(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE70

ASHGO_5.PE70         Location/Qualifiers
FT   CDS_pept        complement(117929..119908)
FT                   /codon_start=1
FT                   /gene_family="HOG000034130" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081014"
FT                   /gene_name="ATG13"
FT                   /locus_tag="AEL277C"
FT                   /product="Autophagy-related protein 13 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52407.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG059207"
FT                   /db_xref="HOGENOM:HBG204015"
FT                   /db_xref="InterPro:IPR018731"
FT                   /db_xref="UniParc:UPI0000252C57"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758N2"
FT                   /transl_table=1
FT                   /translation="MAMESECNVVELIGGFFLKATLLVCQPRTGAIEGDGEEDRTFNIS
FT                   SAADAGVAEAVRAWTAYDGAQELPPLVIEMFLDLRRLGPQHTVVLKDQDGNPWNVCKGG
FT                   KKSEIMLERWLVELDVGNEEARPEEPPNAAEIYKQLVLLFRYLYTLTQLLPANELYARL
FT                   HGPSNQGEAAMPLINIGTRILDGSKPILSKGRVGLSRSIIATYTNVINETNVASHLEQK
FT                   KITPISTGYGSLRITVSYRRDCNFDVNEVLDYEGNNCSSSSVVDTHTKPGVGPLSSLRR
FT                   VSIHSNRSMSISPQTVYSGTVIPDPSPQRKSSSSRIQPFKAGSVGSGSLAIARNPSGSS
FT                   AVATLRAQRSGSASISTHVADQAVGEPSSVGSGGSKYSSSFGKIRRQSSMRRSGSLELP
FT                   AAKQAKPGERGSDELLDFVKMLEEKQELNVKKLYGTTTDISSSLVRFQSMKSNNDTLSE
FT                   DLSMSYSLEPTHAPQVRYRSNSHSPIPSISPSVQYTSIPMRLSQSRNVSQTELASRKNS
FT                   AERLKTLISSRTGSFSESRRQSNAGQEDILEDEDDEAEEILLSKSHLSNPTGTRLQSMS
FT                   PQSLKSISSYNRAAVPFKPVSNFSCPTTMATPAHAKLHKASISSSPDNQSGLVKKDHEH
FT                   STMTGGDDDDDLLFFMSDMNLSSQ"
     atggctatgg aatcggaatg caatgtggta gagctgatcg gcgggttctt cctgaaggcg        60
     acgctgcttg tgtgccagcc tcggacgggg gcaattgaag gggatggtga ggaggaccgg       120
     acgtttaata tcagcagcgc ggctgatgcg ggcgtggcgg aggcggtgcg ggcgtggacg       180
     gcctacgacg gggcgcagga gttgccgccg ctagtgatag agatgttcct ggacctgcgg       240
     cggctggggc cacaacacac ggtggtgctg aaggaccagg acggcaaccc gtggaatgtt       300
     tgcaagggcg ggaagaagtc tgaaatcatg ctggagcggt ggttggtcga actggacgtg       360
     ggcaatgagg aggcgcgccc ggaggagcca cccaatgcgg ctgagatata caagcagctg       420
     gtgctactgt tccgctatct gtacacgctg acgcagctac tccccgcgaa cgagttgtac       480
     gcacggctgc acgggccttc taaccagggc gaggcagcaa tgcctttgat caatataggg       540
     acacgtatac tggatggctc caagcctatc ctgtcgaaag gtcgcgtggg gcttagcaga       600
     agtattatcg ccacctacac gaatgtaatc aacgagacca atgtggcctc tcatctggaa       660
     caaaaaaaga tcactccaat cagcacgggc tacggctcac tgcggattac agtatcctat       720
     cgacgtgact gtaactttga cgtcaacgag gttttagatt atgaaggcaa taactgcagc       780
     agcagctctg ttgtcgatac acacacgaaa cctggagtgg gcccgctatc ttcattaagg       840
     agagtgtcaa tccacagtaa tcgatccatg tctatttctc cccaaacggt ttacagcggg       900
     actgtgatcc ccgatccatc ccctcaaaga aagtcatctt cttccagaat acaaccattc       960
     aaggctggct ctgttggaag cggctccctc gcaatcgcga ggaatccatc tggttcatct      1020
     gctgtcgcca ccctgagagc gcagaggtcc gggagcgcat ccatctctac gcatgtggcc      1080
     gaccaagccg ttggcgaacc gtccagcgta ggcagcggcg ggtccaaata ttcatcttcc      1140
     tttggtaaaa taaggcgaca gtcaagtatg cggcggtctg ggagtcttga attgcctgcc      1200
     gctaagcaag cgaaacctgg tgagcgcgga tctgatgagt tgctagactt tgtgaagatg      1260
     ttggaggaaa aacaggaact aaatgtgaag aagctatacg gtactaccac cgacatctcc      1320
     agctcgttag tccgttttca atcaatgaaa tcaaacaacg atacactaag cgaagaccta      1380
     tctatgagct actcgctgga gcctacacat gctcctcagg taaggtatag gtctaactcg      1440
     cattcgccca ttccatccat ctctccctct gtacaataca cctctatccc gatgagactt      1500
     tcccaaagtc gcaacgtaag ccaaactgaa ttagctagca gaaagaactc tgctgaaagg      1560
     ctgaaaactt tgatttcgag taggacaggt agcttctcgg agtccaggcg ccagtcaaat      1620
     gcgggacaag aggatattct cgaagatgag gatgatgagg cagaagagat cctattgagc      1680
     aagtcgcatc tcagcaaccc tacaggaaca agattgcaat caatgtcgcc gcaatcctta      1740
     aaaagcattt cctcgtacaa tagagcggca gtgccgttca agcctgtttc taacttttca      1800
     tgtcccacta caatggctac ccctgcacat gcaaaattac acaaggcaag tatcagttca      1860
     tcaccagata atcagtccgg cctggtcaaa aaggaccacg agcacagcac aatgacgggc      1920
     ggtgatgatg atgacgactt gctattcttt atgagtgata tgaacctatc tagccaatga      1980
//

If you have problems or comments...

PBIL Back to PBIL home page