(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE80

ASHGO_5.PE80         Location/Qualifiers
FT   CDS_pept        complement(136477..138510)
FT                   /codon_start=1
FT                   /gene_family="HOG000246706" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756847"
FT                   /gene_name="DPB2"
FT                   /locus_tag="AEL267C"
FT                   /product="DNA polymerase epsilon subunit B "
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52417.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG059259"
FT                   /db_xref="HOGENOM:HBG398250"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="UniParc:UPI0000252C61"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758V1"
FT                   /transl_table=1
FT                   /translation="MDRGSALPAEISPQLLRPLAYRVLSKKYGLHIKSDGLAQLAKFIG
FT                   NAFGVDWRRSAETMQFLERFAAIWREQERGLFVDALGVDAVTQELRERNKTAKQRRPAR
FT                   ARETTLDALVRPTEAYSAVESSGGDVTATEPMDEDTVREEPLDWTHYFKVIDTFSQQQF
FT                   TYDVTKRRYRLVQQRESAAGPLSTLLRIPSLEANLAQFPTRYHLVRDRVLRNASFQNDD
FT                   VYNPLSSMQQLQQQLDAGGAPLASTAYMSITQIKNLLGRDGKNFLLLGLIRKDSKGFWS
FT                   LEDPSGSIEIDISETYPTKGTYYVPGCIVLAEGIYSSAGNRFRVSSITHPPGERREAFL
FT                   EAIGNLDLLGIHGPSNESYISRLDKELKIRLHYLEKELTDHRFVFLGGNIFLDDTMTET
FT                   ALAKLFDVLEHDPPTVLVLPGSFTSTPIYPSSDSKSSSSTAAYRANFDALAKLLSKYER
FT                   LINETTFVFIPGDNDPWGSMAYLGVAGTLPQHPIPGDFVTKVNRICKHVVWGSNPTRIA
FT                   YLSQELVIMRDDMCNRFKRNSIIFPTVEEEQKQEYMLLQQELQDDERSSDLSISQLIKS
FT                   RDQLPASVQESRKIVKTILDQQHLSPFTSQVRPITWDYDYTLHLSPIPSTMIICDPTAP
FT                   KYDVTYNGCKSINPGSFLHKRSVNYTEYTPSLRKATEEEIVV"
     atggatagag gtagcgccct gcctgcggag atctcgccgc agctgctgcg gccgttggca        60
     tacagggttc tgtccaaaaa gtacggtctc catatcaaat ctgatgggct ggcacagctg       120
     gccaagttta ttgggaatgc gttcggggtt gactggcggc ggagcgcaga gacgatgcag       180
     ttcttggagc ggtttgcggc gatctggaga gagcaggagc gcgggctgtt tgtggatgcg       240
     ctgggtgtgg atgcggtgac gcaggaattg cgagaacgga acaagactgc gaagcagcgg       300
     cggcccgcga gagcacggga gactactctg gacgcacttg tgcggccgac agaggcatac       360
     agtgcggtgg agagctccgg gggcgatgtg acggcgactg agcctatgga tgaggacacg       420
     gtacgcgagg aaccgctgga ctggacgcac tacttcaagg tgattgacac gttcagccag       480
     cagcagttca catacgatgt aactaagagg cggtatcggc tggtgcagca gcgcgagtcg       540
     gcagcggggc cactatctac gttgctgcgc attcccagtc ttgaagccaa cctggcgcag       600
     tttcccacgc gctaccatct ggtgagggac cgtgtgctac gcaatgcgag ctttcagaac       660
     gacgatgtgt acaatccgct ttcttccatg cagcagctcc aacagcaact ggatgccggc       720
     ggtgcacccc tcgcttccac tgcttacatg tcaattacac agataaagaa cctgctggga       780
     cgagatggta agaacttttt gctattggga ctcattcgga aagatagcaa ggggttctgg       840
     tcgctggagg acccatcagg cagtattgag atcgacatct cggaaaccta tcccacgaaa       900
     ggcacatact acgttcctgg gtgcattgtg ctagctgaag gtatctatag ctctgcagga       960
     aaccgattcc gcgtatcatc catcacacac cctccaggtg aacgacgaga ggcatttttg      1020
     gaggcgatcg ggaatctgga tctgctagga atccacggcc catctaacga gagctacatc      1080
     tcgcgactgg acaaagaact gaagatacgg cttcactacc tagaaaaaga gttgacagat      1140
     catagattcg tattcctggg cggcaatata tttttggatg atactatgac ggaaaccgcg      1200
     cttgccaagc tctttgatgt gcttgagcat gatccgccta ccgtgcttgt acttccggga      1260
     tcctttacct ctaccccgat ttatccttca tccgacagta agtctagcag ctcaactgct      1320
     gcatacaggg ctaattttga tgcgttagca aaattactat caaagtatga gcgtttgatc      1380
     aatgaaacta cctttgtatt cataccagga gataacgatc cctgggggtc aatggcctac      1440
     ctcggagtgg caggcacgtt gccgcaacat ccaatacctg gtgattttgt caccaaagtt      1500
     aacagaatat gcaagcacgt tgtgtgggga tccaatccaa caaggatcgc ctacttgtct      1560
     caggaacttg ttatcatgag agatgatatg tgcaacaggt ttaagcgcaa tagcattatt      1620
     ttcccaacag tggaagagga acagaaacag gaatacatgc tgttacagca ggagctccag      1680
     gatgatgaac gtagttcgga tctctccatt agtcaactga ttaagtccag ggaccaattg      1740
     cctgccagtg tccaggagtc caggaagata gtcaaaacca tcctcgatca gcaacacctt      1800
     tcgcccttta cctcgcaggt gcgccctata acgtgggact atgactacac gttgcacctg      1860
     tccccaatac cctccactat gatcatttgc gacccaactg caccgaaata tgatgttact      1920
     tacaacggct gcaagagtat caatccaggc tcatttctcc acaagcggag cgtcaactat      1980
     actgagtaca ctccttcgtt acggaaagca acagaggaag aaattgtcgt gtag            2034
//

If you have problems or comments...

PBIL Back to PBIL home page