(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE6

ASHGO_5.PE6          Location/Qualifiers
FT   CDS_pept        10760..11911
FT                   /codon_start=1
FT                   /gene_family="HOG000154325" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755764"
FT                   /gene_name="SIL1"
FT                   /locus_tag="AEL340W"
FT                   /product="Nucleotide exchange factor SIL1 "
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="endoplasmic reticulum lumen "
FT                   /protein_id="AAS52344.1"
FT                   /db_xref="GO:0005788"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059163"
FT                   /db_xref="HOGENOM:HBG202778"
FT                   /db_xref="UniParc:UPI0000252C18"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758U2"
FT                   /transl_table=1
FT                   /translation="MYWKKLLFAIASAAALAAVDPETEGSELQTICSGGECYPRLFKAL
FT                   QDWSTIKEGQQIPPGLDIRVDLSTGKKQARLPIPNEASNMENGIQVVDDSSDYEFTKEF
FT                   QLVRAQVASGAPDYNVVIKQLDDLVEYASDYTLGYKIITHEFTLLQELIFGQDVPISVK
FT                   ELSSRIIVACLRNNTPCLDFVNTRFPDFVRHLLQEAVDYGRQATDAVEARTQIKRYLSI
FT                   VEPLLINEPQPINEEALKQLYEVNDQTVQLKVLLIMARLYKGRSHNDDISKRSLESTDV
FT                   QRWTTELSKAIQSKHLDDFHVRELFHGLYALKKEHGRAVKTYPTFLGWLAEETEARKQR
FT                   MTQDKQPRDLEQMEFDRLLIESRHMVFGNPMAHRIKNMEYDEL"
     atgtattgga agaagttgct atttgcgatt gcaagtgcag ctgcgctggc tgctgtggat        60
     ccagagactg agggcagcga gctccaaact atctgttcag gaggcgaatg ttatccgagg       120
     ctcttcaagg ctttgcaaga ctggagtaca attaaggagg ggcaacagat cccccctggc       180
     ctggacatca gggttgactt atctacgggc aagaaacaag ctcggcttcc aatccccaat       240
     gaggctagca acatggagaa cgggattcaa gtagttgacg attcttcgga ttatgaattc       300
     accaaagaat tccagcttgt gcgggctcag gtggcgagcg gagcgcccga ttacaacgtg       360
     gtcatcaaac agctggatga tttggtggag tacgcgtccg actatacttt aggatacaag       420
     ataattactc atgagttcac gttgctccag gagttgatat tcggccaaga tgtcccaata       480
     agtgtcaaag aactatcatc tcgcattata gtagcatgcc tgcggaataa cacgccctgc       540
     ttggactttg tgaacacgag gttcccggat tttgtgcgcc atctgttgca agaggctgtt       600
     gactatggcc ggcaagcgac ggatgccgtt gaggcgcgga cccaaatcaa acggtacctc       660
     tcgatagtag agcctctcct aatcaacgag ccccagccga taaacgaaga ggccctgaaa       720
     cagctgtatg aagtgaacga ccaaacagtg caattaaagg tattattaat aatggcacgg       780
     ctctacaaag gcaggagcca taacgatgat atatcgaaaa ggtcactcga gtctactgac       840
     gttcaacggt ggaccacaga actctcaaaa gctattcaga gtaagcacct ggacgacttc       900
     cacgtgcggg aactatttca tggcttgtat gccttgaaga aggagcatgg tagggcggtc       960
     aagacatatc caacgttcct gggatggctc gcggaggaaa cagaggctcg gaagcaacgc      1020
     atgactcaag ataagcaacc aagagatctg gagcagatgg agttcgaccg actgctcatt      1080
     gagagtaggc atatggtgtt cgggaaccct atggctcatc ggataaagaa catggagtat      1140
     gacgaacttt aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page