(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE98

ASHGO_5.PE98         Location/Qualifiers
FT   CDS_pept        join(complement(166901..166971),complement(166113..166752))
FT                   /codon_start=1
FT                   /gene_family="HOG000158315" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624153"
FT                   /gene_name="ATP4"
FT                   /locus_tag="AEL251C"
FT                   /product="ATP synthase subunit 4, mitochondrial "
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="AAS52434.2"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="HOGENOM:HBG057729"
FT                   /db_xref="HOGENOM:HBG328743"
FT                   /db_xref="InterPro:IPR008688"
FT                   /db_xref="InterPro:IPR013837"
FT                   /db_xref="UniParc:UPI0001DB29A9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758L2"
FT                   /transl_table=1
FT                   /translation="MAFRALTTKAAARPLLALGPRSVAMGARYMSTPAPQDPKSKAAAI
FT                   LDSLPGSTALSKTGILATSAAAAIYAISNELYVLNAETILLCTFTGFSFLIAKLVAPAY
FT                   KEYADKRMQHVSGILNSSRNKHVAAVKERIESVSELKNVTETTKVLFEVSKETLELEAK
FT                   AFELKQKVDLATEAKAVLDSWVRYEASVRQLQQKQIAESVIGKVQAELANPKFQDKVLQ
FT                   QSVADVEKLFASLK"
     atggctttcc gtgctttgac taccaaggct gctgctagac cattgctagc attgggccct        60
     cgcagtgttg cgatgggtgc tcgctacatg tccaccccag ctcctcagga tcctaagagc       120
     aaggcggcgg ccatcctgga ctctctgcca ggtagcactg cgctatccaa gactggtatc       180
     ttggctacct ctgcagcagc cgcgatatac gccatctcca atgaactgta tgttttgaac       240
     gctgaaacca ttctgttgtg taccttcacc ggcttttcgt tcttgatcgc gaagctagtc       300
     gcaccagctt acaaggagta cgctgacaag agaatgcagc atgtttctgg tattctaaac       360
     tcctccagaa acaagcacgt cgctgctgtc aaggaaagaa tcgagtctgt gtctgagttg       420
     aagaacgtca ccgagacgac aaaggtgctg ttcgaggttt ccaaggagac tttggaactt       480
     gaggccaagg ccttcgagtt gaagcagaag gttgacctag ccactgaggc gaaggctgtt       540
     ttggattcgt gggtgagata cgaggcttct gtgcgtcagc tacagcagaa gcagatcgct       600
     gagtctgtca tcggcaaggt gcaggctgag ttggctaacc ctaagttcca ggacaaggtg       660
     ttgcagcagt ctgtcgctga tgtcgagaag ctattcgcca gtttgaaata a                711
//

If you have problems or comments...

PBIL Back to PBIL home page