(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE65

ASHGO_5.PE65         Location/Qualifiers
FT   CDS_pept        108796..110706
FT                   /codon_start=1
FT                   /gene_family="HOG000066017" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755790"
FT                   /gene_name="RPC82"
FT                   /gene_synonym="RPC3"
FT                   /locus_tag="AEL282W"
FT                   /product="DNA-directed RNA polymerase III subunit RPC3 "
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52402.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG059183"
FT                   /db_xref="HOGENOM:HBG397909"
FT                   /db_xref="InterPro:IPR008806"
FT                   /db_xref="InterPro:IPR013197"
FT                   /db_xref="UniParc:UPI0000252C52"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758N7"
FT                   /transl_table=1
FT                   /translation="MNGSMGAAGGQVENERAAEVPVSTLEMRTLSPETFLYTEVARSHL
FT                   GERAGRVIELLLNKGRLSVSELVHLAPELGSKSVRTVLVSLIQLRCVQYLEETTVSGRK
FT                   ITYYYFNEDGFQLMLYAGDIVAAVESQFEADDAKEIAAQIVQNVLALGSLTTKDYMQSL
FT                   ASDVSVNDVASMFVKLVELGFLVPLSNVHYMPLADLWDVLYKKEYNAIPKNSTLSDAKK
FT                   RAETKAKTKVQFNTLLKNVEMSNVLMTDMQTSMRRVQDNLPLTFNFGRYMKHRRSRQLV
FT                   QFARSRVGSVPAMIYKVALKITEQCARALSDPLCETGLMQELEEQLAIQEDMALDDEKL
FT                   PGVTFNAVDISRNLPNNIDLRGTLTSMQRRSQERSTHQGQSHKRLKAEDGMAVAVNHLA
FT                   TVEEEAEGDELLHGSDDDMDMFFDEGDSDPKSVSLINGHLKLLSTGSVPFLIESRPGLF
FT                   YVPYSKLMPILKEAVYDAIIASTLGPSAHRILRCVRDNSLVSEKVINNTALMREKDIRS
FT                   VIATLVKYNAVDILEVPRTADRAASRAVFLFKINEKHAYDFMKQNLAWNIANSIHKTEI
FT                   LKEENFTLLSKAQRDDVKGREAELLLPSELNQLKMVNERELNGHARKIRLLSMWEVFKM
FT                   L"
     atgaacggat ctatgggtgc tgcaggtgga caagtcgaaa acgagcgtgc tgcggaggtg        60
     ccggtatcga cactggagat gaggacattg agtcctgaaa ccttcctgta cacagaggta       120
     gcgcggtcgc acctcggcga gcgagccgga cgtgttattg agctacttct gaacaagggg       180
     cgtctgtctg tctcagagct ggttcacctc gcgcctgagc tcggctcgaa aagcgtgcga       240
     actgtgttgg ttagcttgat acagttgcgc tgcgtgcaat atctcgaaga gacgaccgtc       300
     tcgggacgga agatcacata ctactatttc aatgaggatg gatttcagct gatgctttat       360
     gcgggtgata ttgtggcggc cgtagagagc cagtttgagg cggatgatgc gaaggagatc       420
     gccgcgcaga ttgtgcagaa cgtgcttgca ctagggtctc ttacgacaaa ggactacatg       480
     cagtcgttgg cttccgatgt ttctgtgaat gatgtggcgt ccatgtttgt gaagctggtt       540
     gaactaggct ttctggtccc gctttccaac gtgcactaca tgccactggc cgatctatgg       600
     gatgtgctct acaagaagga atacaatgct attccaaaga attcgacgtt gtcagatgcc       660
     aagaaacgtg cagaaacaaa ggcgaagacg aaggttcagt tcaatacgtt gctgaagaat       720
     gtcgaaatga gcaacgtact aatgactgat atgcagactt caatgagacg tgtccaagac       780
     aatcttcctc taacatttaa cttcggccgg tacatgaagc accggcgttc tcggcagctt       840
     gtacagtttg cacgttcccg tgtggggagc gtaccagcca tgatctataa ggtggcactg       900
     aagataaccg aacaatgtgc ccgtgcgctt tcagatccgc tatgtgagac aggcctaatg       960
     caggaacttg aggagcaact ggctattcag gaagatatgg cgctagacga tgagaagcta      1020
     ccgggcgtta cattcaatgc ggtggacata tccagaaact taccaaataa catagaccta      1080
     cgtggcacac tgacttctat gcaaagaaga tcacaagaac gtagcacgca ccaaggtcaa      1140
     tcccataagc ggctgaaggc tgaagatggg atggctgtag cagtcaacca ccttgctact      1200
     gtagaggagg aagccgaagg agatgaattg ctccatggca gcgatgatga catggatatg      1260
     ttctttgacg agggtgacag cgaccctaag tctgtttcac tgataaatgg ccatttgaaa      1320
     ttgctttcga caggctccgt accatttttg atagagtcaa ggcccggtct attctacgtc      1380
     ccttattcaa aactcatgcc aatattaaaa gaggccgtat acgacgcaat aatagcatcc      1440
     actcttggtc catctgcaca tagaatttta cgttgtgtga gagataacag cttggtatct      1500
     gagaaggtta tcaacaatac cgctctaatg agggagaagg atatcaggtc tgttattgcc      1560
     accctggtga aatacaatgc agttgacata ctggaggtcc cacgtacagc tgatcgtgct      1620
     gcttcgaggg ccgttttctt gttcaagatc aatgaaaaac atgcatacga tttcatgaag      1680
     caaaatttgg cttggaatat tgccaactct attcacaaaa cagaaatact aaaggaagag      1740
     aacttcacgt tattatccaa agcccaaaga gatgacgtga aaggaagaga agcggagtta      1800
     ttacttccaa gcgaattaaa tcaattaaag atggtcaatg agcgtgagct gaacggccat      1860
     gcaagaaaaa taagactact atccatgtgg gaagtcttca aaatgcttta g               1911
//

If you have problems or comments...

PBIL Back to PBIL home page