(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE75

ASHGO_5.PE75         Location/Qualifiers
FT   CDS_pept        128350..130620
FT                   /codon_start=1
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081016"
FT                   /gene_name="SEC23"
FT                   /locus_tag="AEL272W"
FT                   /product="Protein transport protein SEC23 "
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="AAS52412.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG021213"
FT                   /db_xref="HOGENOM:HBG520631"
FT                   /db_xref="HSSP:1M2V"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI0000252C5C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758M7"
FT                   /transl_table=1
FT                   /translation="MDFEQNEDINGVRFSWNVFPASRTDANKNVVPVGCLYTPLKEIEE
FT                   LAVVSYNPVVCGGPHCKAVLNPYCEIDVRSNVWACPLCGTRNHLPQHYANMSQEAMPAE
FT                   LNSTTVEYITNRPVQVAPIFFYVVDVTAEEENLQALKDSIITSLSLLPPNALVGLITYG
FT                   NVVQLHDLSCTAIDKCNVFRGDREYQLQQLVEMLTGEKSGGNLSAGPQMKITPFSLNRF
FT                   FLPLEHVEFKLTQLLENLRPDQWTIPPGHRPLRATGSALNIATLLLQGCYRHVAARICL
FT                   FASGPGTVAPGMIVSSELKDPLRSHHDIDSDNAKHHKKACKFYNQLAERAAENGHTIDI
FT                   FAGCYDQVGMSEMKKLTDSTGGVLLLTDAFSTAIFKQSFIRLFSKDEEGYLTMAFNASM
FT                   CIKTSADLKLQGLIGHASPVNVDAQNVSDSEIGIGGTSTWKMASLSPHHSYAIFFEIAN
FT                   TAATASLMGDRPKLAYTQFITAYQHASGTNRVRVTTVANQMLPFGNPAIAASFDQEAAA
FT                   VLMARVAVDKADSDDGADVIRWIDRTLIKLCQKYADYNKGDPRSFRLAPNFSLYPQFIY
FT                   YLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSMEEEPQPVLLDSVS
FT                   VKPNTILLLDTFFYILIYHGEQIAQWRKAGYQDDPQYADFKSLLEEPKLEAAELLVDRF
FT                   PLPRFIDTEAGGSQARFLLSKLNPSDSYQNQSAAGSTIVLTDDVSLQNFMIHLQDVCVN
FT                   GQN"
     atggatttcg aacagaacga agacataaac ggggtgcggt tctcgtggaa tgttttcccg        60
     gcgtcccgga cggacgcgaa caagaacgtg gtgccggtgg gatgcctgta cacgccgctg       120
     aaggagattg aggagctggc ggtggtctcg tacaacccgg tggtgtgtgg tgggccacac       180
     tgtaaggcgg tgctgaaccc gtactgcgag atcgacgtgc ggtcgaacgt gtgggcgtgc       240
     cctctgtgcg ggacgcggaa ccatcttccg cagcactatg cgaacatgtc tcaggaggcg       300
     atgcccgcgg aactgaactc cacgacggtt gagtacatca caaatcggcc ggtgcaggtg       360
     gcgccgatct tcttctacgt cgtggacgta accgcggagg aggagaacct ccaggcgctg       420
     aaggattcga tcatcacctc tctgtcgttg ctgcccccca acgcgcttgt tgggctgatc       480
     acttacggta atgtagttca gctgcacgat ctttcatgca cagcaataga caagtgcaac       540
     gtgttccgcg gcgacaggga gtaccagcta cagcagctag ttgagatgct gacgggagag       600
     aaaagcggtg gtaacctgtc ggccgggcca caaatgaaga tcacgccatt ttcgctgaac       660
     aggttcttcc ttcccctcga gcatgtcgag ttcaagctca ctcaattgct ggagaacctg       720
     cggcccgacc agtggacaat cccaccggga cataggcctc tacgggctac ggggtctgcg       780
     ctgaatattg caactcttct attgcagggg tgctacaggc acgtggccgc caggatctgc       840
     ttgtttgcat caggtccagg tactgtggcg ccgggtatga ttgtttcttc tgagctaaag       900
     gaccccctaa ggtcgcatca cgatattgat tcggacaatg ccaagcacca caagaaggca       960
     tgcaaattct acaaccagct ggcggagaga gcggcggaga acggacacac aatcgatatc      1020
     tttgctggat gctacgacca ggttggtatg tctgagatga agaagttgac cgactccact      1080
     ggtggtgttt tgttgttgac tgacgcattc tcgacggcca tcttcaagca atctttcatc      1140
     agactgtttt ctaaagatga ggagggctac ctaaccatgg cgttcaatgc ttccatgtgc      1200
     attaaaacca gtgcagatct aaagctgcag ggactgattg gccatgcttc gccggttaac      1260
     gttgatgcac agaacgtgag cgattcagaa atcggtattg ggggcacttc tacatggaaa      1320
     atggcgtcct tgagccctca ccactcttac gctatctttt tcgagattgc aaataccgct      1380
     gcaactgcca gcctcatggg ggacagacca aaattggcat acacccaatt cattactgca      1440
     taccagcatg catctggtac caaccgtgtc agagtgacta cagttgctaa ccagatgttg      1500
     ccattcggta acccggcaat cgctgcttcc tttgaccagg aggccgctgc tgtactaatg      1560
     gcgcgtgttg cagtcgataa ggcagattcc gatgatggcg ctgacgtcat ccggtggatc      1620
     gatagaactt tgatcaagct ttgccagaag tacgccgact acaacaaggg cgacccccgc      1680
     tccttccgct tggcaccaaa cttttcccta taccctcaat tcatctacta cctacgcaga      1740
     tcacagtttc taagcgtgtt caacaactcg cctgatgaaa ctgcgttcta caggcacatt      1800
     ttcacgcgtg aggacactac caactcctta atcatgatcc aacctactct aacctcgttc      1860
     tctatggaag aagagccgca accagtcctt ctggattctg tttcggtcaa gccgaacacc      1920
     attttgctgc tggacacctt cttctatatc ttaatctacc atggcgagca gattgctcag      1980
     tggagaaagg ctggctacca agacgacccg cagtatgcgg atttcaagtc tctgttagag      2040
     gagcccaagc tcgaggctgc agaattgctg gtagacaggt ttccgctgcc acgtttcatc      2100
     gataccgagg caggcggttc gcaagcccgt ttcttgctgt ccaaattgaa cccctctgat      2160
     agttatcaaa accagtccgc tgcaggctcc accattgtgt tgaccgatga tgtttcccta      2220
     caaaacttca tgatccatct acaggatgtc tgtgtcaacg gccaaaacta a               2271
//

If you have problems or comments...

PBIL Back to PBIL home page