(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE88

ASHGO_5.PE88         Location/Qualifiers
FT   CDS_pept        complement(149467..149922)
FT                   /codon_start=1
FT                   /gene_family="HOG000001009" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929688"
FT                   /gene_name="NUT2"
FT                   /gene_synonym="MED10"
FT                   /locus_tag="AEL260C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 10"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS52425.2"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG059268"
FT                   /db_xref="HOGENOM:HBG395603"
FT                   /db_xref="InterPro:IPR019145"
FT                   /db_xref="UniParc:UPI0001DB2994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758M1"
FT                   /transl_table=1
FT                   /translation="MDQQDLNKLQTNLSDAEIRLASIIESFIELGVSVYDFPGTQESTQ
FT                   GMVTNLKRNVERIKLLNQHANDPDSQLRNMNIPLEVLQYIEDGRNPDVYTREFVEAIRR
FT                   SNQYQRAKMHALKKLRDSLAEKIGEEFPDLVPQVQGIIERANGSRDK"
     atggatcagc aagacctaaa caagctccaa accaatctat ctgatgctga gatacgactg        60
     gcctccatta ttgaatcgtt catagagctt ggcgtttctg tgtatgattt ccctggaacg       120
     caggaatcta cacaaggcat ggtcaccaac ctgaagagga acgttgagcg tatcaaactg       180
     ctaaaccaac atgcaaatga tcctgattcg cagctgcgca acatgaacat cccactagag       240
     gtcctacagt acattgaaga cggccggaac cccgatgtgt acacaagaga gtttgttgag       300
     gcaattcgtc gctcaaacca gtaccagaga gcaaagatgc acgcgctgaa aaaattgaga       360
     gactcactag ctgagaagat cggagaggag ttcccagacc tagtacctca agttcagggt       420
     atcatcgaga gggccaatgg gtcccgtgat aaatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page