(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE87

ASHGO_5.PE87         Location/Qualifiers
FT   CDS_pept        complement(147826..149352)
FT                   /codon_start=1
FT                   /gene_family="HOG000093386" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081018"
FT                   /gene_name="JIP5"
FT                   /locus_tag="AEL261C"
FT                   /product="WD repeat-containing protein JIP5 "
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS52424.2"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="HOGENOM:HBG059267"
FT                   /db_xref="HOGENOM:HBG395775"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0001DB2993"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758M2"
FT                   /transl_table=1
FT                   /translation="MGKKKNSKAYSEELTDTTRPLLEFRYGNPLFAIACHPEQSVIVSG
FT                   LATGHMFCHKYNAAELKEAQLKRLRKHDAGSKDDRKKLWEVVEVPGVETSGVSLLWTTK
FT                   RHKGSVRCICFDADGTHIYSVGTDNVLKKADTLTGKVVKKCVLDPGQNVKYTKLVKSAT
FT                   HPLVLLGDENGNVTVLNSESLEQTNLIKSIHNGDAINDIFHFAKKSVYRYISLGQTTLA
FT                   HWDSRESNEGDFAIAADDKQAKRKVILSDDQEDEILCGTFVDPEDGEVLVCGMGEGVLT
FT                   VWRPKKNGLADQLTRIKVKKNESIDCIVPTLEDDGCVWCGCSDGNIYKVHVNRGTIIEV
FT                   RKHSKLDEVTFLDLDSEYRLLSGGLDKAKLWDSEKSEQLTPGSDADDRVSNSSPSAGKS
FT                   SESDSNDSENDATSSGGSSDEDSSSDESEHSDASDVEEELVGLTREQIIAELDKDLVEE
FT                   SEDVEDVRSQRKRKHGADLPTNANGKKQKGKNIKPERSMKTHGIRRFEGL"
     atgggaaaga aaaagaactc caaggcatat tcggaagaat taacagatac caccaggccg        60
     ctactagagt ttagatatgg caatcctctc tttgcgattg catgccaccc agaacagtca       120
     gttatcgtta gcggtttagc aactggccac atgttctgtc ataagtacaa tgcagcagag       180
     ctaaaagaag cacaattaaa aagactacgg aagcatgatg ccggttctaa agacgatagg       240
     aagaagttgt gggaagttgt ggaagtgccg ggcgtggaaa ctagtggcgt ttctttactc       300
     tggactacga agcggcataa gggaagtgtt cgatgcattt gctttgatgc agatggaaca       360
     catatctatt ctgttggtac agataatgtc ttgaaaaagg ccgatacatt aacagggaag       420
     gtcgtgaaga aatgtgtgct ggaccctggc cagaacgtca aatatacgaa actagtcaag       480
     tctgcaacac atcctttggt tttgttgggt gacgagaatg gcaatgttac tgtactaaat       540
     agtgagtctc ttgagcaaac gaacctaatc aaaagcattc acaatgggga cgccataaat       600
     gacattttcc atttcgcaaa gaaatctgtc tatagatata tttctctcgg ccagacaact       660
     cttgctcatt gggattctag agaatcaaat gagggtgatt ttgcaattgc cgccgatgat       720
     aagcaagcaa aacggaaagt tattttgagc gatgatcaag aggatgagat attatgtggc       780
     acgttcgttg atccggagga cggcgaagtt ctggtctgtg gcatgggcga aggcgttctc       840
     accgtctgga ggcctaaaaa gaacggcctg gcagaccagc tgactcgtat aaaagtaaaa       900
     aagaatgaaa gtatagactg cattgttcca acattagagg acgatggctg tgtttggtgc       960
     ggatgttctg atggcaatat atacaaggtg catgtgaacc gtggtacaat tattgaggtt      1020
     aggaaacaca gtaagttgga tgaggttacc ttcctggatc tggattctga gtatagactc      1080
     ctttctggtg gcttggataa ggcgaagttg tgggattcag agaaaagtga gcagctcact      1140
     ccgggaagtg atgccgatga ccgtgtatct aattcatcac caagcgcagg caagtcttct      1200
     gagagcgatt ctaacgactc tgagaatgat gctactagtt cggggggctc ctccgatgaa      1260
     gatagctcct ccgatgaatc tgagcattca gacgcatcgg acgtagagga agagttagtg      1320
     gggctaactc gggaacagat cattgccgaa ctggacaaag atttggtgga ggagtctgag      1380
     gatgtggagg atgtacgctc gcaacgtaaa agaaagcatg gtgccgacct gccaaccaat      1440
     gcgaatggca agaagcagaa gggtaagaat atcaagcctg agcgctccat gaagacgcac      1500
     ggcatccgta gatttgaagg tttatag                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page