(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_6

ID   ASHGO_6; SV 5; linear; genomic DNA; GRV; FUN; 1836693 BP.
XX
AC   AE016819_GR;
XX
DT   01-SEP-2009 (Rel. 111, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 18)
XX
DE   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-
DE   1056) chromosome VI, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Eremothecium.
XX
RN   [1]
RX   PUBMED; 15001715.
RA   Dietrich F.S., Voegeli S., Brachat S., Lerch A., Gates K., Steiner S.,
RA   Mohr C., Poehlmann R., Luedi P., Choi S., Wing R.A., Flavier A., Gaffney
RA   T.D., Philippsen P.
RT   "The Ashbya gossypii genome as a tool for mapping the ancient
RT   Saccharomyces cerevisiae genome.";
RL   Science 304:304-307(2004).
XX
CC   This Genome Reviews entry was created from entry AE016819.5 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1836693
FT                   /culture_collection="ATCC:10895"
FT                   /organism="Ashbya gossypii"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /strain="ATCC 10895 = CBS 109.51 = FGSC 9923 = NRRL Y-1056"
FT                   /strain="ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome VI"
FT                   /chromosome="VI"
FT                   /db_xref="taxon:284811"
FT                   /db_xref="taxon:284811"
FT   source          29053..89763
FT                   /clone="BAC clone bAG2564"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          89666..147977
FT                   /clone="BAC clone bAG1587"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          116449..197112
FT                   /clone="BAC clone bAG2422"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          176039..227038
FT                   /clone="BAC clone bAG1668"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          233999..311485
FT                   /clone="BAC clone bAG2166"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          290384..354254
FT                   /clone="BAC clone bAG1930"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          341173..401664
FT                   /clone="BAC clone bAG2002"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          401586..425221
FT                   /clone="BAC clone bAG2080"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          407411..461926
FT                   /clone="BAC clone bAG2224"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          442192..502222
FT                   /clone="BAC clone bAG1894"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          497430..561198
FT                   /clone="BAC clone bAG1841"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          550895..601595
FT                   /clone="BAC clone bAG1903"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          580104..628149
FT                   /clone="BAC clone bAG2033"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          636286..715959
FT                   /clone="BAC clone bAG2107"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          677067..752846
FT                   /clone="BAC clone bAG2527"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          715893..794333
FT                   /clone="BAC clone bAG2313"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          791672..860856
FT                   /clone="BAC clone bAG2358"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          835634..903842
FT                   /clone="BAC clone bAG2194"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          891641..955641
FT                   /clone="BAC clone bAG1538"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          930590..1012642
FT                   /clone="BAC clone bAG1865"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1004025..1060602
FT                   /clone="BAC clone bAG2191"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1034780..1097597
FT                   /clone="BAC clone bAG2093"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1069955..1141967
FT                   /clone="BAC clone bAG1561"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1103574..1144248
FT                   /clone="BAC clone bAG2417"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1160118..1246169
FT                   /clone="BAC clone bAG2404"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1235917..1269406
FT                   /clone="BAC clone bAG1650"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1263458..1335273
FT                   /clone="BAC clone bAG2318"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1311966..1369835
FT                   /clone="BAC clone bAG2457"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1342188..1393032
FT                   /clone="BAC clone bAG2161"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1369700..1456751
FT                   /clone="BAC clone bAG2545"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1456609..1536890
FT                   /clone="BAC clone bAG2180"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1546882..1597932
FT                   /clone="BAC clone bAG1219"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1573100..1624580
FT                   /clone="BAC clone bAG2408"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1595424..1640045
FT                   /clone="BAC clone bAG1953"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1622989..1679451
FT                   /clone="BAC clone bAG1888"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1679379..1735976
FT                   /clone="BAC clone bAG1779"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1738272..1802897
FT                   /clone="BAC clone bAG1919"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   CDS_pept        786..2618
FT                   /codon_start=1
FT                   /gene_family="HOG000144404" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930828"
FT                   /locus_tag="AGOS_AFL235W"
FT                   /product="AFL235Wp"
FT                   /protein_id="AAS53139.2"
FT                   /db_xref="HOGENOM:HBG429282"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI0001DB2921"
FT                   /db_xref="UniProtKB/TrEMBL:Q755P8"
FT                   /transl_table=1
FT                   /translation="MRLKRYSLRLKSLPIVSVLLAVAISTISLGLMSQGYFGSRLASAM
FT                   EGFRTSSSSFYENRFNSGSSSLKEMFKESEDTSDAPNKEQLCKQYFQLTYRNDPSWSNE
FT                   AVRESNSLLNDASYTALLIERMRIFADCFMSGDVQLQAVLPEKSDMFEFHQRMYPFLAK
FT                   GRSWHDIWPTFSDVKTGDTYAPGMLNDGRRVHIDDSVSFWKNWQSFSKGRGIVITAGEE
FT                   HIQMLLRLLAVLDHLGNTLPIELVLTESPSQERIQKIAHYLRDKTKQSLRIVDCKKILE
FT                   PSYRPLIFDFRYKWLAYLLNSFEEVVFIDLDVVPFVSIDKFFEMEGYKSTGILMFQDRV
FT                   FNSIKNSKCRTAIHHILPSHAEQTLWKHQAKYTKEKAKHRLKNFPDDAGAASVYDRYLE
FT                   GDRMHMVESGLVVVDKRKKISSLIISLMLHMNIAECSYGDKEYLWLGQLVSGEDYYIHP
FT                   LPPAILGMPQEVKHDNKKKYEVCSTQIAHMDHDGSILWVNGGMQNCKFPEFADSEVESN
FT                   NEYFSSQHSDKEVLRKFYESPINIQMAFIPNLVDSNWHAIATCNSYTWCAEIKPDFTES
FT                   SSRGNFIISGNDPRLPVYNEIKGIWMHAPSLSDI"
FT   CDS_pept        complement(3695..4267)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761389"
FT                   /locus_tag="AFL234C"
FT                   /orf_name="AGOS_AFL234C"
FT                   /product="AFL234Cp"
FT                   /protein_id="AAS53140.1"
FT                   /db_xref="HOGENOM:HBG059321"
FT                   /db_xref="UniParc:UPI0000252F26"
FT                   /db_xref="UniProtKB/TrEMBL:Q755P7"
FT                   /transl_table=1
FT                   /translation="MERQALLCRYADRSRKYDELKVGQVTSPLSRLVYWWFLSCSLGMM
FT                   YILVLGRSLGGLVAVIVIVLILRQLFEASVLDHDGKGTLWAVGSATVALAMGVFVVCML
FT                   SEWLSLLQPEGGFTIEMYSWDYFSSDVIFDIIGIVSVLLLIVVLLICLLLSLITLFQII
FT                   VYICESIHGFIKPQIGVRLYEEPSSYV"
FT   CDS_pept        complement(5200..5913)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761390"
FT                   /locus_tag="AFL233C"
FT                   /orf_name="AGOS_AFL233C"
FT                   /product="AFL233Cp"
FT                   /protein_id="AAS53141.1"
FT                   /db_xref="HOGENOM:HBG059373"
FT                   /db_xref="UniParc:UPI0000252F27"
FT                   /db_xref="UniProtKB/TrEMBL:Q755P6"
FT                   /transl_table=1
FT                   /translation="MLARKAARRLRGAVATIAVRRRRGLQLAAACSVLSSCVMAACFMF
FT                   RLYACMREHSARTGIALREHGGHVGADTEGLYAAAGPATILQANANFMAHSSFLKAEMT
FT                   SLLLLQLSHAILAVRTIEFFAGPASVPQCFVMVELLLVFGLMALWVSLYMQFACLVLHG
FT                   DSTWRAYAILESATHLALSLFRCMDRWPLLKIEYMLVLLMFGTPVVLTCLTCVALLVRC
FT                   GESSNAPAPRACAAR"
FT   CDS_pept        6883..7707
FT                   /codon_start=1
FT                   /gene_family="HOG000141965" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930829"
FT                   /locus_tag="AGOS_AFL232W"
FT                   /product="AFL232Wp"
FT                   /function="SNAP receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS53142.2"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG344349"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI0001DB2922"
FT                   /db_xref="UniProtKB/TrEMBL:Q755P5"
FT                   /transl_table=1
FT                   /translation="MSFLDLEAHPGERGAGTIAAPAAVQDGEVIGLLTELSTQVQNLRK
FT                   KVQLLGTARDDHTLRNSIESEDIPRCEQLRDRLQSNPRLTGRDKYVSDLHWLTVELLQL
FT                   KRNYQKRKLGSPLRSKSGAADGGAAAPPGHAPPHEEPGRNSYVSIQVRSDERTPLLAQQ
FT                   QILRQQEHVPQEELDFHSLIQEVRSQEISNIHTQVQDVNAIFKQLGTLVQEQGKQVDTI
FT                   DSNINGLTSNLQGANQHLRKAERYQRQRNKCGTLTLCVIAVVTLVVVLAALS"
FT   CDS_pept        complement(7789..9252)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761391"
FT                   /locus_tag="AFL231C"
FT                   /orf_name="AGOS_AFL231C"
FT                   /product="AFL231Cp"
FT                   /protein_id="AAS53143.1"
FT                   /db_xref="HOGENOM:HBG059478"
FT                   /db_xref="UniParc:UPI0000252F29"
FT                   /db_xref="UniProtKB/TrEMBL:Q755P4"
FT                   /transl_table=1
FT                   /translation="MSLPPNHMQNLFGDDAGGSHNTGHGTGGEDVTPALLLEQLAYVDN
FT                   FMTDLDPDFSNLDTLLGDRGSSATTGLPLDERLAAELSAFADESFIFPDEDKHDGEGNA
FT                   DRANEVGGSALSDAWTQSREDAAGNRRAQLLSERRNTFLAAQYDSTRQRFSRQAETPGA
FT                   GDTDHGGFINYDTAPAPAAGDFALDVEQAQAPATGTQVGQRGVTPPSYPNIQMPEYSRI
FT                   PTATLVALLPKVEVPPGALRSLLQVGFTRDQVDAVRAIMAYHQTRGVQSSTGTARTVPS
FT                   LAQRSRMPLQSPSMAYGSVAPVSEARESPAGTADNNSATLFLELLSKQQGRRRSSAEPT
FT                   ERHEEREHRSSVAPEEQQRTWPRTASRDIDTLSNGPLLGDGQSNSDNLSRSAGHPLAEG
FT                   SSAQVAEVKAAYGNTTKAHLRRKQKELELEKSVQELSQLATTLKQRIQTLEMENRLLRN
FT                   IVVEKGEPSKTEKDKATQRQFYPEVHEGA"
FT   CDS_pept        10009..10962
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082178"
FT                   /locus_tag="AFL230W"
FT                   /orf_name="AGOS_AFL230W"
FT                   /product="AFL230Wp"
FT                   /function="signal transducer activity"
FT                   /protein_id="AAS53144.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="HOGENOM:HBG059535"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI0000252F2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q755P3"
FT                   /transl_table=1
FT                   /translation="METIPTLQDLLQGRQRDASGHDGASSTLLMFHEFLRRTHCDENLQ
FT                   FVLMTDGFVAEQADPPVDPGVWNQIYDTFIRRDSPKECNFPESIRSVFDDSFQRQVVPQ
FT                   QEHIVRARKHVLKLLEDAYTKFHRQLVEQGKSCGKTRVPRDSASSSSSGRASLSSASAA
FT                   PANATPGRPLLMSPAESAQALVQPEFAVSDGEDDSIPELISSPTSVDRMWYSRQLAQIP
FT                   TKRVHTHVLQAPDPAPAAQSALLAPCSPPQAPARSPNEAGIPHAGSAAAAAVASTFHSA
FT                   HLIASPLHNAKIRGKKQLFSKFKFGRRSSSSGSLSN"
FT   CDS_pept        11805..13622
FT                   /codon_start=1
FT                   /gene_family="HOG000110941" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761392"
FT                   /locus_tag="AGOS_AFL229W"
FT                   /product="AFL229Wp"
FT                   /function="2-isopropylmalate synthase activity "
FT                   /biological_process="leucine biosynthetic process "
FT                   /protein_id="AAS53145.2"
FT                   /db_xref="GO:0003852"
FT                   /db_xref="GO:0009098"
FT                   /db_xref="HOGENOM:HBG000329"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001DB2B77"
FT                   /db_xref="UniProtKB/TrEMBL:Q755P2"
FT                   /transl_table=1
FT                   /translation="MFRHTLIRLAIGAGRSVTPHKPTYRNMLRDPSKKYKAPLKVPLAR
FT                   RDWPGKTISRAPRWLSTDLRDGNQALSDPMSLEQKKAFFHKLIEIGFKEIEVAFPSASQ
FT                   TDFDFTRYAVENAPDDVSIQCLVQSREHLIRRTVEALRGARRATVHTYLATSDMFREIV
FT                   FNMTREEAITKAVEATRLVRSLTKDDPAQQSTRWTYEFSPECFSETPVEYAVEVCEAVK
FT                   AAWEPTEDNPIIFNLPATVEVASPNVYADQIEYFCKHISEREKVCVSMHTHNDRGCAVA
FT                   ATELGLLAGADRVEGCLFGSGERTGNVDLVTVALNMYTHGISPELDFSDIPDVTRVVER
FT                   CNKIQVHPRTPYGGDLVVCAFSGSHQDAIKKGFAYRDRAREPHWRMPYLPLDPADVGRD
FT                   YEAVIRVNSQSGKGGAAWIIQKTLGLDMPRDMQTRFSTIVQDAADSAGRELQAAEIAAL
FT                   FSQTYNYDKRLSHLELLDYDITRHSPERRELRGIARAGGRQFALSGFGNGPVSAFVDAL
FT                   NNHLHSDLSVAQYAEHSLGSGSSTRAAAFILLSFTGPDGRRASRWGVGVSEDVADASTE
FT                   AVVAAANCILEAGGLQLPKQVRDTISAQN"
FT   CDS_pept        13867..17217
FT                   /codon_start=1
FT                   /gene_family="HOG000179717" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930830"
FT                   /locus_tag="AGOS_AFL228W"
FT                   /product="AFL228Wp"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="AAS53146.2"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG058693"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI0001DB2B78"
FT                   /db_xref="UniProtKB/TrEMBL:Q755P1"
FT                   /transl_table=1
FT                   /translation="MFVLVQREPQRRIAIISKSYALIFKAVKADCGSPGASGASRPLCA
FT                   IELLPKSHLREQNFEKLTNLEVYGFLGLIEIENKIFICTITGKSKVARPIPGETVNKIY
FT                   AVDFFCLNDDRWDFVEFDTNGYSIPTTEEDYASQQTVTKHPCHELKKLLSNGSFYYSSD
FT                   FDLTSLLQYRGLDSHSLSFDDFQEEYMWNSFLMQEIISFRDKLEDQARQVLDDEGFLTT
FT                   VIRGFAETFPTYIGSLPVWVTIISKQSWRRAGTRFNARGIDDEANVANFVETEFIMYSN
FT                   DYCYAFTEIRGSVPIFWEQDTSLINPKVQITRSIEATQPIFDEHFQRLVDKYGPIHVVN
FT                   LLSTKYSEMELSRRYRTHIERSKSLKLDENIFLTEFDFHRETKDQGFSAASRIRPMIER
FT                   SLLENGYFSYDVKENKPISKQRGVFRVNCLDCLDRTNLIQQFISRYAFLLFLQDFQIVK
FT                   SNVVNNMEDYEWFQKHNNLWADHGDAVSQIYTGTNALKSSFSRKGKMSLAGALSDATKS
FT                   VSRMYINNFMDKGKQQNIDSLLGRLPHQQPVQLYDPIKEYVTSKLETMAHEFTKSSKIS
FT                   LLVGTFNVNGLTKKVDITDWLFPIGNKYLPDVVVLGMQEVIELNAGSILNADYSKSNFW
FT                   QQLVNECLNQYNEKYLLLRAEQMSSLLILFFVKSTKVSHIKRVEGGSKKTGFGGITGNK
FT                   GAVAIRFEYGNTSFCFVNCHLAAGISNTEERRSDYESIAKGINFTRSKKVPHHDSIFWL
FT                   GDLNYRLALPNEDVRQILNNKEDGYIEKLLAYDQLTQEMSNGSSFKGFMEPSIQFRPTY
FT                   KYDHGTNRYDSSEKARTPSWTDRIIYKGKNLQPMAYGDVSLCLSDHKPVYSAYKADVNF
FT                   VDETIKMSLTKELYFRYKEAHPEQASNTSIALIDVVAESKGARKRNMESPINDWSETNL
FT                   LDLEPASVVSIPSSNSSTPGMSPQPPAHVQKHIPGPGGRHRVPPPPPPAPRGNGIAASG
FT                   TNSQRSLQTNSTQGSPVPPAKVGPPVPARRGTLPPGFSDSILVPKNASSSALSSTSTNS
FT                   GKAASNSPSPTPRPSSSVSAAGDSEANHASPTGSSAAYTSTKQPPAVPKKKPELERLTL
FT                   DSWKPLTPK"
FT   CDS_pept        complement(17324..17950)
FT                   /codon_start=1
FT                   /gene_family="HOG000190181" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761393"
FT                   /gene_name="YAF9"
FT                   /locus_tag="AFL227C"
FT                   /product="Protein AF-9 homolog "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53147.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG072995"
FT                   /db_xref="HOGENOM:HBG748014"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="UniParc:UPI0000252F2D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755P0"
FT                   /transl_table=1
FT                   /translation="MAPAQAKRIKTLSVARPIVYGNTAKKMGDVRPAIAPSEHTHMWTI
FT                   FVRGPQGEDISYFIKKVVFKLHETYPNPVRVVDAPPFELTETGWGEFEINVKVHFVDEA
FT                   NEKMLNFYHHLRLHPYTEEDGRRSDGDEVSSVFYDEIVFNEPNEAFFAKMIEQPGNLLP
FT                   SNKTPDCVFSLQLEQEEIDRIQQGIGKVDEEIEQLKQKLEQDLAK"
FT   CDS_pept        join(18146..18175,18229..19371)
FT                   /codon_start=1
FT                   /gene_family="HOG000248026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761394"
FT                   /locus_tag="AFL226W"
FT                   /orf_name="AGOS_AFL226W"
FT                   /product="AFL226Wp"
FT                   /protein_id="AAS53148.1"
FT                   /db_xref="HOGENOM:HBG042202"
FT                   /db_xref="HOGENOM:HBG756784"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR014623"
FT                   /db_xref="InterPro:IPR019481"
FT                   /db_xref="UniParc:UPI0000252F2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q755N9"
FT                   /transl_table=1
FT                   /translation="MTIKMIYVARHGYRSNWLPHGPYPEPPTGVNSDVPLAEHGLEQAR
FT                   ELAHYLLSVDNQPELLFSSPFFRCLQTTEPIAEVMELPIHIERGIGEWYKPDRDVIPEP
FT                   APFEVLENFFPGKLNGEWGATVVPSNKGETETDIFDRCREFWPRFIARVEQQYPDVEKL
FT                   MLVTHAATKIALGMSLLGFSSCREPIDEDGTIIRSGACSLDKYELLQEEEDLPFPQRHW
FT                   KMTMNGNTEFLSRGEEMHWDFRSGFEAGSDAEVKARSTAAATATDSDDAEDTEHVYVCL
FT                   DVPNHNYRERHEISHTATLQYAGLDRESPLVKVGENIYEGTWKKLIGTELAFPSAATTK
FT                   RKTADGAADSLHDENEKSNHDGSTEPPEKVLSERIYRIVDHLELNEVDHL"
FT   CDS_pept        19502..20158
FT                   /codon_start=1
FT                   /gene_family="HOG000241745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777849"
FT                   /locus_tag="AFL225W"
FT                   /orf_name="AGOS_AFL225W"
FT                   /product="AFL225Wp"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53149.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG268536"
FT                   /db_xref="HOGENOM:HBG414045"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="UniParc:UPI0000252F2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q755N8"
FT                   /transl_table=1
FT                   /translation="MSLIKGIEREYDVILASTSPHRYSIVTEVLGFHNVAVMKPNFAED
FT                   LDKGSYRSNPVGYVEDTCKGKTTNAIQQLEAATPNRPKLVICADTVVLGADNVINEKPG
FT                   NSDVQLRMLHSFCRSSAPVRVVTAVRIVRWRSSDDVTTFAFTEETTVHFDPSTPEALLN
FT                   AYVASGDGLQVAGGFKIQGFPATMIRKINGDYYNVVGLPANRTMAHILRATGRDV"
FT   CDS_pept        20331..20951
FT                   /codon_start=1
FT                   /gene_family="HOG000000855" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625294"
FT                   /locus_tag="AFL224W"
FT                   /orf_name="AGOS_AFL224W"
FT                   /product="AFL224Wp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS53150.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG136149"
FT                   /db_xref="HOGENOM:HBG202679"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000252F30"
FT                   /db_xref="UniProtKB/TrEMBL:Q755N7"
FT                   /transl_table=1
FT                   /translation="MARTTKHARASPQPAAADKPQPEPVSDAELDGFSDSDAEPSVTDE
FT                   QPQPAAAGHTILPQQPARRSGAKKQAARTDLSGIIYISRLPHGFHERELSTYFAQFGDL
FT                   KQVRLARNKKTGNSRHYAFIEFANPDDAVVAQETMHNYLLMGHLLQVSVLPKGRTIEKL
FT                   YKHKKRVHKENSIKDAARTQRRADAAHAARMQKLRDAGIDLKW"
FT   CDS_pept        21070..21567
FT                   /codon_start=1
FT                   /gene_family="HOG000039853" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082179"
FT                   /locus_tag="AFL223W"
FT                   /orf_name="AGOS_AFL223W"
FT                   /product="AFL223Wp"
FT                   /function="heme binding"
FT                   /protein_id="AAS53151.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG483498"
FT                   /db_xref="HOGENOM:HBG629516"
FT                   /db_xref="HSSP:1B5M"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI0000252F31"
FT                   /db_xref="UniProtKB/TrEMBL:Q755N6"
FT                   /transl_table=1
FT                   /translation="MIKFYDGSYIIHMGLQAQVAYGVNDQLLSLFTSPPTETTMPKLYT
FT                   YQEIAEHNSENDLWLIINGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFADIGHSDDA
FT                   VKMLEGLYVGDLDKDSEPVVSASEDRSSSTGGGEGNGALWLAFIVFFLAAVYYNYHHNK
FT                   WA"
FT   CDS_pept        21758..23956
FT                   /codon_start=1
FT                   /gene_family="HOG000000785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761395"
FT                   /locus_tag="AFL222W"
FT                   /orf_name="AGOS_AFL222W"
FT                   /product="AFL222Wp"
FT                   /function="binding"
FT                   /protein_id="AAS53152.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059292"
FT                   /db_xref="HOGENOM:HBG202846"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000252F32"
FT                   /db_xref="UniProtKB/TrEMBL:Q755N5"
FT                   /transl_table=1
FT                   /translation="MSAVAGAAYLLFKSISGFQFPYAQDERAVQQTPLWDVYQGTRKAD
FT                   SQAVTLFVHSRQKKASDAGIEQLVRNAVRKAKTLKLPGLVRVLEVLDTDPNVVYIVTER
FT                   VQPLFPELAGAVGELSLGLGLSQVFGALRILEENAHVTLGTLSRGSVYVNERGEWCLFG
FT                   LELCSAQTELAHLREHAARYRSLMAHTMFEVPATESAQVDSVLLAGLIRSVYTTGVPRA
FT                   WQAAVSMLAAGRLTVTQFVARVSGTPQLQTPLITIYSHLKELHIKDSQDKLVALAEVQN
FT                   IILQEPGVLDNSTPGFVDGFIIPQLSETIRNEIVTNQQQIAGMQVFSNIVSLLATALQL
FT                   TCSKNPNSTSAETFKSHIKPLIFETFKISDRQVRFLLLMYMSVYVDKLSGYEIQNQVFP
FT                   YFVQGLADSDNALRLHTLKNIVHIVEKITERQLNSDLLRQLAKTQVDSDVNIRTWTILT
FT                   ITSLAEKLSAGSDRPSLLGTAFTKSLKDPAVMPRLAALHGLAKSIHLFDAKTIANRILT
FT                   VIAPGLLDSNAQVRSQAKELFSMYLKKLEDESSTADYQSDSEDYVDVDFESMQAEASQD
FT                   EFISNFLSNLKVTADHSITNAPMSIGSQEKIDSDAWDTGDDFSWGDVDANEQQQPMRQA
FT                   SKPRISAQPRKPAGVKVNGLRMDSLDIRDSSQIKFGAVKTQNSWDNSPKHQITSHKSHS
FT                   TPNLPSKLVAQQRNPPKRDPIASLVPSAEDDDGWDEEW"
FT   CDS_pept        join(complement(25244..26519),complement(24180..24577))
FT                   /codon_start=1
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082180"
FT                   /gene_name="DBP2"
FT                   /locus_tag="AFL221C"
FT                   /product="ATP-dependent RNA helicase DBP2 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="nuclear-transcribed mRNA catabolic
FT                   process, nonsense-mediated decay"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53153.2"
FT                   /db_xref="GO:0000184"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001DB2B79"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755N4"
FT                   /transl_table=1
FT                   /translation="MSYAGNRDQQFNRSNFGGRDGDHRGQRPSDRNSYGRDGFGRGGRG
FT                   GFAGRGRGRSDDRLELTKPDWDVESLPKFEKNFYVEHEDVQKMSTDEVEQFRKENEMKI
FT                   VGHDVPKPIRTFDEAGFPEYVLKEVKEEGFEKPTAIQCQGWPMALSGRDMIGVAATGSG
FT                   KTLSYCLPGIVHINAQPLLSPGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVY
FT                   GGVPKSQQIRDLQRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQ
FT                   IRKIVDQIRPDRQTLMWSATWPKEVQQLARDYLHDPIQVNIGSLELAASHTITQLVEVV
FT                   SDFDKRDRLVKHLEIASKDKDSKIIIFASTKRTCDEITSYLRQDGWPALAIHGDKQQQE
FT                   RDWVLNEFRTGRSPIMVATDVAARGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGAT
FT                   GTAISFFTEANKTLGAQLISIMREAKQEIPQDLLVYDRAPRGGFHPRYGGRGGRGGRGG
FT                   RGGRGYGGYGGGYGGYGGGYGGGHGGYGGKPKDSGWGNRN"
FT   CDS_pept        complement(26750..27157)
FT                   /codon_start=1
FT                   /gene_family="HOG000179862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930831"
FT                   /locus_tag="AGOS_AFL220C"
FT                   /product="AFL220Cp"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="protein dimerization activity"
FT                   /protein_id="AAS53154.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG410450"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="UniParc:UPI0001DB2B7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q755Q7"
FT                   /transl_table=1
FT                   /translation="MCTPSHLPHTASAMSNTEEQPKDVDMLADEQEDELDRDKIRLLPQ
FT                   ATSEDGTCASFQITDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFLNIRIQTYGKV
FT                   TAVDALHKGLQDLMDMCDVVEDKFTQRIREL"
FT   CDS_pept        27531..28079
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625295"
FT                   /locus_tag="AFL219W"
FT                   /orf_name="AGOS_AFL219W"
FT                   /product="AFL219Wp"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53155.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG341495"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI0000252F35"
FT                   /db_xref="UniProtKB/TrEMBL:Q755N3"
FT                   /transl_table=1
FT                   /translation="MFSRPFNTTAIRAFQTNVSAQIAKKSGTNTLRKTLLKEQSPRRPP
FT                   AVYALYLKSIMPSVRSEHPNATFVELSRLANNKWKSMSDHQKKPYYDESHRLFKEYHSA
FT                   RAEIEKTLPPKRPSTGFILFCNDVRPHVAAEHPLLKTTDIVRLLGEKWKALPFDKKNRY
FT                   LDLAARNREQWKLRNGFLS"
FT   CDS_pept        complement(28250..31837)
FT                   /codon_start=1
FT                   /gene_family="HOG000161114" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082181"
FT                   /locus_tag="AGOS_AFL218C"
FT                   /product="AFL218Cp"
FT                   /function="potassium ion transmembrane transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53156.2"
FT                   /db_xref="GO:0015079"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG253167"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004773"
FT                   /db_xref="InterPro:IPR015958"
FT                   /db_xref="UniParc:UPI0001DB2B7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q755N2"
FT                   /transl_table=1
FT                   /translation="MGLARSLSRHPTIQYFHSTYKKTVGHKLRDVISAIVHRLHPIFRK
FT                   LLPNFIAAHYFYIITMALLCSILVYPVKNAAYIDVLFLSAGAATQGGLNTIDICDLSLY
FT                   QQIVLYLVSMFTTPIWIHGMLVFVRLFWFERYFDGIKSWSKKNFQMRRTRTLVARELSR
FT                   SMSSSRHWPKPDRHLKGSDRRLTRTSTATNDFQNRLFSGKLVNREESNVAPEDKEPRVF
FT                   STACSEVAPSPSDSNSKASNRTSSLGTTSVSSGVAPGSISNKSEPDLSRQSPAEPLSAK
FT                   RDREVTPADLVRSITMMQSQHRKTEDEDGPALVIKGPHERTSGRTSGNEGEDYEDEGVP
FT                   SRDSTEKTRRLDLRKRPLSGRSSQGGMAWLTPSQSLSAIEQRRSGDYSDVSSALETATE
FT                   AHDHPSWKQGGRTAEPTSELPRSTTSAEQLASATNNGPSIHFEIGNMPRPPTRQNLQRH
FT                   DTGSSKYGESSDNKKSGRPGLLRRLSASGGIKDFLMRNNGSASVTRGDNDHVPDSVSSD
FT                   NDSAIESTGSEENDETGDSRNRTYFRQPSRDAQTPESIRAEDLRRSFRRRRSTGLSLKK
FT                   LQLSASFNKILGDRVPNALRRKSKRTSNASLTSADHSADSVDSYSNYYDQESGYGGLDL
FT                   DGNEMSHVMSTNYLSYNPNIGRNSIFIGLTDAQKVELGGVEYRATKLLCRILVTYYFGF
FT                   HALIVIFLLPWIHSSQKYKDIVASNGVSTTWWAFFTSQSAFNDVGFTLTKDSMLSFSKA
FT                   SFPLVVMIFFIIFGNTGFPILLRFIIWVMFKLAPDLSLMKENLGFLLDHPRRCFTLLFP
FT                   RAATWWLFLIVVGLNSLDLILFIVLDLNSSLLNGMHAGQKVIDGLFQAVNTRTAGLAVV
FT                   DLSQLHPSIQVSYMLMMYISVLPVAISIRRTNVYEEQSLGIYGNLMPIIAEASTTGTSA
FT                   QSRLNKHGSTKEDVNIDQEQDTKSFVRDHLRKQLSFDLWYMFLGLFIICIVEGDRIQDP
FT                   NEPTFDVFHILFEVVSAYGTVGLSLGFPNTNQSFSAQFKPLSKFVIVAMLIRGRHRGLP
FT                   YKLDRAIMLPSDKLKQIDNLEDLKLQKTATSNKDPLLQYWRRRAKPVSTGIAQVLSRTK
FT                   SHTSRSSDHSHIPIAVERGEQATGAPLGPTASGSIKSDYVMRRNSHKSTDQERSPSTIS
FT                   PLQPASEEDMDPSGHPSHTVDAEPNKFLA"
FT   CDS_pept        complement(32234..34309)
FT                   /codon_start=1
FT                   /gene_family="HOG000234206" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761396"
FT                   /locus_tag="AFL217C"
FT                   /orf_name="AGOS_AFL217C"
FT                   /product="AFL217Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53157.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG190374"
FT                   /db_xref="HOGENOM:HBG447816"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252F37"
FT                   /db_xref="UniProtKB/TrEMBL:Q755N1"
FT                   /transl_table=1
FT                   /translation="MERNTVQRSGTMQTGGSSSASKNYSNINANLHARVKAFQEQRKLQ
FT                   RSGSVGSKSSGQSQDSAAIQHIVNKPLPPLPPGKGKEAAPPLRRQGSMLKADSRPRSMS
FT                   SFTGSPPAVGASIADAEPVASAERPAPVLQANVGQEADSMPVQQSIPLKAAAVPGRQPH
FT                   QKTHSASDIFQRTSSHVLPQIPIPLNPIRKAPRPPDAGMGHQRGRQGSHSGIVLGPQSG
FT                   AGGTGSASDAPKHIMTKSKPSLSARRGLKLPSGGISLKMKQPLQEFASQPSNKDTALAT
FT                   SGVVPGHRVSKSNPGSLTNGIQTTSTSSDKQVDTKGTEPSKSGNSGTNSNGGLFAVFSK
FT                   YVDIKSGSLNFAGKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGTVSKVLHKPT
FT                   NIMMAMKEVRLELDESKFRQILMELEVLHKCQSPYIVDFYGAFFIEGAVYMCMEFMDGG
FT                   SLDKSYDPHEIGGIEEPQLALITESVIRGLKELKDVHNIIHRDVKPTNILCSATQGTVK
FT                   LCDFGVSGNLVASLARTNIGCQSYMAPERIKSLNPDKATYSVQSDIWSLGLSIVEMALG
FT                   AYPYPPETYDNIFSQLSAIVDGPPPRLPKDTFSSDAQDFVRLCLQKIPERRPTYASLLE
FT                   HPWLKKYRGLDVHMSEYITKRLVQRQHYLEQSGGDELPKVLPALHGRLVKPQPHIP"
FT   CDS_pept        complement(34664..34813)
FT                   /codon_start=1
FT                   /gene_family="HOG000000831" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761397"
FT                   /locus_tag="AFL216C"
FT                   /orf_name="AGOS_AFL216C"
FT                   /product="AFL216Cp"
FT                   /protein_id="AAS53158.1"
FT                   /db_xref="HOGENOM:HBG059322"
FT                   /db_xref="HOGENOM:HBG398757"
FT                   /db_xref="UniParc:UPI0000252F38"
FT                   /db_xref="UniProtKB/TrEMBL:Q755N0"
FT                   /transl_table=1
FT                   /translation="MINFFRQIRNVFKESHAPLQQILLSRRAFFRLLGYLGTCTLLIVV
FT                   AQNC"
FT   CDS_pept        complement(34959..36698)
FT                   /codon_start=1
FT                   /gene_family="HOG000141837" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930832"
FT                   /locus_tag="AFL215C"
FT                   /orf_name="AGOS_AFL215C"
FT                   /product="AFL215Cp"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="AAS53159.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG059329"
FT                   /db_xref="HOGENOM:HBG202298"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR015416"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000252F39"
FT                   /db_xref="UniProtKB/TrEMBL:Q755M9"
FT                   /transl_table=1
FT                   /translation="MIFRDSESIPLESNEAHDQEQHDIETYLTVLQPHTILLKDGETTA
FT                   TMYPIRANSDLLPLGLLAFLLDEFNMEVEKGDSFPYYEPLDLDEFRKMWFHTHGIVCVM
FT                   VLGEIPELDYSLELSEDQQLLQTEQLRQQGVTTERNTVQYQKRKERRNMNLNIQWEKQC
FT                   LGTFNLLPAYPGRSSHVVTGTFLVNAGIRGKGIGRTLVERFLEWAPQLGFTSCCFPLVY
FT                   GTNVGIRRILESSNFKRIGKLPESGILKGYDSPIDSFIYGKEFTHVSKQIDALNSARND
FT                   STKAKYERLKFYLETSEYPASCSRNEKARLRVMSKTHSILNGKLMFKGREVVYEPRRQL
FT                   EIAYETHAVDHQGINRVTSKVAERYHWKGIKQSVAKVISTCTRCQDTPAHDAQHPGSGL
FT                   VIDATGPANQTHVVVHAHANDDQLSRVAEAVVGSLQRAEDRDYAESTPADATPRARAYP
FT                   PPGQLRRIRFHTQPAAKDPDPSMNSFTRYAEEHLPRSAKKRSRYSSAAHPDSPKSASES
FT                   ATVLLDDTPPIDDALLHLEDNVIAAVEAVRKEQRAASLRRSPNTDDDYVSDDPSFHDDR
FT                   AYY"
FT   CDS_pept        complement(36985..38205)
FT                   /codon_start=1
FT                   /gene_family="HOG000173282" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761398"
FT                   /gene_name="TRM61"
FT                   /locus_tag="AFL214C"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase catalytic
FT                   subunit TRM61"
FT                   /EC_number="2.1.1.36"
FT                   /function="tRNA (adenine-N1-)-methyltransferase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53160.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016429"
FT                   /db_xref="HOGENOM:HBG370530"
FT                   /db_xref="HOGENOM:HBG737548"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="UniParc:UPI0000252F3A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755M8"
FT                   /transl_table=1
FT                   /translation="MSYFTEYKDLIAEGDLVLVWISRGNVKQLRIKSGEVFNTRYGSFA
FT                   HDDIVGRPYGSQIGVRTKGSNRFGFIHVLQPTPELWTLSLPHRTQIVYTPDSSYIMQRL
FT                   GCSPQSRVIEAGTGSGSFSHAFARTVGQLFSYEFHHMRYEQALAEFQEHGLIADGNVTI
FT                   THRDVCQKGFLIKAGDTTSYEFLEGQDSVSVNADCIFLDLPAPWEAIPHLDAVIAKDRT
FT                   ARLCCFSPCIEQVDKTLEALELHGWEEIETVEIQGRQYESRRQMVRQLDDALERLRDVK
FT                   RRKQHGTERRKRLGEQLGSVEELTDDVRPKTPKTSYNPFGKGSRVKEGDNGFEWKQVAK
FT                   VESEIKSHTSYLTFASKILFKSRDENTVSQLLEQYKDFNPNVKAASKLDKRPQETSFEE
FT                   SQASNSV"
FT   CDS_pept        38882..40270
FT                   /codon_start=1
FT                   /gene_family="HOG000141838" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082182"
FT                   /locus_tag="AFL213W"
FT                   /orf_name="AGOS_AFL213W"
FT                   /product="AFL213Wp"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS53161.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG104161"
FT                   /db_xref="HOGENOM:HBG494288"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI0000252F3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q755M7"
FT                   /transl_table=1
FT                   /translation="MPAVLDRPKTYKKPTLEDVDPTINYIPAVVRDKLTHESQEMLQRL
FT                   RKFVDIECLGKEKLYLRELQAHGYESEQCPTVQLLRTRAEELDLQQLYVRKRVFDNQEP
FT                   FYENRLSMLEYCMASFFLGKSQLAQAVMHAHCSMVNVGAMELLLRHGSPEQLSLFLSPM
FT                   ISAQLHSSFMVSESEVSSSDALNVSTTCKIDDSNGTMTLNGSKWFVTSLEDNKCELWLL
FT                   LAVTEFDEGNIYKRHSVVLLDKDAIKSEGITYERIDTGGPNSITDSNKYYRVQFKNAVV
FT                   PLNILGQRGEGFSMVQTRTSLAKLYQCMKLCGTGHEALRLAQLRASSRKVFGSKLQKTD
FT                   TFKTDVATWKIKIEVCKLLCCNAAVRCQVEGIKVARDDIAMAKIYTPREMSELVNWSIQ
FT                   IHGALGLCTLESPLLHMWHSCRATRINEGPDEALLSQLGKLEISNFAKNQKTWDDELAK
FT                   AKSS"
FT   CDS_pept        complement(40439..40897)
FT                   /codon_start=1
FT                   /gene_family="HOG000223544" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777850"
FT                   /locus_tag="AFL212C"
FT                   /orf_name="AGOS_AFL212C"
FT                   /product="AFL212Cp"
FT                   /protein_id="AAS53162.1"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI0000252F3C"
FT                   /db_xref="UniProtKB/TrEMBL:Q755M6"
FT                   /transl_table=1
FT                   /translation="MSHSKISEGEADLYLDQYNFTTTAAIVGSVDRKIFVLLRDGRMLF
FT                   GVLRTFDQYANLILQHCVERIYIPEEGQYGECERGVFMVRGENVVMLGEVDIDKEDKPL
FT                   EQLERVPFEEAARYRDGQNETKFKVETQKSKELARYGLIHDFNKSDMY"
FT   CDS_pept        41324..41725
FT                   /codon_start=1
FT                   /gene_family="HOG000001095" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761399"
FT                   /gene_name="FMP46"
FT                   /locus_tag="AFL211W"
FT                   /product="Putative redox protein FMP46, mitochondrial "
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS53163.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059347"
FT                   /db_xref="HOGENOM:HBG202378"
FT                   /db_xref="HSSP:1WPI"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012882"
FT                   /db_xref="UniParc:UPI0000252F3D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755M5"
FT                   /transl_table=1
FT                   /translation="MSLLRTLQMQPRVITVFAEHANVGAASEILGALKTASGPKCKVQV
FT                   STMFPTLEQLIYMSEINRTAVAAQVPRLSELLQKPSFSEEFSSPLAQCTQDGVWRSQGG
FT                   LWVDWEKRLLGADGQSVHELLGSSTMTID"
FT   transit_peptide 41324..41386
FT                   /gene_name="FMP46"
FT                   /locus_tag="AFL211W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755M5 "
FT   mat_peptide     41387..41722
FT                   /gene_name="FMP46"
FT                   /locus_tag="AFL211W"
FT                   /product="Putative redox protein FMP46, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755M5 "
FT   CDS_pept        complement(41782..43047)
FT                   /codon_start=1
FT                   /gene_family="HOG000248649" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761400"
FT                   /locus_tag="AGOS_AFL210C"
FT                   /product="AFL210Cp"
FT                   /protein_id="AAS53164.2"
FT                   /db_xref="HOGENOM:HBG059352"
FT                   /db_xref="InterPro:IPR018814"
FT                   /db_xref="UniParc:UPI0001DB2B7C"
FT                   /db_xref="UniProtKB/TrEMBL:Q755M4"
FT                   /transl_table=1
FT                   /translation="MTGAGKPSEADEVLEFLDSLPDGAGKKGGQTGTPNAEGNEDILEF
FT                   LDELEQSNLKVDAKKPAGAAVGVQKTVKAAGDTKGAAATGKAAAGVQKAAGDSAEAAPL
FT                   RAGQPEKQEVAEELHDPIKSLSNWWSSSGQATVSSIWSKTTERATQLKDRITLEQQDLT
FT                   TKLNTNPIASKLSNATMLSELTSQLTKFVVGETEEVLRIHLVHDLVNFHDLSYEVESQF
FT                   HDVLSSQVQGGIRIFVDQWDRPNESAAEGPAGNIHGLNMFQGKPTEGDKLCRANLDNAM
FT                   KLFQKAMEESRRQRRERDIEAAADEESRISDVFIGILAVGQPQKGDEGAVVDSTHVGSF
FT                   SFTIHLEDMSNGVSLLVRSQGFPIRWAGWLEGKSDLKKKEDEKPLEGEIDPSEWVKDWI
FT                   DKGLALSIGVLAQNYVIERMGV"
FT   CDS_pept        43540..44022
FT                   /codon_start=1
FT                   /gene_family="HOG000033892" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761401"
FT                   /gene_name="ALB1"
FT                   /locus_tag="AFL209W"
FT                   /product="Ribosome biogenesis protein ALB1 "
FT                   /biological_process="ribosomal large subunit biogenesis "
FT                   /biological_process="transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53165.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0042273"
FT                   /db_xref="HOGENOM:HBG059358"
FT                   /db_xref="HOGENOM:HBG397695"
FT                   /db_xref="InterPro:IPR015218"
FT                   /db_xref="InterPro:IPR022784"
FT                   /db_xref="UniParc:UPI0000252F3F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755M3"
FT                   /transl_table=1
FT                   /translation="MPSKNSINRPKQKLNLQHRVQKNAAKRSARERAGLLAPPRSSDQS
FT                   QSGRAKSIPLDLFRGERVDQGPITTKTLSKKRAKKIERNLRYVEQRKLLVDVQAARESG
FT                   MDIDVETAVSTKAKTQQTGPLQKVKESIWSALEDVAAQEMIVQTGAGTTLGGQFFP"
FT   CDS_pept        complement(44149..44868)
FT                   /codon_start=1
FT                   /gene_family="HOG000259349" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625296"
FT                   /gene_name="RPE1"
FT                   /locus_tag="AFL208C"
FT                   /product="Ribulose-phosphate 3-epimerase "
FT                   /EC_number="5.1.3.1"
FT                   /function="ribulose-phosphate 3-epimerase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS53166.1"
FT                   /db_xref="GO:0004750"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG302064"
FT                   /db_xref="HOGENOM:HBG571751"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000252F40"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755M2"
FT                   /transl_table=1
FT                   /translation="MVKPIIAPSILASDFANLECGCHRVINAGAEWLHIDVMDGHFVPN
FT                   ITLGPPIVKSLRKAVPRVGDKESDKPKAFFDCHMMVAEPEKWVDVFVENGADQFTFHYE
FT                   ATKNPLELVKLIKSRGIRAACAIKPDTPVDVLFELAPYLDMALVMTVEPGFGGQKFMPD
FT                   MMPKVAALREKFPQLDIQVDGGLGKETIPHAAKAGANVIVAGTSVFAAADQKDVISYMK
FT                   DNVRDELRSRGLLDIDM"
FT   tRNA            join(complement(45011..45049),complement(44965..45001))
FT                   /gene_name="tRNA-Tyr"
FT   CDS_pept        complement(45815..47434)
FT                   /codon_start=1
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082183"
FT                   /locus_tag="AFL207C"
FT                   /orf_name="AGOS_AFL207C"
FT                   /product="AFL207Cp"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53167.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000252F41"
FT                   /db_xref="UniProtKB/TrEMBL:Q755M1"
FT                   /transl_table=1
FT                   /translation="MSRQVLHSDMRSVGTEVSAASQKKYLMEETVDIPTKPATAYITVC
FT                   LLCVFVAFGGFIFGWDTGTISGFVNQTDFRRRFAQVNDEGGYYWSNARVGLIVAIFNIG
FT                   CAVGGIILSRLGDMYGRRIGLMIVSLIYVVGIIIQISSNTKWYQYCIGRVISGLGVGGI
FT                   AVLSPMLISETSPKHLRGTLVSCYQLMITAGILLGYCANYGTKSRYDDSRQWRIPLGLC
FT                   FLWAIFMITGMAFVPESPRYLIEKDKIEEAKRSLATSNKVPVDDPAILAEVNNIQAGVE
FT                   LERMAGSASWGELFTVRTKILQRVIMGAMIQSLQQLTGNNYFFYYGTTIFDSVGLEDAF
FT                   KTSIILGAVNFGSTFVAMYTVDRFGRRKCLLYGAAAMAVCMVIFASVGVTRLWPNGPDQ
FT                   PSSRPAGNAMIVFTCLYIFFFATTWAPIAYVIVSETFPLRVKAKGMAIATAANWIWGFL
FT                   IAFFTPYITNAIRFYYGYVFMGCLIFAFFYIFFFVPETKGLTLEEVEEMWQEGVVPWRS
FT                   ESWVPSARRHAPYSSDKQAAGI"
FT   CDS_pept        complement(48062..50008)
FT                   /codon_start=1
FT                   /gene_family="HOG000247211" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930833"
FT                   /locus_tag="AFL206C"
FT                   /orf_name="AGOS_AFL206C"
FT                   /product="AFL206Cp"
FT                   /function="ATP binding"
FT                   /function="arginine-tRNA ligase activity"
FT                   /biological_process="arginyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53168.1"
FT                   /db_xref="GO:0004814"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006420"
FT                   /db_xref="HOGENOM:HBG450640"
FT                   /db_xref="HOGENOM:HBG695395"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015945"
FT                   /db_xref="UniParc:UPI0000252F42"
FT                   /db_xref="UniProtKB/TrEMBL:Q755M0"
FT                   /transl_table=1
FT                   /translation="MLSGISAAYSISSLISSRRIFPAALRFTVTRVHSFRQHINIKMPG
FT                   DTISQQLAKLSIQAPTKMAGSHPEANVVDLIRNYITDELSRISGVAGPLIYEALEWTNT
FT                   LERGDLLIPVPRLRIKGSNPKDLAAEWAVAFPCGEYLDRVEANGSFIQFFFKPQFLFNV
FT                   VVPDVLTRKEDYGSCKLVENKKVIIEFSSPNIAKPFHAGHLRSTIIGGFLSNLYEKMGW
FT                   EVIRMNYLGDWGKQFGLLAVGFEKYGSEEALEKDPINHLFDVYVRVNKDIEQEGDSLPL
FT                   EESTNGRARAYFKKMEDGDPEALKIWQKFRELSIQKYIDTYARLNIQYDVYSGESQVKK
FT                   ESMENALKLFQEKGLTHEDKGAILIDLTKFNKKLGKTIVQKSDGTTLYLTRDVGAAMDR
FT                   YEKYKFDKMIYVIACQQDLHTAQFFEILKQMGHKWAENLHHVNFGMVQGMSTRKGTVVF
FT                   LDNILEETKEKMHEVMRKNEVKYAQVENPDEVADLVGISAVMIQDMQAKRINNYEFKWE
FT                   RMLSFEGDTGPYLQYAHSRLRSVERNASEITPEKWVTADFSVLTEAAAVTLVRLLAQYP
FT                   DVLRNALKTHEPATIVTYLFKLTHQVSSCYDILWVAGQAPEVATARLALYASCRQVLNN
FT                   GMRLLGLTPVDRM"
FT   CDS_pept        complement(50502..52142)
FT                   /codon_start=1
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930834"
FT                   /locus_tag="AFL205C"
FT                   /orf_name="AGOS_AFL205C"
FT                   /product="AFL205Cp"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53169.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000252F43"
FT                   /db_xref="UniProtKB/TrEMBL:Q755L9"
FT                   /transl_table=1
FT                   /translation="MSAAIAQPDNRSVMSTHSSTASNKPSKEENKESGLVEIPVKPASA
FT                   YITVSLLCILVAFGGFIFGWDTGTISGFVNQSDYKNRFGELNESGDYYLSDNRTGLIVA
FT                   IFNIGCAVGGIFLSKFADMYGRRIGLMIVTLVYVIGIVVQISSTDKWYQYCIGRVISGL
FT                   GVGGIAVLSPMLISETSPKHLRGMLVSCYQLMITAGIFVGYCANYGTKAKYEDSKQWRI
FT                   PLGLSFAWAILMIGGMVLVPESPRYLVEVNKYEDAKRSLARSNKVPVDDPSIQAEFDNI
FT                   HAGIELERMAGSASWGELFSTKSKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFKSVG
FT                   LEDSFQTSIILGAVNFGSTFVAVWAVGKFGRRRLMLAGAAAMTVCMVIFASIGVTKLWP
FT                   NGEDQPSSKPAGNVMIVFTCIYIFCFATTWAPIPFVIVSETFPLRVKAKGMAIATAANW
FT                   IWGFLIAFFTPKITNAIKFNYGYVFMGCLIFAFFYMFFFVPETKGLTLEEVEEMWQEGV
FT                   VPWKSESWTPSYKRNAYETEEVKPEKTWA"
FT   CDS_pept        complement(53050..54657)
FT                   /codon_start=1
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625297"
FT                   /locus_tag="AFL204C"
FT                   /orf_name="AGOS_AFL204C"
FT                   /product="AFL204Cp"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53170.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000252F44"
FT                   /db_xref="UniProtKB/TrEMBL:Q755L8"
FT                   /transl_table=1
FT                   /translation="MTVSEGMTPSKSELSGDGSNSHPIESKKDIVSVISTETKPFSAYI
FT                   FACLCCFMVAFGGFIFGWDTGTISGFVKQTDFIARFGQLSPSGEYELSDDRTGLIVSIF
FT                   NIGCAVGGIFLSKIGDAYGRKIGLATVTAVYVIGIVIQISASDKWYQYFVGRIISGLGV
FT                   GGIAVLSPMLISETSPKHLRGSLVSCYQLMITAGIFLGYCTNYGTKTNYTDSRQWRIPL
FT                   GLGFAWALLMIGGMAFVPESPRYLVEAENLPKARMSIARANKVAEDHPIVEHELNTLQT
FT                   AIELEKLAGKARIVDLFNVKKKIFQRLIIGIFIQSLQQLIGNNYFFYYGTTIFNAVGMD
FT                   DPFVTSIVLGIVNFGSTFFSLYTVDKFGRRKCLIWGAFAMAICMAIFASVGVTKLWPNG
FT                   EDQPSSKPAGNVMIVFTCIYIFFFATTWAPIAYVIISEIYPLRVKARAMALATAANWIW
FT                   GFLIAFFTPRITSAIKFCYGYVFMGCLIFAFFYIFFFVPETKGLTLEDVDEMWQEGVVP
FT                   WGSESWLPRSDREVAHDA"
FT   CDS_pept        complement(55339..56496)
FT                   /codon_start=1
FT                   /gene_family="HOG000176056" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761402"
FT                   /gene_name="SVF1"
FT                   /locus_tag="AFL203C"
FT                   /product="Survival factor 1"
FT                   /biological_process="response to oxidative stress "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53171.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="HOGENOM:HBG055858"
FT                   /db_xref="HOGENOM:HBG329155"
FT                   /db_xref="InterPro:IPR013931"
FT                   /db_xref="UniParc:UPI0000252F45"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755L7"
FT                   /transl_table=1
FT                   /translation="MLKWIQGGISSVTGIAEPEYGPEFIHSATERVRGKQPFHETSRQD
FT                   LAWRNISSTHVETATFYFTQIQTGMAGFAQIIYSKIGGLPRTAQFTFRLHHASRPELGT
FT                   WTSTKLENFRVEGANFYADNLSLELDSTATSYTLQSSVTADSVVDITFKRLTPGVKVGE
FT                   DPTTYYGDNTKEPWGTMRHVFWPRNSVNGTVVVHGEMITLKNDYSVMILALQGMKPHHA
FT                   AKAWNFLNFHSETHSVLLMEFTTPKSYANTKVSIGILCDKDSVLSVTIDNEVEHVKPKT
FT                   DEVGWPVPKALSMKFTGIPSSVPDKEVASAEKLSARVDIELKNLVERVDVMAEIPAFVK
FT                   NIVSGVVGTKPYIYQYANEALLTYAGSEYKGFAWSEVTFISEFEN"
FT   CDS_pept        complement(57613..59058)
FT                   /codon_start=1
FT                   /gene_family="HOG000115531" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761403"
FT                   /locus_tag="AGOS_AFL202C"
FT                   /product="AFL202Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53172.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG059394"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniParc:UPI0001DB2B92"
FT                   /db_xref="UniProtKB/TrEMBL:Q755L6"
FT                   /transl_table=1
FT                   /translation="MDNFEYPGGEFGRFNQEFGSPEEMLNNGHGELRSDNGEATGNSKS
FT                   PGHGELAEAADGGKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEKNV
FT                   RIWFQNRRAKYRKSDRTFNQRTAATDMNTFGSISVTVEYDKIPLNINDNYYFIDANSLT
FT                   VGSWKRLKSGNLHRESLSNIKYLSNLSPTSINMIMSNATDLMVLISKKNFEVNYFFSAI
FT                   ANNTKILFRIFFPINSVLNCSLLLHAEGGKKDEDDANNVVQETTAPAAEQVCELKLNVS
FT                   KPPNFAVYFSDMNDELTSNQWSICEDFSEGRQVSDAYVGGSNFPHVLTGLEASLKFMSS
FT                   LILDYNSTTHVVPHAQPQPHPHSHPHHSSDPAQAIVLQPEPHSLAQSAFFRNYGPHSTD
FT                   DILDIQDPDQYETAQTTNTEFPSTSTAAGSHFLTAHLADTQIPKTPEFLNQHTDLHNDD
FT                   QHGLNNLLNFNDQPHTSNAEQYY"
FT   CDS_pept        59887..61380
FT                   /codon_start=1
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761404"
FT                   /locus_tag="AFL201W"
FT                   /orf_name="AGOS_AFL201W"
FT                   /product="AFL201Wp"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS53173.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="HSSP:1AG8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000252F47"
FT                   /db_xref="UniProtKB/TrEMBL:Q755L5"
FT                   /transl_table=1
FT                   /translation="MSELFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPAN
FT                   GELIATFYAAGAADVDAAVAAARRAYEERWRHTSAQERGALLARLAELVDEEREVLAGI
FT                   ETLDSGKPYHTNALADLDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVA
FT                   QIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLP
FT                   GLGPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADA
FT                   DLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGLFSKD
FT                   CNMGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEKGYYIPPTIFLDVPQSSRLCRE
FT                   EIFGPVAVVAKFKDYDEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSN
FT                   DEEVGVPFGGFKMSGIGRELGKAGLQTYLQTKAVHLNFA"
FT   CDS_pept        61572..63362
FT                   /codon_start=1
FT                   /gene_family="HOG000111345" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625298"
FT                   /locus_tag="AFL200W"
FT                   /orf_name="AGOS_AFL200W"
FT                   /product="AFL200Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53174.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059404"
FT                   /db_xref="HOGENOM:HBG203461"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000252F48"
FT                   /db_xref="UniProtKB/TrEMBL:Q755L4"
FT                   /transl_table=1
FT                   /translation="MARSTIIASKPCAVCIKRKVKCDRLVPCTNCVKRGGAAECERADT
FT                   IKRPRLGNPSPGSDWLLLWQEYEYWVLKVGIFKDMPSNKRAAVDLNADLKAVKFWSNYL
FT                   QAETSFKLLDYSMEKLGGLYFGCLSDIGELYLKLEEYWARRENKDEPSSIDEYLWDTLI
FT                   WAVLTMAVYYMPLSELSSIMDDQPVVDWYGQKIPGWSEELQHGLYYGFLRTALTHLKMA
FT                   DFMSCSDVRIIQIYLILSSTSFIQLERSLADSVLVQCIHVAKALQVDQFRPMVSDSAAL
FT                   RLTKLTAQKIWYRLCFCDYLQSGPNKLLCIHTENDSLITHAAYYEEMPGVDIYQSEDTY
FT                   ETLLWKLISLDRDLEQYSLKKPSLKSLDAIRRQLDIFTVKLDSIDDIHSFNSKFESFQS
FT                   RLILNLTYWKSCKLFLSYYSSQTSNDQLNTYTEIIIALVLKNIKSNLSSFNRNPYVLYA
FT                   LSLLLGYHSMKNVFDYSEQNEQLVVDLRELLKTYLVAFQPTCIKILLVAKRVTKLAYLW
FT                   KNIRIIDTDDPVQHPVFKILKADIKAVQKKMNKLPTLLNFDTSAIALEDEGETKESTEF
FT                   RAIIKEFETQNSFQKILYGN"
FT   CDS_pept        join(complement(65595..65744),complement(63372..65537))
FT                   /codon_start=1
FT                   /gene_family="HOG000176000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930835"
FT                   /locus_tag="AFL199C"
FT                   /orf_name="AGOS_AFL199C"
FT                   /product="AFL199Cp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /biological_process="reciprocal meiotic recombination "
FT                   /cellular_component="MutLalpha complex"
FT                   /cellular_component="MutLbeta complex"
FT                   /cellular_component="chiasma"
FT                   /cellular_component="synaptonemal complex"
FT                   /protein_id="AAS53175.1"
FT                   /db_xref="GO:0000795"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005712"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0007131"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="GO:0032389"
FT                   /db_xref="GO:0032390"
FT                   /db_xref="HOGENOM:HBG014498"
FT                   /db_xref="HOGENOM:HBG631009"
FT                   /db_xref="HSSP:1B62"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011186"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014763"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0000252F49"
FT                   /db_xref="UniProtKB/TrEMBL:Q755L3"
FT                   /transl_table=1
FT                   /translation="MGISDAQRIPDFHHVRVTEKHSAALILNATTSYLQRCVPQYRMHL
FT                   PSRIKALEASVVNKIAAGEIIISPVNALKEMMENSIDAGATNVDILVKDGGIKMLQISD
FT                   NGCGIMKDDLPILCERFTTSKLKSFEDLSRIQTYGFRGEALASISHIARLHVVTKTKEN
FT                   QCAWKAVYENGVMVGEPKPTAGKDGTTILVQDLFYNVPSRLRALRSPSEEFAKIVDVVG
FT                   KYAIHSDGVGFSCKKFGETQYALNVRGTSSKSDKIRAVFGAPVVANLVEVDISADPEHG
FT                   LTSSSGQITTPDFNNKKSIPAVFFINNRLVSCDPLRRALSQVYSNFLPKGNKPFIYMSL
FT                   HITPENVDVNVHPTKREVRFLYEEELIERIGNLLHERLSQLDTSRTFKPGSLTPGKHSS
FT                   TVSSAFRQSATPASTQPKAKRAENMLVRTDGSQAKITNYVRASQSSTSSSFSTSLRKKS
FT                   HAAASDELGSIGEDSQDTATSMTTSTQEPNHTKSRAILTLLNNEYEVVQRERTEVNLTS
FT                   IKTLKQEVDEDMHKELTSVFADMTYVGVVDATRRLASIQHGLKLFLVDYGSLCNELFYQ
FT                   IGLTDFANFGKIYIQDEVENREGLAIYQLLSKIDNASQSNILEITQQLWDMREMLENYY
FT                   SIEICGDETDLTNVRIKSVPLLLKDYVPPLSKLPFFLYRMGTKVDWSSEKECLEGILRQ
FT                   LALFYIPEIIEHVDINDDTIDGDVRAYYISKAEHIGTVLEQVVFPTIKRRLLASTRLLK
FT                   DIVEVANLPGLYKVFERC"
FT   CDS_pept        65813..66967
FT                   /codon_start=1
FT                   /gene_family="HOG000113859" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930836"
FT                   /locus_tag="AFL198W"
FT                   /orf_name="AGOS_AFL198W"
FT                   /product="AFL198Wp"
FT                   /protein_id="AAS53176.1"
FT                   /db_xref="HOGENOM:HBG059412"
FT                   /db_xref="HOGENOM:HBG203077"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="UniParc:UPI0000252F4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q755L2"
FT                   /transl_table=1
FT                   /translation="MSDDAVNPKRRRLTSPDKGGAERGASGKEFQILQGYRNFEDDVAH
FT                   DRATVARTGDISVAVQRLEEVNMLFKQAGDLNLSVNSLFAQDSHAVMSVSELASLSIRN
FT                   LKLTNAGKLLSPEEFVNGAKRFLLEDYLELNHVSVPGSMYPETDDASNTQNDSIENDGD
FT                   ATSDALDESTNQHADAALRQSMQRNSYLRQFEAYGDFAQFNWFKMGALFQQLGGAPTLV
FT                   DHMLGPLAVQKKTRVATQRRAVENVGAKTTAEAVTRETLNSNQSETTPEQVKKCFQVLI
FT                   QKNGYNSISLFRFIIDPSSYARSIENLFYTSFLIKEGRLVLEDDDEGFPAIRPKEPLPQ
FT                   DPAEKELERQRRNDARQKHIIFQMDMATWRKLIDKFHITESFLP"
FT   CDS_pept        complement(66989..68143)
FT                   /codon_start=1
FT                   /gene_family="HOG000109570" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777851"
FT                   /locus_tag="AFL197C"
FT                   /orf_name="AGOS_AFL197C"
FT                   /product="AFL197Cp"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS53177.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG236550"
FT                   /db_xref="HOGENOM:HBG304663"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="UniParc:UPI0000252F4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q755L1"
FT                   /transl_table=1
FT                   /translation="MLALPGALWRRLGRSYRVLSIETSCDDTCVAILDRSSRYRAPAVV
FT                   CHYRETLDSASDGGVVPTKAHEHHQRRIGGLVGRALESGPVDLICATRGPGMPGSLSAG
FT                   LTFGKALSVGLRRPLVGVHHMVGHLLVPRLASNGREPQFPFLSLLVSGGHTMLVLSRSA
FT                   VDHEVLCNTIDVAVGDALDKCARVLGLRGNMIAREMERFIDEDPPGARRRELLPLVLPT
FT                   PLANKAKRRDVQAFSFCPFITAVNRGLEGHAAPLSEAERRVAAFQIQEAIFDHLITKIN
FT                   LVLRLNADKVADVAQFVCSGGVCANRRLRARLETELFRPFDSFHYPAPDLCTDNAVMIG
FT                   WAGIELYEGHGLTTDVAALTIAKWPIDELLAVPGWVSARPAGDT"
FT   CDS_pept        68418..69503
FT                   /codon_start=1
FT                   /gene_family="HOG000180802" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930837"
FT                   /locus_tag="AFL196W"
FT                   /orf_name="AGOS_AFL196W"
FT                   /product="AFL196Wp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS53178.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325384"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000252F4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q755L0"
FT                   /transl_table=1
FT                   /translation="MFSFTSSIPVVGTHHEGGVHTRGGQKAGADGHEGDMPDRSSPEGE
FT                   PSSAHSPLLHCVLAGGIGGAIGDSVMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEE
FT                   GVRRGLYGGYGAAMLGSFPSAAVFFGTYEWVKRQMINEWQIHETYSHLAAGFLGDLFSS
FT                   VVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSR
FT                   DLPFSALQFAFYERFRKWAFLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKT
FT                   RIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIM
FT                   LLLYQTALRTLARSPRAEPAS"
FT   CDS_pept        70036..72114
FT                   /codon_start=1
FT                   /gene_family="HOG000204902" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777852"
FT                   /locus_tag="AFL195W"
FT                   /orf_name="AGOS_AFL195W"
FT                   /product="AFL195Wp"
FT                   /protein_id="AAS53179.1"
FT                   /db_xref="HOGENOM:HBG051099"
FT                   /db_xref="HOGENOM:HBG396084"
FT                   /db_xref="InterPro:IPR007651"
FT                   /db_xref="InterPro:IPR013209"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000252F4D"
FT                   /db_xref="UniProtKB/TrEMBL:Q755K9"
FT                   /transl_table=1
FT                   /translation="MQYVGRAIGSVTKSWSSINPATLSGAIDVIVVEHMDGEMSCSPFH
FT                   VRFGKFQIFKPSQKKVEVIVNGQPTDIPMKLGDTGEAYFVFQMDTDLNNIPEELITSPV
FT                   VSAASSPSLSPRISPGDDKKLPEPDFLDINDGSTDGTFSPKTEGDYVSTVERPVTPTLK
FT                   SGSVFKERLNKKLEQKRIPNRVDNKGNLLLDIEGYKSNQERVHDTDEMLKMLLQEELGQ
FT                   DNDISPFVKEDDNGHIRIVNPYDHLSGGPSPPSSPASSSLSMETVPSNNNGSEVQSEYT
FT                   DSLQSLETLSPLPKNPTGANYIKSIRLTSDQLHCLDLKYGENDLTFSVDKGRAFVTAKL
FT                   FLWKWDVPIVISDIDGTITKSDALGHVLTMIGKDWTHPGVAKLFTEIQRNGYNIMYLTA
FT                   RSAGQADSTRSYLRCIQQDGCTLPFGPVILSPDRTIAALRREVILKKPEVFKIACLNDI
FT                   RKLYFHELQAADAETAPADGQPTPFYAGFGNRITDALSYRTVGIPSSRIFTINPDGEVH
FT                   MELLELTALRSSYVHINELVDQFFPHIRHSYLPDDDLKSLSPTPGSPAFHPEERSFYRQ
FT                   HDEKFSDFNYWRDPVPNLDDLSDSSSVCSAEPSSPAPSTSPTPAPDPPLEPLASPDPPR
FT                   PPIDALLPLQPPGLGVRITAPLPRPAAPPTAPADLSDDDYSDDEFDEDEFDDDDFPP"
FT   CDS_pept        72669..76175
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761405"
FT                   /locus_tag="AGOS_AFL194W"
FT                   /product="AFL194Wp"
FT                   /protein_id="AAS53180.2"
FT                   /db_xref="HOGENOM:HBG059431"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="UniParc:UPI0001DB2B93"
FT                   /db_xref="UniProtKB/TrEMBL:Q755Q6"
FT                   /transl_table=1
FT                   /translation="MDGITSNWGASSGRSSAGGKTGADAPDGHGDENGRADGGGGLLSD
FT                   VLVSDAMAKNSRQLLHAHIYNYLVHNKHHETAKRFLKEADVPLSKVIPDGTMDGQQLLY
FT                   ARMLMNSPETFLLEWWESLWALHELVESQPVEALMLNRTFNERITPILPQHMLVPAQAA
FT                   PGLAHQQPPYMAQPPHAPQAQARPAQHMQLPQAAGRPGPRQVLPQQQGHSPHLMGMGMY
FT                   TQPSPTQAQAPVQPSPESQPFQQQQRQQPHHTSMGVPLQSSGQHVGQPALSHSPTAPIS
FT                   RNPQLQQGAPIQKSAGRQFPSSGGVPNLSSSPYNPPSSMQAVQYSPMYPQSPMMLNMNQ
FT                   PVNMHSQQTRAQQPQNNVNHSSSVGGTGPPMDPMVAYIQQQQQQQQQSQSQQQQQQQQQ
FT                   QPQSQPQQQQQQQQSQPQPQQKPQQTQPQQQQQQTQQQTPPPQQTPPQQQAPPTLQKPK
FT                   PQQSQQQQQQQSSPSQPQHHQQPQALPPAPLPQAPEPAQQHSQQPQPQQQPQAQQAKSP
FT                   SQQHHQQQAQAQAQQQQDSQQEAPQTHTQIQAQAQAQAHAHAHAQAQAHAQAQAHAQAQ
FT                   AQAQAQAQAQAQAQAQAHAQAQAQAQAQSQSQSQPQAQVQAQSQAAQAQAQNQAQQTQV
FT                   PPPQHAQQQLQSQPQQLKKNIQLQEMQQLHAQQMVYQMQSQQQRQVSNIQKRPRRPKRE
FT                   SPQRILESPKKKGHLSVPAMPAMASLTASTGPGSSQLKKMMPNNLEKIEIKGQKTNTQQ
FT                   AQLNWTKLQQQQLQQQVQQKQEQHQDELEQQHQQQHQEKEQEQHQQQHTPNHQLQLDKQ
FT                   SQDQLQQKSNIEGGTEAQPQQQTPQSATPQPRQLSQHQIQAHQQLSHDTKAEEQSLTEH
FT                   QKAEEATPKRVQQVQFTQASLHIQPSAMIRDDHMVQESEKEQEPQSQKHHLHHPNNQQQ
FT                   LTDPTPARGQPPPQLHPEQQQRKQGSPIRTSQPQGQASHLKQPLRKPSHQSHNQPSYLA
FT                   QNMSQSQGLQQLDFMNPMSMIPPVRAATAGNISVQPIAESSSAASQHHVMSTPYGPAGV
FT                   NPEVDGLDPLFFQQQVRFPGSILDPAMFKTPAYAQLSSQASRKNPPDNVSDKKGRKQTG
FT                   ASFQPAQDGLQSVQDMNTILPDTSSQDRAEDQSLSTPLNMDMDLDHFDITVFNNDFMGS
FT                   WK"
FT   CDS_pept        76779..78737
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761406"
FT                   /gene_name="INP2"
FT                   /locus_tag="AFL193W"
FT                   /product="Inheritance of peroxisomes protein 2 "
FT                   /function="receptor activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="AAS53181.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059435"
FT                   /db_xref="UniParc:UPI0000252F4F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755Q0"
FT                   /transl_table=1
FT                   /translation="MYYTPKGLLSGRPGQTMVRESESATGGEGIYAGSPLGNALDWGID
FT                   VYTDRSPTVVNDDFEPLDSTMDELFLFPTCRDSYSGTPMGELIRRVFEHGALGGEHFLE
FT                   EFQYTIITSKGLNVNGMTAPVSSVTGISELNNQNAGPGKTMVHAPTKYGRLVGSRKVLY
FT                   LRKTVSFLPVALFCVRCFRRLLLVRSKSRKNIIVALLVAIYLALQQENFHSRYVRHATM
FT                   MNLGKMLNSWSDVEARMHRYHIRLKELTIYRPITLTGGKPPTYPTNNHSLLADLLNMAS
FT                   DMLYYKIKHIVTELLSLADTENLVHYCGIYDVNMVTLYGYLHTTSDLGTADKINRLQLL
FT                   KKFSLCILLSITRFDRIVTTRSAVVLKLFPNYKHRYMKETEKLLLLSKALGDVADCLNE
FT                   VSKVLESYKSQLKYIETSINDQHNNVLPQPVMIESGLERVTVTLNELNEIQNKLFHAES
FT                   DDETLRKFVQEKLHELCHFWEHTTTKKPTSLLPPQVTSPHRQFHNTSNGFVLNVVKAIE
FT                   TNPAMAPQLTSYEPVTPAGSESCLEQDFLESNFSTESGEHIYSTADEETVAPQYLVDRF
FT                   DKLSHEELRLRLDEQFKRLTVDTKPPKQHSKKDRLEVLNMNVRDGSNNGYESGPFYSKE
FT                   ESIPVLYELNQLLSNRR"
FT   CDS_pept        complement(78862..80268)
FT                   /codon_start=1
FT                   /gene_family="HOG000186273" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930838"
FT                   /locus_tag="AFL192C"
FT                   /orf_name="AGOS_AFL192C"
FT                   /product="AFL192Cp"
FT                   /function="nucleotidyltransferase activity"
FT                   /protein_id="AAS53182.1"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG027994"
FT                   /db_xref="HOGENOM:HBG527090"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="UniParc:UPI0000252F50"
FT                   /db_xref="UniProtKB/TrEMBL:Q755P9"
FT                   /transl_table=1
FT                   /translation="MRTKERYEAAGQGHLFEHWEQLTKEEQGELEQSLVQTDPARVLAN
FT                   LQRALESQDKSQEGDISALPETSYESAIDCSAETRARYREIGLEAVRRGEVAVVLMAGG
FT                   QGTRLGSSQPKGTYDVGLPSHKSLFQIQAERLGRLERLAGCAQPIPWYIMTSRATRTAT
FT                   ESFFREHGYFGLQQGQVTFFNQGTLPALDSDGRRLLLESKMSLLESPDGNGGLYRALQE
FT                   NGILDDLVSRGVKHIHMYCVDNVLVKLADPVFLGYAIDHEFDLATKVVRKRDAHESVGL
FT                   IVAKDGKPCVIEYSEISKELAEAIDEESGLLKLRAANIVNHYYSVDVLRAKLESWCEQM
FT                   PLHIAKKKIKYYDPCSDAVVCPADVNGIKLEQFIFDVFGSIPLERFGCLEVERSEEFSP
FT                   LKNGVDAPNDNPLTARRDYLELSTKWLRDVGAVVDEGVLVEVSSALSYDGENLDRYHGE
FT                   RFSQDGAYLT"
FT   CDS_pept        80619..85346
FT                   /codon_start=1
FT                   /gene_family="HOG000190484" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930839"
FT                   /locus_tag="AFL191W"
FT                   /orf_name="AGOS_AFL191W"
FT                   /product="AFL191Wp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53183.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059444"
FT                   /db_xref="HOGENOM:HBG676968"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000252F51"
FT                   /db_xref="UniProtKB/TrEMBL:Q755K8"
FT                   /transl_table=1
FT                   /translation="MARKKRAQSLRKQLFNKQLYARWQQQQEEGGERDEIQLKDLNAGG
FT                   GETCAAASGRQAAPTLWRRITAALRRSQAEPVEYGRRIPVALGRRGFAESAGGGGYVDR
FT                   RSGLPYIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTI
FT                   VPLSIFMGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASF
FT                   TDFETLQANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMAL
FT                   DGETNLKCKHVLPKIASQTRTASGLATFRGMTTVEDPNIDLYNFEGKIEVETDSGEQQA
FT                   YSIGLDNVLFRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLF
FT                   MILVVAIFSFLSFGLQRFFKNREVDSDRAWYLMKVDAGLAPTIMSFIIMYNTLIPLSLY
FT                   VTMEIIKDMQSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRM
FT                   IFRKFSFCGTAWEHDVARKDQETGCSQTKKDVEVISVESNSFIKNFELNSTDTRTSVEY
FT                   KGLASATYTGRPSIASQIELMKLQQNSANTNKSSSPKISRLPTLDSSPEPKLKTSLDLI
FT                   MHIQLNPNTVFSQRAKFFILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTA
FT                   ARDMGYVVLNRNGDELTIKTYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHP
FT                   EKVLLICKGADNVILERLHNSDLAQQKLNEINTSAGQRKIEEAELVLQHRKSLEQAITR
FT                   DSIGGVLRQSMSLRPSRASLVLQAAKNGHSGISSSPHDQELHINSIDDFLGAVTKPEQD
FT                   VENIFNMARKSTQKQQRDKYARTSTSYVQGSSDNQRVNNINSQVAETSSMAEYIGSPDL
FT                   ITNEEYVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQM
FT                   DTVGEIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSC
FT                   RLIHDYSTVIILAPNDENMASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTL
FT                   FIELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDI
FT                   TGKEGLQASRSSDYSIAQFRYLLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLIFQ
FT                   INTMFSGTSQYEPWCLTVFNTLFTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQAF
FT                   NLVIFLRWMAIAALSSVIICFTNWQCWSLTAQSDNTLYPIGLINYTAVVVLVNVKCQLL
FT                   EMANRNWLAFASFFISVCGWLCWCLLLPAIYKETLVYDVREGLYHQFGPDITFWATNLV
FT                   LVLLPVMLDLLFKTCKVIIYPSDTEIFAELEQRDAVRKKLEFGAFNELKQGWTWQRDPP
FT                   TIKRLMNKAIGNKSDTFDGVINHTRSRKNTLPGATELPPGTPSKVTIHSSATYNTEEYE
FT                   QLPSGKLIKRKNLVPDNSGGSGNDGFAAKLGRKLKLKPAAEDIDEIIERRMQNLE"
FT   CDS_pept        complement(85608..86315)
FT                   /codon_start=1
FT                   /gene_family="HOG000233608" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761407"
FT                   /locus_tag="AFL190C"
FT                   /orf_name="AGOS_AFL190C"
FT                   /product="AFL190Cp"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="AAS53184.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG124831"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI0000252F52"
FT                   /db_xref="UniProtKB/TrEMBL:Q755K7"
FT                   /transl_table=1
FT                   /translation="MAEKEYTEEQEKLTLLIVDKDKHSFYELLQVDEKASDGDIKKAYR
FT                   KMAIKLHPDKNRHPRAAEAFKKVNRAFEVLSDEKKRRVYDQLGYDPDDRAAAQESYRRG
FT                   GASEASTNGFRPFTDEGMFFRGAGGAPEDLFDFFFRGGGPGGPFGMADPYDSFGPFGGA
FT                   TTFTFGGPAGFKVYSGGSGGQFRRGPFGMAQAATEAQRQRANGQPEAQDPLQHVVFVLL
FT                   IVLLFLLLPSLGF"
FT   CDS_pept        86926..90204
FT                   /codon_start=1
FT                   /gene_family="HOG000036616" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761408"
FT                   /locus_tag="AGOS_AFL189W"
FT                   /product="AFL189Wp"
FT                   /function="3'-5'-exodeoxyribonuclease activity "
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA replication proofreading "
FT                   /biological_process="DNA replication, removal of RNA primer"
FT                   /biological_process="S phase of mitotic cell cycle "
FT                   /biological_process="base-excision repair, gap-filling "
FT                   /biological_process="nucleotide-excision repair, DNA gap
FT                   filling"
FT                   /biological_process="regulation of mitotic cell cycle "
FT                   /cellular_component="delta DNA polymerase complex "
FT                   /protein_id="AAS53185.2"
FT                   /db_xref="GO:0000084"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006287"
FT                   /db_xref="GO:0006297"
FT                   /db_xref="GO:0007346"
FT                   /db_xref="GO:0008296"
FT                   /db_xref="GO:0043137"
FT                   /db_xref="GO:0043625"
FT                   /db_xref="GO:0045004"
FT                   /db_xref="HOGENOM:HBG023242"
FT                   /db_xref="InterPro:IPR004578"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="UniParc:UPI0001DB2B94"
FT                   /db_xref="UniProtKB/TrEMBL:Q755K6"
FT                   /transl_table=1
FT                   /translation="MTNALKRAGEQQGELLEKKMRRQSYDYSAGSEPVSSIEIVPTDRY
FT                   TKQNVQGYRSTQAADTKGNGDATLFEHELQQMEHESAAAQERNQQVLWSRDKLPADFAA
FT                   ATHDITFQQLDAEQAVLPGYIDGGTSAVVRFFGVTEQGHSVLCSVTGFKHYMYVPAPAN
FT                   FDARTDVPVLVDYLNDMFDGVVDSVEVCQKQSIWGYSGDQKLQFLKVLVADPYGLNKIR
FT                   TAFEKGYITPNDTWFQGGTTTYDNIAYTLRLMIDCGIVGMSWITLPKGKYAMIPKNKKI
FT                   STCQLEVSINYKDLISRPADSDWSHSAPLRILSFDIECAGRVGVFPEPEVDPVIQIANV
FT                   VSIAGESKPFIRNVFTVDTCAPITGSQIFEHETEEAMLKHWRDFLVEVDPDVIIGYNTT
FT                   NFDLPYLINRAAALNVSSFPYFGRLVNSKQVIKETVFSSKAHGTRESKSINIEGRLQLD
FT                   IFQFVRREYQLRSYTLNSVSAHFLGEQKEDVHHSIIASLHRGDSETRRRLAVYCLKDAY
FT                   LPLRLLEKLMALVNYTEMARVTGVPFPYLITRGQQIKVISQLYRKCLQIDTIIPNMHGN
FT                   HSDDQYQGATVIEPIRGYYDIPIATLDFNSLYPSIMMAHNLCYTTLCNKATVQRLQLKE
FT                   NEDYIITPNGDYFVTSKKRRGILPIILEELIAARQRAKGELKKETDPFKKDVLNGRQLA
FT                   LKISANSVYGFTGATVGKLPCLSISSSVTAYGRTMIETTKRAVEEKYTIKNGYKHDAIV
FT                   VYGDTDSVMIKFGTNELKQTMELGAEAAAYVSSLFKHPINLEFEKVYFPYLLINKKRYA
FT                   GLYWTKPEKYDKLDQKGLASVRRDSCPLVSIVMNKILRMILIERNVPGALKFVENTIED
FT                   LLQNKADISKLIISKTLAPNYTNAQPHAILAERMKKRDGVGPNVGDRVDYVIIGGNDKL
FT                   YNRAENPLYVLEQNIQLDSKYYLTTQLQNPVVSIIAPIIGEKQANAMFIVKSIKIATSN
FT                   QKGGLMGFIKKVQTCKGCRGPLKKNEGPLCYSCKERSGELYLKAVSDVRELEEKFSRLW
FT                   TQCQRCSGSLHNEVLCSNQNCDIFYMRVKARKELQEKVEDLSKW"
FT   CDS_pept        complement(90256..91674)
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930840"
FT                   /locus_tag="AGOS_AFL188C"
FT                   /product="AFL188Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53186.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020648"
FT                   /db_xref="UniParc:UPI0001DB2B95"
FT                   /db_xref="UniProtKB/TrEMBL:Q755K5"
FT                   /transl_table=1
FT                   /translation="MLSLIPNKEQKIKIFDQPVIKIGRSRSCDVVLGEPDISTVHCELN
FT                   LVEVDLDGDQKKLYNIVDRSRNGTFINGNRLMRKDYLLRNGDRIVFGKSASFLFKYVHV
FT                   EACEQPTDSPARPADEEKNSVFKKPLFSSQNTTRKPLRGKENRGVSFFDRYIPGKELGS
FT                   GHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHENIVKLLERF
FT                   VEPLSKSQVQTYLVLEKIQDGELFDRIVRKTKLQQDETRALFKQILAGLKYLHDRNIIH
FT                   RDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFTGEMQFTTTLCGTP
FT                   SYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAPPSMKEQILQGKFAFYSP
FT                   YWDEIDDSVLHLISNLLVVDPAKRYSVRDAIGHEWLTKTDDSKTSKVERPRLSETNVPK
FT                   TYSELSSIQQTASK"
FT   CDS_pept        complement(91909..94284)
FT                   /codon_start=1
FT                   /gene_family="HOG000141873" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761409"
FT                   /locus_tag="AFL187C"
FT                   /orf_name="AGOS_AFL187C"
FT                   /product="AFL187Cp"
FT                   /protein_id="AAS53187.1"
FT                   /db_xref="HOGENOM:HBG059470"
FT                   /db_xref="HOGENOM:HBG203458"
FT                   /db_xref="UniParc:UPI0000252F55"
FT                   /db_xref="UniProtKB/TrEMBL:Q755K4"
FT                   /transl_table=1
FT                   /translation="MVLTRLARHIFELYIGWAGQQAGAGDKQARHSCRLSMSAVSQDGA
FT                   EFHKADRFEEGEQLQPQPDGQRRWFPWFGSAVSGHSDVDTAVTESSVPTVALPPLQAPT
FT                   TSLLQSVVGWMPFWQTAEDGLLIDQSTEYHQLTAKQVHTLEQEALQAVARGNDSWCWHT
FT                   EYLPDMGDMAGVWGLVEGELSVANTGSQNCQLPLKEYPLEVCPLEHQSEYVVGVNNSVL
FT                   LPGHSPVEYFHPMPWTTRIASAVRGYYEPGRESHLYLKKETEGTLKDKKVIIISIVGSL
FT                   PERYEKMVLEKACSARYLGERLSEQLQSEAPRSISGISIHSPLDRKPIEDCVKECLMLL
FT                   CNWRTSFQEYDALFVAGVYHSVPLAIYLIEEIIKHQSLFQLNRKSTIGLLSFNSCLRGY
FT                   QFWDHSVDTIIEEDTNLQASREKILFQGASKIQREILSKLKNYGKQNTEESLAIKKSLD
FT                   WLLYNCKSFKMTLVSTLHDNFMTVSQKLAIDYVHPSFVRHIWCDGEQLGLDLQELSARP
FT                   EFAKFDTTYPRIFAADLDIPKERLFEVYLVSNILLAINLGHEEFIPILQLINPFYISRS
FT                   FNEHTTPANLKKQIHNEQKLWLAAADARWKNASFCSGSRIPVEAHTIQDLLQYLQYCRL
FT                   KGSNSLEIRGSMYSDSNIYRAFVHNTIHTAPLLERQHVRVSDHTVVPQSIYNGVNQYDL
FT                   VWKFHECLSRFIKLRNVPQQPIPTILFTISTDNRFLHRIRKAAFTRNTKESLRRLDLLW
FT                   HSYNEWKPQTKGLKQLQEILSVLTLYSTTDDLVKDIAR"
FT   CDS_pept        94329..94703
FT                   /codon_start=1
FT                   /gene_family="HOG000034134" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777853"
FT                   /gene_name="ATG16"
FT                   /locus_tag="AFL186W"
FT                   /product="Autophagy protein 16 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasmic membrane-bounded vesicle "
FT                   /cellular_component="vacuole"
FT                   /protein_id="AAS53188.1"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016023"
FT                   /db_xref="HOGENOM:HBG059479"
FT                   /db_xref="HOGENOM:HBG104155"
FT                   /db_xref="InterPro:IPR013923"
FT                   /db_xref="UniParc:UPI0000252F56"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755K3"
FT                   /transl_table=1
FT                   /translation="MDLHQLYLDRLRQRDRIEGNFCYLFEAAVVLETAQPPQDSRDLVA
FT                   KSLREELHAHEQEIHKLKDIVHLRSKDAEKLNDEIISLNIENSLLQDKLTALQAEYDKL
FT                   IQRWLAKAQSEADAMNQGLA"
FT   CDS_pept        94988..97864
FT                   /codon_start=1
FT                   /gene_family="HOG000200154" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777854"
FT                   /locus_tag="AGOS_AFL185W"
FT                   /product="AFL185Wp"
FT                   /function="6-phosphofructokinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="6-phosphofructokinase complex "
FT                   /protein_id="AAS53189.2"
FT                   /db_xref="GO:0003872"
FT                   /db_xref="GO:0005945"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG027559"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniParc:UPI0001DB2B96"
FT                   /db_xref="UniProtKB/TrEMBL:Q755Q5"
FT                   /transl_table=1
FT                   /translation="MTMEVPLINGTNSVVVTAYSREQYAQCMQFYSAMLRLETLTKGEN
FT                   ETVLTNKAVSVRVKYEEDKSRDQEARERREALAAAATTHDWRGEASTVVFSTVDVAKVR
FT                   QTLGLCQAYPSELAPLEVYTLDPQGNVVGFTQTKNAISTFTNVPSVVGPRHARDSMTVS
FT                   SAGSSTDLRSFGLDTTAHYPSLPKKSVAGDRKAIAVMTSGGDAPGMNANVRAIVRSVIF
FT                   KGCRAFTVMEGYEGLVRGGPEYIKECKWEDVRGWSTEGGTNIGTARCMAFRERSGRLLG
FT                   AQHLIEAGVDALIVCGGDGSLTGADLFRSEWPSLIQELLETGKITQAQYDRYRHLNICG
FT                   TVGSIDNDMSTTDATIGAYSSLDRICQAIDYLEATAKSHSRAFVVEVMGRNCGWLALMA
FT                   GIATSADYILIPEKPASSREWQDQMCDIVSTHRSRGKRTTIVIVAEGAIAADLTPITPK
FT                   DVHQVLVDRLGLDTRITTLGHVQRGGSAVAFDRILATLQGVEAVNAVLESTPDTPSPLI
FT                   VLNENKIMRKPLMESVALTKSVADAIQAKDFKKAMGLRDPEFVEHLNNFMAINSADHDE
FT                   PKLRGEKRLNIAIVNIGAPAGGINSAVYSMANYCLSQGHKPFAIYNGWTGLARHESVRT
FT                   LNWKDMLGWQSRGGSELGTNRTVPEDADIGMIAYYFQKYKFDGLVIVGGFEAFVSLHQL
FT                   ERARENYPAFRIPMVLIPATLSNNVPGTEYSLGSDTALNALMEYCDVVKQSAASTRARV
FT                   FVVDVQGGNSGYLATHAALAVGAQVSYVPEEGISLEQLSQDIETLRESFEKAHGKGKHG
FT                   KLILKSTNASKVFTTAVLADVITAEAKGDFDAKSAVPGHVQQGGLPSPIDRTRGTRLAV
FT                   RAIGFIEAKQDVIREARENEEAFDCADKAVSHTAAVLGITGSQLKFTSIRQLYDLETEF
FT                   SKRMPKVIHWEPTRAIADHLEGRKRVTV"
FT   CDS_pept        98211..99377
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625299"
FT                   /gene_name="INP1"
FT                   /locus_tag="AFL184W"
FT                   /product="Inheritance of peroxisomes protein 1 "
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="AAS53190.2"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="HOGENOM:HBG059491"
FT                   /db_xref="UniParc:UPI0001DB2B97"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755Q4"
FT                   /transl_table=1
FT                   /translation="MARPTNSAASDVIPPSSKTRMPKIKPFKTIRTTFLKKKNTIGNLV
FT                   SKGTHSSQSGGHKDSYMGDVESLTLRSPQSRGSWVESIDSKKIHSLSNDRVTLFRYEHV
FT                   RVTSYQSVRKKYRNSGDSRRGQERMESAVKGTDVLRRERASVIEPRGPLEIYQIITPIS
FT                   KEPSQKVTYLCLGRKEQIIKPILPKLRITMLTREGLQFSVLSFNPENSWKIEFLGALGD
FT                   SAVPCNVILAFENAVKNICRYTSELNNDPIEEVGTEDDDDLEYLLYSDFAEDDDTGSDI
FT                   TLNREHSSEPSDLLNCSTTNEMINDAFRKAIEHIRHVGSMPLIEAHGVKSFSSQLKIDG
FT                   EQVDPPPKASPRQRAVSVPVETRTWSKLSTHPVALSTWMDIEYDDIKE"
FT   CDS_pept        complement(99588..100748)
FT                   /codon_start=1
FT                   /gene_family="HOG000200591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761410"
FT                   /locus_tag="AFL183C"
FT                   /orf_name="AGOS_AFL183C"
FT                   /product="AFL183Cp"
FT                   /function="voltage-gated anion channel activity "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="AAS53191.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0008308"
FT                   /db_xref="HOGENOM:HBG056755"
FT                   /db_xref="HOGENOM:HBG327874"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="UniParc:UPI0000252F59"
FT                   /db_xref="UniProtKB/TrEMBL:Q755Q3"
FT                   /transl_table=1
FT                   /translation="MSATNPLSLGDFSKISPLPGIAAVPEQRTESFWSSNPISSYLISV
FT                   YNNIHAHRQTLSLVNPGTMENLNKEVSRDVFLTQYFFTGLRADLNKAFALNPAFQTSHT
FT                   FSMGSENLPNYAFSALFANDDLFMQGNVDNDLSLSGRLHYGWDKNNVSKVTLQVSQGQP
FT                   TMCQLEQDFQGSDFSLNLKTLNPSLSADGTFSGVAVGSILQSITPQLAVGIEAVYSRGQ
FT                   SSMPADAAVSYATRYVSAKQDWIFSGQLQANGALTASFWRKVASNVEAGVESTLQASMV
FT                   PIMDPVIGQPIGIQPTIEGLTTIGAKYEYRQSVFRGFINSNGRVGCFLERKILPTLSVL
FT                   FCGEIDHFKSDSKLGCGLQFETAGSEELLMMQQGLDANGNPLPLPA"
FT   CDS_pept        complement(100956..101339)
FT                   /codon_start=1
FT                   /gene_family="HOG000113550" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930841"
FT                   /gene_name="CSE2"
FT                   /gene_synonym="MED9"
FT                   /locus_tag="AFL182C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 9"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53192.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059503"
FT                   /db_xref="InterPro:IPR011425"
FT                   /db_xref="UniParc:UPI0000252F5A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755Q2"
FT                   /transl_table=1
FT                   /translation="MSAQASPATELQNPTLGQVYATLTRHSAQQTEFIPHIFYALHQLK
FT                   NDNGHTNTFETATSNIRHRLKLCKAAIAGDAHAVEMLSRPCDEWPAVVCQKEQEIEAKK
FT                   RVHRQLRQRVEEIAGPLDAAAAP"
FT   CDS_pept        complement(101362..102030)
FT                   /codon_start=1
FT                   /gene_family="HOG000211245" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777855"
FT                   /locus_tag="AFL181C"
FT                   /orf_name="AGOS_AFL181C"
FT                   /product="AFL181Cp"
FT                   /function="C-8 sterol isomerase activity"
FT                   /biological_process="ergosterol biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="AAS53193.1"
FT                   /db_xref="GO:0000247"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006696"
FT                   /db_xref="HOGENOM:HBG051559"
FT                   /db_xref="HOGENOM:HBG717428"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="UniParc:UPI0000252F5B"
FT                   /db_xref="UniProtKB/TrEMBL:Q755Q1"
FT                   /transl_table=1
FT                   /translation="MRYLRIGAVIAAVGYVMNAALYSWLPRNYMFDPHTLNRICNTVIA
FT                   KHNARGAVAPRALLQDVRDALAAHYGEEYINRYVEDEWVFNNAGGAMGQMLILHASVSE
FT                   YLILFGTAVGTEGHTGVHFADDYFTILHGEQSAALPHALEPEVYTPGMTHHLRMGHAKQ
FT                   YAMPSGSFALELAQGWIPCMLPFGFLDTFSSTLDVYTLARTVQLTARDMFKNLVYNFKF
FT                   "
FT   CDS_pept        complement(102238..102765)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761411"
FT                   /locus_tag="AGOS_AFL180C"
FT                   /product="AFL180Cp"
FT                   /protein_id="AAS53194.2"
FT                   /db_xref="HOGENOM:HBG059518"
FT                   /db_xref="InterPro:IPR013734"
FT                   /db_xref="UniParc:UPI0001DB2BAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q755Q8"
FT                   /transl_table=1
FT                   /translation="MVARQSSAHTRAQTIGMRSPLRELSGSQINQRRRDRAAKERAAPA
FT                   WGAGTPRSPRGRAAGRPPSPRPALLATPDSDGAQPGSPRARQQLHAMKVRLQLAYYKYR
FT                   TNQAHLNFHQLKQRYQCVKPRTLACTAALRTPVKVSGAGPSPTSTPTSVKAAKSLLQLF
FT                   SASAAAPTEHIH"
FT   CDS_pept        complement(103261..105198)
FT                   /codon_start=1
FT                   /gene_family="HOG000196602" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930842"
FT                   /locus_tag="AFL179C"
FT                   /orf_name="AGOS_AFL179C"
FT                   /product="AFL179Cp"
FT                   /function="phosphatidylcholine-sterol O-acyltransferase
FT                   activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="AAS53195.1"
FT                   /db_xref="GO:0004607"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG328479"
FT                   /db_xref="HOGENOM:HBG342141"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="UniParc:UPI0000252F5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q755K2"
FT                   /transl_table=1
FT                   /translation="MAMVARKKSKRRSKAGRDEKTKGSSSNTEKVVLCEQPTEEKEVEI
FT                   TVQEVMVDQGKRRWRESRRLMFTLGAVLGLLLALYFGTDVHKQTYEGLDRIVNFETFQD
FT                   YFVDWKEVVPTNILSLVTDFQLRNTRSASLQDLTTSFAIGRQLQRDHELCDKHPVVMVP
FT                   GVTSTGIESWGLYKDAECDSEPHFRRRLWGSFYMLKTMVLDKACWLRHVMLDPETGLDP
FT                   PNYKLRAVQGFEAADFFMAGFWIWNKILQNLGAIGYEPNKMVTAAYDWRLAFLDLERRD
FT                   RYFSKLKMQVEMMYDATGEKSVLVGHSMGSQIIFYFLKWVEAEGELYGNGGPGWVEKHI
FT                   DSFVNVAGTLLGVPKAMPALLSGEMKDTIDLNALAMYGLEKFFSRKERLDLLRSWGGIP
FT                   SMIPKGGNLIWGNMTYSVEDVLHNNTDTYGNFIRFNKPQGPLSSRNLTMEDAIDYIFEL
FT                   APGWLGRRATDQYSFGYATSPEQMQLNERHHAHWSNPLEVPLPRAPSMKLYCLYGVGNP
FT                   TERAYVYKEERKISSLNVTIDYESDTPVFFSDGDGTVPVLTHAMCHKWAEGVSPYNPAG
FT                   INVTIVEMQHQPDRFDIRGGAKSAEHVDVLGRAELNEYILRIAAGHGASIQPRFLTDMA
FT                   DWVARLNFPL"
FT   CDS_pept        105476..106324
FT                   /codon_start=1
FT                   /gene_family="HOG000234613" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082184"
FT                   /gene_name="ATG3"
FT                   /locus_tag="AFL178W"
FT                   /product="Autophagy-related protein 3 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53196.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG524450"
FT                   /db_xref="HOGENOM:HBG602769"
FT                   /db_xref="InterPro:IPR007134"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="InterPro:IPR019461"
FT                   /db_xref="UniParc:UPI0001DB2BAF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755K1"
FT                   /transl_table=1
FT                   /translation="MLRSTLSNWREYLTPVTHQSTFENTGQITPEEFIKAGDYLCHMFP
FT                   TWRWNQQQGGMVYRDFLPQDRQFLVTRKVPSNMRAADSVNVGGEEETSAGEYWVLQPQQ
FT                   ESADGGEEIDIDEMLQEMDIEDQSGEQDIIQLRPSHTRFYDLYITYSTSYRVPKMYLVG
FT                   FNNDGTPLTPQQMFQDIAPDYRTKTATIEKLPFFKSAVVAVSIHPCRHANVMRVLMEKV
FT                   RAAKQKPVEEEQPDGPREDWEDLQDEVDSSLRVDQYLVVFLKFITSVTPGIEHDYTMEG
FT                   W"
FT   CDS_pept        join(106502..106577,106644..107689)
FT                   /codon_start=1
FT                   /gene_family="HOG000161510" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625300"
FT                   /locus_tag="AGOS_AFL177W"
FT                   /product="AFL177Wp"
FT                   /function="damaged DNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53197.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG435659"
FT                   /db_xref="InterPro:IPR000465"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR022656"
FT                   /db_xref="InterPro:IPR022658"
FT                   /db_xref="UniParc:UPI0001DB2BB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q755K0"
FT                   /transl_table=1
FT                   /translation="MRLYFNSLHRLLSVHGADRRAEGCCPNRRKALERLKQRGISKPAH
FT                   GGPAAGGVRASADFARPVVTTGLERQIEQNRQTARKRLQQTQQNLRDASSIINTGHALG
FT                   SPSAHPTGNTGSRLRPAIRRQDYIEYDFSTMKNTNGGFINREDDQGYGDNALAQEKQRS
FT                   LEEWQREQRARRALYENQPPPAHMSLAPKCTQCNINTEMDPVMKDVFHLQVCKSCVKAH
FT                   PEKYSLLTKTECKEDYFLTDPELNDASLFDRLEKPNPHSGTFAHMQLFVRCEIEKYAFE
FT                   KWGGEEGLDNEWQRREEGKIERREKKYQQKVREMRLKTRAQEFTTRLKEKKYGKDHTHE
FT                   FGAPVDGGSNEDGIPVQKRRCFGCGIEIEEIML"
FT   CDS_pept        complement(107864..109678)
FT                   /codon_start=1
FT                   /gene_family="HOG000000859" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761412"
FT                   /gene_name="VPS27"
FT                   /locus_tag="AFL176C"
FT                   /product="Vacuolar protein sorting-associated protein 27 "
FT                   /function="zinc ion binding"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="AAS53198.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="HOGENOM:HBG059536"
FT                   /db_xref="HOGENOM:HBG395505"
FT                   /db_xref="HSSP:1VFY"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017073"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR018205"
FT                   /db_xref="UniParc:UPI0000252F60"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755J9"
FT                   /transl_table=1
FT                   /translation="MNTEIQTVAALGECIQRATSESIPNGEIDLALALDVSDAVRSRRL
FT                   GARDSMRALKKRVLQTKSNPNTQLAAWRLVEVCVKNGGTHFLKEVCSREFMDCMEHVAA
FT                   QEKTVDNEDLVQLCRRIIFELYTAFKNDSQLSYVSQVHQRLQARGVEFPQAAPGYLVNT
FT                   MAMFDSKAPADWVDSDACMICSNAFTFLNRKHHCRSCGGIFCNEHSSHQLPLPEMGITE
FT                   PVRVCDNCYDEYEIKKHSSRRLRRQSQRRARPKAEREDEDDDLRRAIELSLRESKTQDN
FT                   LVPTVTRLENSDATKDDEDPEFLAAVQASLREHQLEQERQAAAAAAAAKHPSQPERAVQ
FT                   LPSLMDSRQAPVAQQRYSTLTNQEEDDIYLFANLVEKMKGQPMNAVLEDTQLQMLYQKV
FT                   LGTRPRLNHSLNDTFHKYNTLVDMNAKISDIMSIYDTMLERQLRNINLSQQYSMPHLPS
FT                   DPYTYQMHRQPESSPANTVPYEKTQPEPTYRSYARSSSNAAELTPAILHTTQSSPMENR
FT                   QSQSVTGFEPQVSEPDIKKTLLSSPSEPLYPPEESIPDKEKEAQVPITQFEFPSVPAQK
FT                   IKMATPQNERVTEDAGTTPQEETLLIEL"
FT   CDS_pept        complement(110009..110770)
FT                   /codon_start=1
FT                   /gene_family="HOG000246668" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625301"
FT                   /gene_name="ROT1"
FT                   /locus_tag="AFL175C"
FT                   /product="Protein ROT1"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53199.2"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059541"
FT                   /db_xref="HOGENOM:HBG332450"
FT                   /db_xref="InterPro:IPR019623"
FT                   /db_xref="UniParc:UPI0001DB2BB1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755J8"
FT                   /transl_table=1
FT                   /translation="MVYVSWSAAALLCASFFSTVVLAQSAKDLYGTWSAKSNQVFTGPG
FT                   FYNPADELLIEPSLPGISYSFTEDGFFEMATYRVSGNPRNLACPSAVMTFQHGKYEILA
FT                   NGTLILRPFEVDGRQLVSEPCVDKGVSTYLRYSQVETFQRFAVELDEYHGKHALHLFQF
FT                   DGSPVQPLYLAYRPPLMLPTITLNPTDHAGATATAGPGHRKRSLGELVRAGLQDKHKTT
FT                   AVRNPSLFNAAFYWWCSAGVIAAGTVLFFMV"
FT   mat_peptide     complement(110012..110701)
FT                   /gene_name="ROT1"
FT                   /locus_tag="AFL175C"
FT                   /product="Protein ROT1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755J8 "
FT   sig_peptide     complement(110702..110770)
FT                   /gene_name="ROT1"
FT                   /locus_tag="AFL175C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755J8 "
FT   CDS_pept        complement(111464..113002)
FT                   /codon_start=1
FT                   /gene_family="HOG000111606" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761413"
FT                   /locus_tag="AFL174C"
FT                   /orf_name="AGOS_AFL174C"
FT                   /product="AFL174Cp"
FT                   /protein_id="AAS53200.1"
FT                   /db_xref="HOGENOM:HBG059548"
FT                   /db_xref="HOGENOM:HBG203941"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014399"
FT                   /db_xref="UniParc:UPI0000252F62"
FT                   /db_xref="UniProtKB/TrEMBL:Q755J7"
FT                   /transl_table=1
FT                   /translation="MSVSSCDVPLGLIVNAKQTYYPIELSNAELLAHYETIQDYHQEIS
FT                   ENVLQHSCRVKPDPKLIDQQPEMNPQHTRTAIVNFAFELAQKTRVTNGIFFHAVRLYDR
FT                   YCSKRVVLRDQAKLVIATCLWLAAKTWGGCNHIINNVTVPTGGRFYGPNPRARIPRLSE
FT                   LVHYCGGSNVFDESMFTQMERHILDTLSWDVYEPMVNDYVLNVDENCLIQYELYKRQLE
FT                   HNRQYANKRNSQDSNATEEDVSEEDEDLDNKIQLINIKKFLIDLAVWQYDLLKYEVFEL
FT                   AHGIFSIINKFTNQDLGPLLLSPIPSTNNESLVLNVFINGVIKCPAALLESYHEKFGVL
FT                   QFVDQVKEYHESLQKKLQLAAAMDLSRRNNAKFYEAPSMPSPTYSQHSSYTPLRNTSNS
FT                   ESSVFSSVSNQQSPITPQMYSFSVQKPGSACGSSVSVNSISQKRNRDEETNYSIMGNDK
FT                   ENYDPTSTYTVPPRAKFAGHTYIFTGAAKEEQTSSTSNRSSLISLAIGNANSLV"
FT   CDS_pept        complement(113592..114683)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761414"
FT                   /locus_tag="AGOS_AFL173C"
FT                   /product="AFL173Cp"
FT                   /protein_id="AAS53201.2"
FT                   /db_xref="HOGENOM:HBG059556"
FT                   /db_xref="UniParc:UPI0001DB2BB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q755J6"
FT                   /transl_table=1
FT                   /translation="MRGWGNVWYSGPWALLVHAGHACLFHGNEAVEKWPVVGQVRCNFS
FT                   EDAVHLVVYAERAFQLQTVQLATRRRTEQAVVSVAYGVARFEVLWQDGIIVAMDGVGGR
FT                   VHCVDTRRQRTLGCVQTNADDGAIYVVGARAFQVFVRQLDKATATEQLFFNTYELGADG
FT                   AVRLQQAVRLGSSAGRHFAARLGNVFAVVLSCPFTRRSALSLHVDGQPAPLAQLQLPFV
FT                   HDAAFCDHWTLALALDARLALLRPLAGTLAAVPLAAARVHNGPARIIASPLGTPGLPDP
FT                   LDSPPAQPSPPDVVPSLCLLTARPQHIAALFAARPNWVYLWSPPDTSPAHPRLTGIILP
FT                   DALVAATPDDRYFAGSYTAYTLR"
FT   CDS_pept        114853..115914
FT                   /codon_start=1
FT                   /gene_family="HOG000184676" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625302"
FT                   /locus_tag="AGOS_AFL172W"
FT                   /product="AFL172Wp"
FT                   /protein_id="AAS53202.2"
FT                   /db_xref="HOGENOM:HBG059561"
FT                   /db_xref="UniParc:UPI0001DB2BB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q755J5"
FT                   /transl_table=1
FT                   /translation="MGWLGDNSEDSTGAVRWVMDALLGKRESPSQKYRREFAQDDTNNR
FT                   LQVPRSAGARRRRTGSLDSEFRARYELLPDETEGAGASLLSPVDLRPAGTAARESGTPG
FT                   RAGWAGGAAGTLGGGDGGCDGGRDGDTFGRARGSEDVAFRPPRADNPLVSALFAQPSSP
FT                   DAGLPGSFPGRAPRARDPTHDYLALLDQLARNNRDLHSLQQDLEAREERDRRETSYRDR
FT                   YLQLRQELIQELKQSKTMYDNYTALYERYKALKDAEHPDYAELVSKLEAQIVDLTIADQ
FT                   QKDRRHQEELLRLQLQYEARIHELERKLNHQNSTYTANDTATPASTVDSGSISPYHKYN
FT                   DTIDTQFLNHIVK"
FT   CDS_pept        116263..117561
FT                   /codon_start=1
FT                   /gene_family="HOG000111175" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930843"
FT                   /locus_tag="AGOS_AFL171W"
FT                   /product="AFL171Wp"
FT                   /protein_id="AAS53203.2"
FT                   /db_xref="HOGENOM:HBG435435"
FT                   /db_xref="UniParc:UPI0001DB2BB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q755J4"
FT                   /transl_table=1
FT                   /translation="MSMVQTPQHGSAMGGQLAEGGGMNGGGVNGGDAGRKSPGAGTPPP
FT                   PPRGNKRLDLEEMVAEFSALLGNENWSKYAQIISLFILGKLSRKELVQQLDVLLAPAHS
FT                   PGDARAPPVSRAVLVRLHNQLLLAILANSLRDSPLGSKAGDAWGFQNGATYQNKKRTNK
FT                   HNSQIETYKKIVMSLPSKDRQRLKAITKENGKRGFVLCSVLQNRLANIPKIPIVTNQET
FT                   LKRVKANSLKTPLEWSQEIVSGFSAPLASESYSLPDNDSLYLRMVSIAREHGLVGTVDG
FT                   RCVEILSLALEYYLKTILESAIDTVRYREKKYSDYYDLNDYGFQQAISETNKETKMDPA
FT                   AYLSGNKVISLTNEDLQETFTIYPNLVEPSGALLRLNATGLVNDNELVQLKSPIDDMPQ
FT                   FFEDKPTFTPVDERNMGTREELNWLIKDILTKE"
FT   CDS_pept        complement(117692..119593)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930844"
FT                   /locus_tag="AFL170C"
FT                   /orf_name="AGOS_AFL170C"
FT                   /product="AFL170Cp"
FT                   /protein_id="AAS53204.1"
FT                   /db_xref="HOGENOM:HBG059568"
FT                   /db_xref="UniParc:UPI0000252F66"
FT                   /db_xref="UniProtKB/TrEMBL:Q755J3"
FT                   /transl_table=1
FT                   /translation="MNKTRIPSISLKRARECGEVDSQPPRYKRASGKSPLAEITNTASS
FT                   SPHISEDKMLSTKSMFGSSGQSSRLMNKYYYGDPRVIEEVKRRERKVMKDIQHFKKSIE
FT                   EVERDMKTMVEESIPGLRYTLSKKAAVYKDLRVETAQVTARLDLLANKCGVMRANTELA
FT                   LNNITLEQQVEVQNLENELDRRINALREEWELKLLSLEKFKPNDDLVKEIEGLKQELNK
FT                   EQKTWDRLQRENEEKRKEFELILEQDFLRFKEEKLSLYEDLTEKREHLFQEKNKKQLEL
FT                   KQLHSIVEQHRREKAELAIDIQAITEEIVHYEQQLKPSQARLQQLKEQLNTEVHETEEI
FT                   RKKASAAEQEYNTLYDKMEDEQLSRRRIENTIEELRGNIRVFAYVSDASVPYTIDYASK
FT                   TITVGSAKQYCFDRLIPKELVPLQELLEQECQAYMDMCLQNQYDSSVISLQQENDHSIR
FT                   NTFIGWMLSQKHKRINFQCVVLSENSPSVDLLLRKRLSGETNREIKVTLDNKSVLFEST
FT                   SILVESGGSAEDIIKQLGTDYNKEGILILKFQIWGENETSTDVYFIEVTPPAYNCLHST
FT                   GSAGSTGSSFGSSRIGAILRSLLMHTKPLLLLTLTQENSLLLDISQQIGQREKQQPA"
FT   CDS_pept        complement(119998..120453)
FT                   /codon_start=1
FT                   /gene_family="HOG000244518" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761415"
FT                   /locus_tag="AFL169C"
FT                   /orf_name="AGOS_AFL169C"
FT                   /product="AFL169Cp"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="electron carrier activity"
FT                   /protein_id="AAS53205.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="HOGENOM:HBG267069"
FT                   /db_xref="HOGENOM:HBG524254"
FT                   /db_xref="HSSP:1AYF"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="UniParc:UPI0000252F67"
FT                   /db_xref="UniProtKB/TrEMBL:Q755J2"
FT                   /transl_table=1
FT                   /translation="MLGRLLPISARAVRFARAPPFMRALRAHGHLSTPRKGEELQVTFI
FT                   LKDGSQRTFDVAPGDTLLDIAQGHNLDMEGACGGSCACSTCHVIVDPDYYDALQEPDDD
FT                   ENDMLDLAYGLTETSRLGCQIRMSKDINGLRVALPAMTRNVSNSDFS"
FT   CDS_pept        120751..121398
FT                   /codon_start=1
FT                   /gene_family="HOG000116573" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761416"
FT                   /locus_tag="AFL168W"
FT                   /orf_name="AGOS_AFL168W"
FT                   /product="AFL168Wp"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS53206.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG384598"
FT                   /db_xref="HOGENOM:HBG492790"
FT                   /db_xref="InterPro:IPR007705"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI0000252F68"
FT                   /db_xref="UniProtKB/TrEMBL:Q755J1"
FT                   /transl_table=1
FT                   /translation="MASLLKSYEADFQATLEQCQRLLRQAQGEPVAQRNATLQTLEQHK
FT                   DDLYDILDQMEVEVNNMVGDPARQVASRSALRDLRREAGMVKQQLRELMDARDRDALFP
FT                   AGAADMDNEQRQQLLSNHAMLQQTGERLVDAMRLANETEGIGNQVMMDLRSQRETLEHS
FT                   RQNLFLADSYVDKSVRTLKTMSRRLVANKFISYAIIAVLILLILMVLYSKFK"
FT   CDS_pept        complement(121503..124760)
FT                   /codon_start=1
FT                   /gene_family="HOG000011547" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761417"
FT                   /locus_tag="AGOS_AFL167C"
FT                   /product="AFL167Cp"
FT                   /function="mannosyl-oligosaccharide glucosidase activity "
FT                   /biological_process="oligosaccharide metabolic process "
FT                   /protein_id="AAS53207.2"
FT                   /db_xref="GO:0004573"
FT                   /db_xref="GO:0009311"
FT                   /db_xref="HOGENOM:HBG157410"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniParc:UPI0001DB2BB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q755J0"
FT                   /transl_table=1
FT                   /translation="MSRVDTSDLVGVTVEEQRLAENRQQSKYWLKWGPYLSERSWATVR
FT                   EDYSFDGDAWRHFPFEQANARVFRWGEDGIFGVSDNRQLVCLNVGMWNGRDELLKERMF
FT                   GLTGPQGNHGEDCKELYYYLDNLPSHAYMKALYKYPFKRAFPYQELIAGNDARGYAERE
FT                   LEVYELDGLYREAATGDTPYYDVVFEMAKGDENPDDLNFRITVHNRSKTETGELYLMPQ
FT                   VFFRNTWAWNTKGEESAKPRLHQSHRNVVTIEHAKYGTRRAIFAPSPGWFDSKDSEDIE
FT                   PELLFTENESNLRKLFNEPSNPAPYTKDAFDEYVVHGNTGAVNPAREGTKAAALYHFPK
FT                   IPPNDYVTVRYKFTDEWLPRYNEELVIDEEAHDAVFDRREQEAENFYWRISPVPIPPEL
FT                   RKIQRQAFAGLLWSKQFYHFIHEQWYEGDPLVKPRPPQDRANGRNKQWKHMYTDDILSL
FT                   PDKWEYPFFASWDTAFHCTPLAMIDPDFAKRQLDLLTREWYMHPNGQIPAYEWNFSDVN
FT                   PPVHAWAVYRVFKIERNIYHREDRLFLERVFQKLLLNFTWWVNRKDSDGNNVFEGGFLG
FT                   LDNIGVFNRSEPLPTGGKLEQADSTGWMAFFSLQMLNIALELAKENPVYEDIASKFFEH
FT                   FILISDAMSFSYGKSYNEGEPEKSQEGYLWNDEDKFYYDVISWGGPFKQQLPIRSLVGL
FT                   IPLYASMTLEPGVLDRFKSFKKRVEWFIEHRRDIFDRNIASMEKRGVGERLLLSLVNKE
FT                   RLEAILRRMLDETEFLSDYGIRSLSKYHEEHPFEMEVGGMKYVVKYLPGESDSGMFGGN
FT                   SNWRGPIWFPTNFLLVESLQKFFLYYGSDFKVECPTGSGEFLNLAQVAEEISHRLIHLF
FT                   VPDANGLRAAYYGDHAEFLSKDEHFKDLIPFFEYFDGDTGRGLGASHQCGWTSLVAKWI
FT                   HDAGASCLRLPRTPRSHTSITNLGEATPTGHSLLPKLSRRKSGRSLINLTGTHLELTEE
FT                   EKILHTMGTMNSNSATTEDSYKDGQTGLSSPKLAAATGSNSEHGLDGADSAHMSLEGIR
FT                   MHAQRENSLIAQLKERLKNLTAAGELSADEEEELETH"
FT   CDS_pept        complement(124955..125338)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761418"
FT                   /locus_tag="AFL166C"
FT                   /orf_name="AGOS_AFL166C"
FT                   /product="AFL166Cp"
FT                   /protein_id="AAS53208.1"
FT                   /db_xref="HOGENOM:HBG059583"
FT                   /db_xref="UniParc:UPI0000252F6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q755I9"
FT                   /transl_table=1
FT                   /translation="MHSDSPINYSPLDTYNAGAAWQHALRAAPLCEQLPQLSNTPDELD
FT                   DMCYDELDMYAELSGLPPPGSVGDEDIFALDEDAQCAAGPGPSAAAHPLPRMIDVTKGC
FT                   ELPADIEFANAARDNYRLWLASV"
FT   CDS_pept        125643..125927
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761419"
FT                   /locus_tag="AFL165W"
FT                   /orf_name="AGOS_AFL165W"
FT                   /product="AFL165Wp"
FT                   /protein_id="AAS53209.1"
FT                   /db_xref="HOGENOM:HBG059591"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniParc:UPI0000252F6B"
FT                   /db_xref="UniProtKB/TrEMBL:Q755I8"
FT                   /transl_table=1
FT                   /translation="MYSGTTTWYRPTDRTQNMDNRRRSAEGQPPCKAQACAIQACLKRT
FT                   GYEEGRCAAAVEALYTCCAQFYEREGRDARSVCCPAPDVVAARRQEVDK"
FT   ncRNA           complement(126091..126119)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR11"
FT                   /product="AgSNR11"
FT   CDS_pept        complement(126214..126798)
FT                   /codon_start=1
FT                   /gene_family="HOG000141900" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082185"
FT                   /locus_tag="AGOS_AFL164C"
FT                   /product="AFL164Cp"
FT                   /protein_id="AAS53210.2"
FT                   /db_xref="HOGENOM:HBG059596"
FT                   /db_xref="UniParc:UPI0001DB2BB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q755I7"
FT                   /transl_table=1
FT                   /translation="MYSTSVRTVQPCVTAARRLQQTWAPPTYFNTPAQAPRAQAAPARK
FT                   PLLEGALFVAVGTLAFFAVDNYRERTAAEVRLQKQLLESQRMHEVFTRQVNAARRKREL
FT                   QVLNERKATQIRQMKMALHIAMLREQLHDRGVEAVGVDQVLQEFDRHVRMENSISNVSG
FT                   TSLWVVDDAPAKPYVPNVRDYDPTGTPAGTS"
FT   CDS_pept        join(complement(128027..128042),complement(127515..127801))
FT                   /codon_start=1
FT                   /gene_family="HOG000155312" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082186"
FT                   /locus_tag="AFL163C"
FT                   /orf_name="AGOS_AFL163C"
FT                   /product="AFL163Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS53211.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG024774"
FT                   /db_xref="HOGENOM:HBG324276"
FT                   /db_xref="InterPro:IPR000509"
FT                   /db_xref="UniParc:UPI0000252F6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q755I6"
FT                   /transl_table=1
FT                   /translation="MAVKSGIAVGLNKGKKVTPMTPAPKVSYRKGASSKRTTFVRSIVR
FT                   EVAGMAPYERRLIDLIRNAGEKRARKVAKKRLGTFGRAKAKVEEMNEIIAASRRH"
FT   CDS_pept        complement(128499..129284)
FT                   /codon_start=1
FT                   /gene_family="HOG000247967" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761420"
FT                   /locus_tag="AFL162C"
FT                   /orf_name="AGOS_AFL162C"
FT                   /product="AFL162Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS53212.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059607"
FT                   /db_xref="HOGENOM:HBG396219"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="UniParc:UPI0000252F6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q755I5"
FT                   /transl_table=1
FT                   /translation="MVLQAFTGVGLGFKRNFSSGLHLLRAWKQIEVRKLAKQPEYKVGD
FT                   EKPRYIPSKRKTVPDYKYGESRIFKQSNNGLYGGSFIQFGNNISESKTKTRRTWLPNIV
FT                   RKSLWSEALQKDVRIKLTAKVLRTISKEGGLDNYLTKDKSARIKELGPKGWELRYRVLV
FT                   ARERQLNPPHKDAQAITTEDGRTVTVYYEVPLNGTTLRITCGRRRLLFHLFNREHREHK
FT                   ADGLHLTFKSFLDKHRDTPVPDIVSRLVALGHSMEELTV"
FT   CDS_pept        complement(129492..131981)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625303"
FT                   /gene_name="GYP5"
FT                   /locus_tag="AFL161C"
FT                   /product="GTPase-activating protein GYP5 "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="exocytosis"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53213.2"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG203972"
FT                   /db_xref="HOGENOM:HBG252912"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI0001DB2BB7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755I4"
FT                   /transl_table=1
FT                   /translation="MVEAGAKISKGGTQQAAGHGLEGYASDGSTDLRSAGAAEHETQDS
FT                   AKAQENEASANSMDDGLELGRRGQGVSPVLTPPTEEEGDAPAQKNRRQRLKERKATAAA
FT                   AGALPGIGRARSGSVKEGGSPKAAGAESPRRGAGAAAKDAKISERAEGAGSPQQRKQGT
FT                   GAAAPGSPPRRRLEAAEPPATPPRRKQAEGEQSRPEGEQGRPENKNKKAKDKHDDLPTR
FT                   GPGTRRPQVRAVPPPLSEELKNEAFRKTLERVETVAPEVPLQAAEQRSEPSDFDLIINR
FT                   LRVNAQEYMSQDEQAQENLQEGVRQLKSSYTEFLQTIQPEEKKKGDVEELDEEEEEMRK
FT                   IDWQFWTSVVNNFATVAKNDSAKLEEKVSDGIPKQIRGIIWQLISNSKSKEIRQLYQDL
FT                   LQIPSEHEKAIQRDISRTKFIPVDKTESLFNVLKAYSLFDPEVGYTQGMAFVTAPLLIN
FT                   VWEEADAFGLLIKLMKNYGLREFFLPDMPGLQLKLYEFDRLLEENSPQLYNHLIRLGIR
FT                   SSMYATQWFLTLFAYKFPLGFVLRILDVIFVEGIESLLKFAVILMLKNESVLVQLKFDK
FT                   LLDFLKDGLFNYYLKENVRKRQEGKEDTNAIQNAEVSDSSSKSSTVGSEILGVEYNINV
FT                   FIQDAIREVKITPIQLRRYSSEYEEIHQLEFQREAQYEEMRIKNRQLQREVRKLEHDYT
FT                   LLNREHIMLANELIQNRLKIETLNDENKDLKLTVDVLKRHLSDEMRKQTLPNPDAQIPT
FT                   DLKEDLEKTMQRNLEVMNQNQELEDKVTALERQVKQLKKNRANTSVEHGEDSSSEPRVR
FT                   SHIVTPSISSWTFKKPW"
FT   CDS_pept        complement(132308..134254)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930845"
FT                   /locus_tag="AFL160C"
FT                   /orf_name="AGOS_AFL160C"
FT                   /product="AFL160Cp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53214.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059616"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR005600"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000252F70"
FT                   /db_xref="UniProtKB/TrEMBL:Q755I3"
FT                   /transl_table=1
FT                   /translation="MRPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRS
FT                   PLTRAHLTEVETRLGQMEQLLRNAFVDLDADTLLKHRHDPQLREILFGRTVDIGALSRT
FT                   DEYMASPLPPLRQAEFQWYERRDLLTGTGFNMKQSPLHSLVAEAQQEGLMARPSKYERM
FT                   QLEEQSTTLRYMQAYFEHFHWLYPVVDEHEFYLLYEDPSTAPDACLWTGLVNVVLALGA
FT                   WCAGAPPAAHVFYYDKAESHVLGRMLRTGDRVLAIALLLMAHYNYMTHHRNTAWMLLGL
FT                   ASQLATSLGLHRDLQGLPPKQRTLAQILWWGIYSTTTQVALELGRPSPLPRIGHTDVPV
FT                   PDMTNPLYSHLANEVNLVIQLQRIMHVPNPSVAVCLQWYQTVKDFYHNIHPGAGDDRDS
FT                   YLLPREATDEQPNRLFCKYRITWKFHICVVSILFNSIMGNVPNVDTNSCYSMCLKFTND
FT                   IINSIATFFNTYSLPHLLSWYSINYMIRASTVPLYCLNSPPPKTSDLEFLLRSQLIATK
FT                   DFLKKFLPESKLALRYSDMLADACNRASLRSHSPCIGSVEPPPLVPEPAAFSAFSAPHS
FT                   PTAPCADTFSDLLPFWNRPAGKADSPLLNPNQISAAADCSAMFDDIATLNSPDLYTTAV
FT                   KDPGTDSPLTDTA"
FT   CDS_pept        135171..139142
FT                   /codon_start=1
FT                   /gene_family="HOG000141897" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777856"
FT                   /locus_tag="AGOS_AFL159W"
FT                   /product="AFL159Wp"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent 3'-5' DNA helicase activity "
FT                   /function="nucleic acid binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /protein_id="AAS53215.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0043140"
FT                   /db_xref="HOGENOM:HBG059623"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR015906"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR022758"
FT                   /db_xref="UniParc:UPI0001DB2BB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q755I2"
FT                   /transl_table=1
FT                   /translation="MTRSRCFPSLASQVRWAQESGVCTPDGTQIFGFLRGTGGGAAGKR
FT                   ARQESGGADGRADGQGGGARAGGGAEEARAARGSAAQTGAGWAACSVHSSPERAAGAGG
FT                   PRGGEGQAEQAYALVRLLKRQCALLQRKCALLEGAEGAQRARPPQLQRVQAALDTVADE
FT                   VRRAEAPLNRMESSLGSSVAAVGLPFAARSEPAGGTRAVRPAQVVAIETDDESDGEEQP
FT                   RAIAQRRVQRRLRLRQQEVSYRVPALDEDVGFRTRAGALRGATDDSDATAEAETEDSHF
FT                   LSTMDEDVDDEIHASDREFIADGLENYLQDGNSGDEDYVFNSAAETTHDGPYSNTQSQA
FT                   LTCSQLCSQKTDYAAHQGSAQKLPRDDHVHTERTAQEIVINSSFQREPSEDLLQEDSIP
FT                   EINLLDQDEDEDLFADPILHSIQPTSPQAELEEEIEPIVGDLSDSDLEAFNHEREFQTP
FT                   VNDIKELDDDLKIISEKTLDSTVDLGNTVSTSTQSALPTLKTEGFLNANQDFLEDDDFS
FT                   IIEIQELPTPHAGGPEALQDTSEPHALTHPWSAELYHKLHNVFKLPGFRPNQLEAVNAT
FT                   LQGKDVFVLMPTGGGKSLCYQLPAIVKAGCTHGTTIVISPLISLMHDQVEHLLAKNIKA
FT                   SMFSSKGTAEQRRQTFNLFINGLLDLVYISPEMVSASVQCRNAIQKLYRDKKLARIVVD
FT                   EAHCVSNWGHDFRPDYKELKFFKVEYPDIPMLALTATASEQVRMDIIHNLHLKEPVFLK
FT                   QSFNRSNLYYEVLRKDKNSLKDISHSIKTRFKGQTGIIYCHSKNSCEQTAAIVQDSGVR
FT                   CAYYHAGMEPDERLAIQQQWQSDKIQVICATVAFGMGIDKPDVRFVYHYTVPRTLEGYY
FT                   QETGRAGRDGKYSYCIMYYSFRDVRNIQSMIQKDKNLDRENKEKHLTKLQQVMQYCENT
FT                   TDCRRQLVLSYFNEQFSSQECSKNCDNCQNGSNVEYEERDVTDEALQITKLVQSVEGDK
FT                   VTLIHCQDIYKGSKNAKVIQMCHDQSHYHGLGKRMTKSDIERIFFHLITSQILQEYSVL
FT                   NGRGFASNYVKLGPRANQLLRGNMKVKMQFAINHLISRPLSASGEPNLVTAPSANVPAT
FT                   SKANDEAHAMLSAIGNYRYQDTPYTTSGKTSKADCAMQNFSSHPADTQRHISASYTKLH
FT                   NIVTRKTKDYGYDSSDSFIPPDVLKQMALLLPQTQWDFDQMSPNMQLGSKFKYFKNALV
FT                   RLKRERASIASSSGHQRPKENNNTQTSSFEGPRSEFFAASRDQETADQQILSQLRQTMA
FT                   VSPNKRASQTPAKRSKPYRPPKRGKYRKSSKSGGRRPIR"
FT   CDS_pept        complement(139224..140918)
FT                   /codon_start=1
FT                   /gene_family="HOG000179304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930846"
FT                   /locus_tag="AFL158C"
FT                   /orf_name="AGOS_AFL158C"
FT                   /product="AFL158Cp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS53216.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG056374"
FT                   /db_xref="HOGENOM:HBG398100"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000252F72"
FT                   /db_xref="UniProtKB/TrEMBL:Q755I1"
FT                   /transl_table=1
FT                   /translation="MPALELMVDILKELVVQPWRRLKWGFIPVRRRLEEDAGGVATTTE
FT                   DGSLKESGLQKTTSLDTFTEEKYEYRDESKRPWWKYLDEQEYRVTKAHASKRRSWSWFG
FT                   TATSKAEKKLLFKLDVLLAFYSCLAYWVKYLDTVNLNNAYVSGMKEELGMSGNDLVNTQ
FT                   AMFTVGAVIFQLPFIFILNKVPLNYVLPALDLGWSVLTLGAAHVNNVGQLKAIRFLIGV
FT                   FEAPAYLSYQYLFGCFYKHDEIVRRSAFYYLGQYAGILSSGGIQSAVSATLDGKNGLSG
FT                   WRWSFIIDAIISIIVGIIGFYMLPGDPNNCYSIFLTDDEIRLARRRLEESNIDKSDFSS
FT                   KIFDKQLWKNIMTDWKIYILSIWNIFCWNNNNGPAGAYLLWMKSLERFSTPNLNRLSMI
FT                   TPALGMVYLILTSLIADLGHSRLAAILLTQVFNFMGNVILAVWDVSESAKWFAFMLQYF
FT                   GWAMAPVLYSWQNDICRRDARARAVILVVMNTVAQAMQAWISVLVWKTSEAPRFLKGFT
FT                   FTSVDIFCLSMWTFVVLWFYKRDERMHCRENNVIIVNPKKDEGKPPV"
FT   CDS_pept        complement(141840..143156)
FT                   /codon_start=1
FT                   /gene_family="HOG000260968" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930847"
FT                   /locus_tag="AGOS_AFL157C"
FT                   /product="AFL157Cp"
FT                   /protein_id="AAS53217.2"
FT                   /db_xref="HOGENOM:HBG020934"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001DB2BB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q755I0"
FT                   /transl_table=1
FT                   /translation="MDYRGGKRSSISFGSYQRPMEQFQNAGGGIYQRQSPMLYHPRSLE
FT                   VGAPHAYCADLPSPQFAVDWDACDRVAIGSYKEDAFNKLTVLQATPDLSHWDSVAQASV
FT                   IYPLSKIQWMPKGTGKLATCSDSLRIWSVEEQLHEQLNLSLVKYGKSLGEVSNGRMLGQ
FT                   LPPVTSFDWNALDTNLILSSSIDTTCTVWDLQASNYVKTQLIAHDSEVFDAKFLTQSSN
FT                   LFASCGGDGSVRVFDLRCLAHSTIIYEPQQQVQGQTPSQTQVHTLAAHEQDGQLQKNSQ
FT                   SSALSSSASSSLGALDNCALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPMLLLE
FT                   GHAAPVNQLKWHPSKPNVLATCGDDCQILYWDLLELLSASQVWTGLTQQRWSTTSTVRT
FT                   LETPQMSYTAQYEVNNFVWRPSGDWIGYTAGKRFYNIRM"
FT   CDS_pept        143544..144242
FT                   /codon_start=1
FT                   /gene_family="HOG000248070" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761421"
FT                   /locus_tag="AGOS_AFL156W"
FT                   /product="AFL156Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS53218.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059635"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniParc:UPI0001DB2BBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q755H9"
FT                   /transl_table=1
FT                   /translation="MARQNFVGLVISHGKMQKTVKVRVETKVFNKRLNKEMMHRKDYLV
FT                   HDEGESAREGDVVRIEATRPLSRRKYFSVAEILKNQGQRQVEFQADAKRAVRADEAARA
FT                   QAFLERREQRTTAGTTLVADVAALQEAYTQGTLDSPEVAAIRERYGVSEFTPDTLQKLL
FT                   ELDVTAMEQEVMRQRTRLEDVLSRLEAYMQDQAAADAYLRSKNVEAPEELKKHTRKNLL
FT                   RKHITADLLN"
FT   CDS_pept        complement(144302..145087)
FT                   /codon_start=1
FT                   /gene_family="HOG000111157" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761422"
FT                   /gene_name="RBD2"
FT                   /locus_tag="AFL155C"
FT                   /product="Rhomboid protein 2"
FT                   /EC_number="3.4.21.-"
FT                   /function="serine-type peptidase activity"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53219.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059640"
FT                   /db_xref="HOGENOM:HBG397694"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI0000252F75"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755H8"
FT                   /transl_table=1
FT                   /translation="MDWKSMLRTGVHKPGALTAGLSVFLTLVYVLNWVFPINEKILLDP
FT                   GALRKLQLTRLSLYPLAHLSIFHLLLNLMSLFVPLSMFEASHGTVFTGITLNLLAIVTG
FT                   VVYCLVGMLLYPNVYVGGASGWCFTLCGYFAVQEAGFRPHYELASLKMPTLYIPLVFLV
FT                   LVTLLMPGSSFVGHLIGLGLGYLIGFRERWLQMATPPGWLIVKIETWLDRWISMIPSVV
FT                   KYHRESSVDRTAGYTPLYQESELPLHNDNFPGQGRVLGP"
FT   CDS_pept        complement(145415..146389)
FT                   /codon_start=1
FT                   /gene_family="HOG000091197" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082187"
FT                   /gene_name="HUT1"
FT                   /locus_tag="AFL154C"
FT                   /product="UDP-galactose transporter homolog 1 "
FT                   /biological_process="carbohydrate transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53220.2"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG203273"
FT                   /db_xref="HOGENOM:HBG382050"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI0001DB2BBB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755H7"
FT                   /transl_table=1
FT                   /translation="MGSQVRLVIAVCGIYATFLTWSLAQEPLTTSVWPNSAARFSHSSF
FT                   IVLCQALTAAVVGLCYLKAQRSGYGAREFIRKHWADVAGISLTQALSAPAANHSLQYVD
FT                   YVGYMLAKSCKLLPIMLVHVLVYRTPIGRDKALVGVLVSGGVALFTLGGAERKQGEASL
FT                   YGLGMLLVSLFLDGLTNASQDRLLRRPASKKITGAHLMVALNTAIVLWNLAYLVLFDRT
FT                   QWQGSLQQLHADPAILTYLFTYCACGALGQCFVFFTLEHYSSLVLATVTVTRKMVSMLL
FT                   SIVVYGHSVRPVQWLGILVVFGGIIWETVKKGQRGSGQKSKQH"
FT   CDS_pept        146710..148437
FT                   /codon_start=1
FT                   /gene_family="HOG000141896" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625304"
FT                   /locus_tag="AFL153W"
FT                   /orf_name="AGOS_AFL153W"
FT                   /product="AFL153Wp"
FT                   /protein_id="AAS53221.1"
FT                   /db_xref="HOGENOM:HBG059648"
FT                   /db_xref="HOGENOM:HBG203998"
FT                   /db_xref="UniParc:UPI0000252F77"
FT                   /db_xref="UniProtKB/TrEMBL:Q755H6"
FT                   /transl_table=1
FT                   /translation="MVTAVKYSPLRATYGVRSDQYLEDYDDYRHYHGKLNAKLMSLRRR
FT                   LQLTTRDTRRYSAKEKYSKVGAAEYQRNRLHGLAMLLHAERDIAYAETLKLRARERGWL
FT                   KKSERRLLTTRLKKAWRTAGKLLEMTADEGRWVVRAELLVYEKLARVEYLVHGKHSRRK
FT                   DSDRIAQELALSVAALEYLCTEGEVAAETVATINGRFDYMLRQHAQCFSSAELQAFTAK
FT                   VVNTRKDDPLLVLLLAHGYELPVEGAAAADGGLQTEVKWRSYNAQIHEPNVARLLNEIK
FT                   TQDATQVSEHDDPVLKWNAAIDAQRQSMERRQEEGVHYEGEDDQILLTYLQFNYLCATM
FT                   GRDVALLQPLWVEWQEGRRTARFTKYKQLNHVINNIITHAEEAMGLPGVYSDDELTAYL
FT                   KLVKVFYRAQLVGRGLAPLYQEEGKHQEALALYAGSMQNLRTAMSAMPRDTAFDPFNIL
FT                   DNVSELQKALESSCRSVAALAEYTGNSSRPAQQYELSLLEKMNTNTFIDYANIYTGNLF
FT                   PLRPRVMPVSAKPTLFDLAFNYIGCESSAVPPEQTSAAVTPAAETEQPRKRGIFGIFR"
FT   CDS_pept        148658..149935
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761423"
FT                   /locus_tag="AFL152W"
FT                   /orf_name="AGOS_AFL152W"
FT                   /product="AFL152Wp"
FT                   /protein_id="AAS53222.1"
FT                   /db_xref="HOGENOM:HBG059653"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0000252F78"
FT                   /db_xref="UniProtKB/TrEMBL:Q755H5"
FT                   /transl_table=1
FT                   /translation="MNFIYRKKYTCWICLEESDGLFSFAWTRHECGCSLQVHNKCLVRW
FT                   LFATNLRVWNECGTSDFYRIRSLPELKRRLCYVVDGHRNFQSEVNLAETVQGIPAVGQT
FT                   WAAFLCILEMAVRILLRIPPSEPPTDLWRGLPIEAVACPQCKKSITKGRLYWHTSSLGL
FT                   HAYSIYKSASTYVATIALFWFLYSNPWKQWFKIGLYLLRQVFPESILQQILDVSTTRAI
FT                   DVYTDSMNGIECVPARQRFLILGFPLYLAGLLSPTLPLGYMQQIYPWTLVTACRNSKVV
FT                   LKVLSVELFVASLYTKVAAMLGRSLKKKLLSVRPYFNSPKDSTENNTFTEELLRTTWLD
FT                   CITDITLLFRISTFISNNILQPIPIITRLILKLDPTVSPNECICVQNLLAIGAVCCGRE
FT                   LGRFFLAYKRSRELQQLQRIVEDDDI"
FT   CDS_pept        150323..151129
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761424"
FT                   /locus_tag="AGOS_AFL151W"
FT                   /product="AFL151Wp"
FT                   /protein_id="AAS53223.2"
FT                   /db_xref="HOGENOM:HBG059660"
FT                   /db_xref="UniParc:UPI0001DB2BD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q755H4"
FT                   /transl_table=1
FT                   /translation="MDGINRILPRSPYFCTPSTIPFKVMVAPQAKQEEYKDNESTLSDI
FT                   LSDSDASSDEPLTLYSGYRTKVKDYLVPTTDSDPNSVPFRLLRDGAILLRQLLCANATL
FT                   GNNFSRGIVTSDLGQEALFWSGLPLYFSGMILPDAVANMHRLLFVVEVVCRRDLTSFGK
FT                   YGVLLLLALPLISKVIRRLFFAESIKLSTLEAGVAPAADSAMIWPLLGKFLNQYLLMKI
FT                   PYYRWLVEACTGNTDDALWFGNLLGCFLLLVVKDVAWWLNRKLLKG"
FT   CDS_pept        complement(151290..156230)
FT                   /codon_start=1
FT                   /gene_family="HOG000113100" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777857"
FT                   /locus_tag="AGOS_AFL150C"
FT                   /product="AFL150Cp"
FT                   /function="Ras GTPase activator activity"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS53224.2"
FT                   /db_xref="GO:0005099"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG059668"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="UniParc:UPI0001DB2BD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q755H3"
FT                   /transl_table=1
FT                   /translation="MTVQLDSPTKEKSRYVEKYLQSLGSAEKSGTNSRTLLQASPAKIN
FT                   SSPLKDEASAEKKSDKPLSKRTGGFQGGTKVKGGISNNPFLLQDSEVKHDSPNISPARS
FT                   AVAKGSAKKPLQAAAKTRPENGNVSQPNESRREAAQHEVSPKAQKKVDTSGMSRETLRY
FT                   YEFLCRVGEAKRWIEDVIGETIPGELELAAGNSMRDGYFLAKVTQTIKPDLAPTIVPPG
FT                   RLQFKHTQNINAFFSLMDLVGVPDLFRFELTDLYEKKDVPKVFETLHAVANILNSRFPG
FT                   EIPEIHNLSGVLEFSPQELKECKQKLPNVRNFRSFKADGATNASSEKLPRNEGLIKDWN
FT                   PRSRELEPALVLGSKGTAPDEDEKFVVEVTPEPEPEPEPEPEPEPEPEPEPKPESKLNP
FT                   EPAPKPQAQPAPPEVIVVNDVSPKVPDRQMPTLEAQRVPDLLHMDHSGMANGFPRTPER
FT                   QLNGSYLYSQRYISPQYPERSFMGSRTASILLSDPLLRTANTNLTYSPSKNFSYYSPSI
FT                   SRRISYRTDSMKSLDREHLLYNHYLSNYPPYSPARRQRMSEDQFLDIVFRIQAISRGAN
FT                   LRYGIYLKKKTFELFDEEISIFQAWCRAGSLRKQYSLKLRPVLSAESEAQIFSLQSYIS
FT                   GYIYRSHLDILQLRCLKNDMVIRRFQNIVKSVLLRRASREALTKISLCRAPLTKLQSYI
FT                   RGSKLRTDFDYTYSNLRRVHYEVIHFQAHCRGLNVKTRYNYEIQCSSIHRGLLEECQAT
FT                   LRGIAQRRKLYDTLFEIDFYDLALDHFSAVIKGGKVRHQLEAVNQYRDSTDPLTYLQAR
FT                   VRGVLARFAVELINDAVELYSINQFQAMLLGGKLRSELLASRRYYRNNVRVVVQIQSAI
FT                   RAYQMSSAYHELLNSTTPSLWAVKKFVHILNENETDTLYSQLHKKKALVNDCNGEICRL
FT                   QSTIRTLITKKSLLEHRGIQVSRYLSQAGLKSLERFSVERASKDVMQQNSLYERICYLL
FT                   QVDSFYWKLLFKLEPYSCINFLPKLFSPTSGKISHRENLLFIKMIMDLMLDELDETPTD
FT                   FFLSSRNSKSPWRLLLAEYLPRHKNSDTVYLFGTVLESLSEPGTDFESVPANIWKFLHP
FT                   GEPMVASHIAIDDPLTNAKYVENMMNIWNTTESVRNILMVMIDSIPMEIKYLCTKAFRA
FT                   VADRSTDIYDPLRAISMVLIEHFVNGFFMNRASYGYQDDVQDLEDKIQVLCSALSTIFN
FT                   LREFNGYYSSLTPYAEAIKPDVVLLLKSMLISPDFENECDSIVYRDMGSTERPFMVMKQ
FT                   EYLENMIKTFISHQSIFPHDDAIVELLKQMEKIFETSVTKMSGVVEVELDPTVYHVPLE
FT                   DDRSALLYNETKRGISYLIQVEDVETNLNDLLTSSVFPEDDNVFTQLLLKYPAVREDLA
FT                   KKNLDNTGYVTFKKHVMQRVKELKHLGIIDSANNYQSVLNDIANTIRSRSYVGHMNERE
FT                   LIFMNDVYEHLKQKENYMSLLSQALSTAVSKSVKQIQKCGHYQPIRKSGLGNKIKDAYR
FT                   RVQGKHSDTPNGIHYTWSARQLYERGVLRDIKGENLKDIAVTFFGSNAPRFPDISFRIA
FT                   TQNGEIYNVDMFVGRKRNMKYREVIKFKELLDKESEDPESTIVLMRGRSATFKISALID
FT                   LLCEVFFR"
FT   CDS_pept        join(complement(157352..157433),complement(156568..157298))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082188"
FT                   /locus_tag="AFL149C"
FT                   /orf_name="AGOS_AFL149C"
FT                   /product="AFL149Cp"
FT                   /protein_id="AAS53225.1"
FT                   /db_xref="HOGENOM:HBG059674"
FT                   /db_xref="UniParc:UPI0000252F7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q755H2"
FT                   /transl_table=1
FT                   /translation="MEDLFPLRPDGSLDAKATARQFASFEKEIQSSIDDPSKLNAARKR
FT                   LVDVSLQLTNLAACLPRFDRERYGNKLERLLAAIQERELRNAPAGQKRFHFTRKPPKQQ
FT                   KPQASTPLAAPCAAVTPANALASTYQVVRVGPADTHFADMRNCQLLSEATAPVTTSALH
FT                   LQRIVASSVKLRPIPFEHGSLYIEDCEDVTFMLECPPESDIQIRLRCLRNCKLCITRPD
FT                   AVAQKVVLERCTDCIFEKSSQEKVLIQDFGNLGFLDSQPTNYSFASWV"
FT   CDS_pept        complement(157654..159768)
FT                   /codon_start=1
FT                   /gene_family="HOG000031988" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761425"
FT                   /gene_name="HSP82"
FT                   /locus_tag="AFL148C"
FT                   /product="Heat shock protein HSP82 "
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53226.1"
FT                   /db_xref="EMBL:AAN61917.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG244366"
FT                   /db_xref="HOGENOM:HBG631012"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="UniParc:UPI000006C9B0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8J2M3"
FT                   /transl_table=1
FT                   /translation="MSSQETYEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDK
FT                   IRYQSLSDPKVLESDPELFIRLTPKPEEKVLEIRDSGIGMTKAELINNLGTIAKSGTKA
FT                   FMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKHNDDEQYIWESNAGGSFTVTLDE
FT                   VNERIGRGTILRLFLKEDQLEYLEEKRIKEVVKRHSEFVAYPIQLLVTKEVEKEVPVEE
FT                   EEKKEETEDDKKPKLEEVDEEEEDKEKSKTKKVKENVKELEELNKTKPLWTRNPSEVTQ
FT                   EEYNAFYKSISNDWEDPLAVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYV
FT                   RRVFITDEAEELIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIKKNIVKKLIEAF
FT                   NEIAEDSEQFEKFYSAFAKNIKLGIHEDSQNRASLAKLLRYNSTKSVDEQTSLADYVTR
FT                   MPEHQKNVYFITGESIKAVEKSPFLDALKAKNFEVLFLVDPIDEYAFQQLKEFEGKQLV
FT                   DITKDFELEESEEEKKQREEEIKEFEPLTAALKEVLGDQVEKVVVSYKLIDAPAAIRTG
FT                   QFGWSANMERIMKAQALRDSTMSSYMASKKIFEISPKSAIIKELKKRVEDNGAQDRTVK
FT                   DLTSLLYETALLTSGFTLEEPASFATRINRLISLGLNIDEEESTETAAETATEAPVEEV
FT                   APETAMEEVD"
FT   CDS_pept        complement(160054..162870)
FT                   /codon_start=1
FT                   /gene_family="HOG000141917" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761426"
FT                   /locus_tag="AFL147C"
FT                   /orf_name="AGOS_AFL147C"
FT                   /product="AFL147Cp"
FT                   /function="binding"
FT                   /protein_id="AAS53227.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG190822"
FT                   /db_xref="HOGENOM:HBG203475"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019414"
FT                   /db_xref="UniParc:UPI0000252F7C"
FT                   /db_xref="UniProtKB/TrEMBL:Q755H0"
FT                   /transl_table=1
FT                   /translation="MSNASGEQRKLEDVLQRRPDFVKDTPLDSFFENLQREFLSPLRTS
FT                   DGLNIYERIGCQDNGEFVTRCVERLTCLHGLAVEREQGEGAEHKLLPISLHDMKFFDEL
FT                   INLLIVHGVYANLPQGFGVPLQQRQLSQFKDIAERFQVPGKHVRSATTLEVASRGLYII
FT                   LSQDRAVDTVRDILLKGAGYIDALMGFIALRHDRPQRQEEYDNVLEKLESIQDTYRLLS
FT                   IYSLLVQSTCAREYLEWPLQQLSTLTVRRDDGVASLVDFVVGLRDEEQVSIEKFDRVKQ
FT                   ILLAKPKSLSNVEYFHRLFKQIYTCLADVNRPVLISCLNSVLVGFYYKNKRIVYDFLFQ
FT                   RVARILFNVGSEAFSEKQLNDCFNVLISLSKSSSTELIGALVQYKGAQSFYFHLWVYGL
FT                   FLRKNQTIQPVESEAKYYMVVFSLLNTFVKLTGDFEALERLVPHLVNFDHETWRYAINL
FT                   ETHLPYVLPKSGDENAAADLNLHDAPETGLSKIQQLFSSMDFAVEAFIELLNLLGEEEV
FT                   RKNIFLQVLRRWVEATSKSESVQQTAIGGDSVSHNLLALVDLKLLEKMHAQFKDDIISR
FT                   PHDILRLVADLLVYSHSQEDEHSAKDSDDEDSEDEEAAAEPAQGRPFSILLDLLSATLL
FT                   SAPPADLVSEQPTLQLLAERLQAYPADASCRALQLRIRDVLARRAPAPGADAVGAADNA
FT                   AFSRALANVNDALPSLRAHGLYELRRLIERGSPSVGLTRVLDLHFLLLRDPEPFVYLNA
FT                   IKGLSTLCLSATATALPALLARYHDPQGRMPLDHALRLAEALAAFIPAQNELLQGPHAA
FT                   ALVETCLSKVRARTADARLRMSALSLLGLCVRTNPLGVAAVLPDILDCALGVLQLEPVV
FT                   ASDDRTPLVRRAAAHLIHDLLSASGLDLLPPSDLRRLADVVRNTATNEKDYLTAEPLAD
FT                   ALQLLEGR"
FT   CDS_pept        163008..163604
FT                   /codon_start=1
FT                   /gene_family="HOG000111159" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930848"
FT                   /locus_tag="AFL146W"
FT                   /orf_name="AGOS_AFL146W"
FT                   /product="AFL146Wp"
FT                   /protein_id="AAS53228.1"
FT                   /db_xref="HOGENOM:HBG037955"
FT                   /db_xref="HOGENOM:HBG397791"
FT                   /db_xref="HSSP:1A5E"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0000252F7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q755G9"
FT                   /transl_table=1
FT                   /translation="MPLHQGPLDIEDQLAIIADARIGDLDSLKQIFSELIDPKLLPSCS
FT                   DPDTLCTPLHMAAANGHADVARYLLSLLEPAAARDWAAAQNATGNSALHWAALNGHLEV
FT                   VKLLCDDYAADPFVRNSFGHDAIYEAESCSRDDVEAYFLQKYDIAPTQDDSAGDAAEGP
FT                   ADLNVAVTAGTEIEQVTRDAAEALRAQAERLDLAN"
FT   CDS_pept        163861..164709
FT                   /codon_start=1
FT                   /gene_family="HOG000107197" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930849"
FT                   /locus_tag="AGOS_AFL145W"
FT                   /product="AFL145Wp"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="AAS53229.2"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG374400"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniParc:UPI0001DB2BD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q755G8"
FT                   /transl_table=1
FT                   /translation="MSDLANELGFDPSLKKKKKVKKVAPEEAIGAAEASVEGDDLFAGL
FT                   KKKKKKAKEGSKEEEGTGDALDELTEALGELKLKKKKKKKEAAALDVFDKELEKAGVSV
FT                   EEGSAEPGVSAGAASEVQEDVGLPYSDLLSRFFKILRTNNPELAGDRSGPKFRIPPPVC
FT                   QRDGKKTIFANIQEISEKLQRSPEHLIQYLFAELGTSGSIDGQKRLVIKGKFLSKQMEN
FT                   VLRRYIMEYVTCKTCKSINTELKKEQSNRLFFLVCKSCGSTRSVSSIKTGFQATVKRRR
FT                   F"
FT   CDS_pept        complement(164940..165416)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761427"
FT                   /locus_tag="AFL144C"
FT                   /orf_name="AGOS_AFL144C"
FT                   /product="AFL144Cp"
FT                   /protein_id="AAS53230.1"
FT                   /db_xref="HOGENOM:HBG059697"
FT                   /db_xref="UniParc:UPI0000252F7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q755G7"
FT                   /transl_table=1
FT                   /translation="MKSFQNCTESEVSGYNDCPNFLFAAREHTAGSSHRRGLKARARGR
FT                   ARRPDMPSDALQQMEPGELEEIRAEAMRKIEWLFETESRLAEVEFNFYRNKVRQNLGRA
FT                   LADERTLLMMAAVLRQLPADLETAKDVLTTWLVSDVSVAAWCTALRKILENAVL"
FT   CDS_pept        complement(165676..166761)
FT                   /codon_start=1
FT                   /gene_family="HOG000157694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625305"
FT                   /locus_tag="AFL143C"
FT                   /orf_name="AGOS_AFL143C"
FT                   /product="AFL143Cp"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53231.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252F80"
FT                   /db_xref="UniProtKB/TrEMBL:Q755G6"
FT                   /transl_table=1
FT                   /translation="MLRMGEYICGCKPLWNLWANDVRITVNGKRYLVTGLLSDKGLTMI
FT                   YKVRSLQREQRGNFCIKAVHCPFGRAEHVAEAMREIDNYQAFHSPYITSLLDSQIVPLE
FT                   QGSKLVYMVLQYFPTGSLQQLIDTTLVEGVPLPEPRVLALMVEVCRAVRAVHQPGDEGV
FT                   ESGSATQSEDTHLLADALEMDVLEASTSSPRRSFVLCDLRPSAVMLTPQGMPIISDLSA
FT                   CVRSGYALANATRLARMRAVLDTHGSPMYLAPELCALEPNACILPPADIWSLGCICYAL
FT                   MYGISPFEREEQLHGTPLRQARASGLFSFPDNPVYSLQLLDIVRQCLAVKPDARPTIDS
FT                   LMSLFHDLLDDSAIGSLVLGE"
FT   CDS_pept        166967..168376
FT                   /codon_start=1
FT                   /gene_family="HOG000190885" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930850"
FT                   /gene_name="RVB2"
FT                   /locus_tag="AFL142W"
FT                   /product="RuvB-like helicase 2 "
FT                   /EC_number="3.6.4.12"
FT                   /function="ATP binding"
FT                   /function="DNA helicase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53232.2"
FT                   /db_xref="GO:0003678"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG015017"
FT                   /db_xref="HOGENOM:HBG749829"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0001DB2BD6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755G5"
FT                   /transl_table=1
FT                   /translation="MSIQTQEAHDMSLKSLSLIATHSHIVGLGLDENLQPKPSSQGMVG
FT                   QLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGLSQSLGADVPFTAMAGSE
FT                   IFSLELSKTEALTQAFRKSIGVKIKEDTELIEGEVVEIQIDRSITGGHKQGKLTIKTTD
FT                   METIYELGNKMIDGLTKEKVLAGDVISIDKACGKITKLGRSFARSRDYDAMGPDTKFVQ
FT                   CPEGELQKRKSVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVAEWKE
FT                   EGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVIMATNRGISKTRGTNYKSPH
FT                   GLPLDLLDRSIIITTQNYSEQEIKTILSIRSQEEEVELTEDALDLLTKIGGETSLRYSS
FT                   NLIAVSQQIAQKRKSSSVDVQDVKRAYLLFLDSTRSAKYLQEYESRYIDDHGRVDISTT
FT                   GRNADAMDTNE"
FT   CDS_pept        complement(168568..169062)
FT                   /codon_start=1
FT                   /gene_family="HOG000056520" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777858"
FT                   /gene_name="VMA11"
FT                   /locus_tag="AFL141C"
FT                   /product="V-type proton ATPase 16 kDa proteolipid subunit 2"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS53233.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="HOGENOM:HBG211385"
FT                   /db_xref="HOGENOM:HBG325773"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="UniParc:UPI0000252F82"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755G4"
FT                   /transl_table=1
FT                   /translation="MTDDLVNEYAPAFAPFFGFAGCAAAMILSSLGAAIGTAKSGIGIS
FT                   GIGTFRPELIMKSLIPVVMSGILAVYGLVVAVLVAGGLSPTEEYTLFNGFMHLAAGLCV
FT                   GFACLSSGYAIGIVGDVGVRKFMHQPRLFVGIVLILIFAEVLGLYGMIIALILNTRGSG
FT                   N"
FT   CDS_pept        169942..170595
FT                   /codon_start=1
FT                   /gene_family="HOG000000975" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777859"
FT                   /locus_tag="AFL140W"
FT                   /orf_name="AGOS_AFL140W"
FT                   /product="AFL140Wp"
FT                   /protein_id="AAS53234.1"
FT                   /db_xref="HOGENOM:HBG059719"
FT                   /db_xref="HOGENOM:HBG204023"
FT                   /db_xref="InterPro:IPR013950"
FT                   /db_xref="UniParc:UPI0000252F83"
FT                   /db_xref="UniProtKB/TrEMBL:Q755G3"
FT                   /transl_table=1
FT                   /translation="MPAEKLELTSEEIKHIHLQLKGILDEKIRLHLPQRHSVSESQDTD
FT                   DGSDSMARQVMVEVEKFLSSVMEMASDSVHVSDARSSVTVLDVVNDVQREYVEPFDLEL
FT                   NERVRQLYQEWEAETLRVAQLRQTGPRAITDAYLKEEGAAIAALDERIRKLEGLAEADQ
FT                   ETQLPAADADFWSEVGDQYGRSLGLLKQAQSLLPRDRMQLEKLKKLVQYLENEV"
FT   CDS_pept        170943..171836
FT                   /codon_start=1
FT                   /gene_family="HOG000246774" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930851"
FT                   /locus_tag="AFL139W"
FT                   /orf_name="AGOS_AFL139W"
FT                   /product="AFL139Wp"
FT                   /function="SNAP receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS53235.1"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG344349"
FT                   /db_xref="HOGENOM:HBG735129"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI0000252F84"
FT                   /db_xref="UniProtKB/TrEMBL:Q755G2"
FT                   /transl_table=1
FT                   /translation="MNQQNPYDSGNPYADAYEMQGYRNSGNGAGPAQSGAGGDDFVVFM
FT                   NGIGQINNELDRYSQLIGQIDVYQKRLLTEVNEEQEIMLRKQLDVFASQASDLQYQLKD
FT                   DIKRAQQQAAGDMSKEAQAENSRQRFLKLIQDYRITEANYRENNKEQAKRQYRIIQPEA
FT                   TDDEVEAAISDVGGQQIFSQALLSANRRGEAKTALAEVQARHQELLKLEKTMAELTQLF
FT                   NDMEHLVIEQQEQVEFIDKQVEEAQQDVEQGVGHTNKAVKSARRARKNKIRCIIILIIV
FT                   LIIVAIAVAVPLATRK"
FT   CDS_pept        172713..178388
FT                   /codon_start=1
FT                   /gene_family="HOG000177974" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777860"
FT                   /locus_tag="AGOS_AFL138W"
FT                   /product="AFL138Wp"
FT                   /function="fatty-acyl-CoA synthase activity"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /protein_id="AAS53236.2"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004321"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="HOGENOM:HBG053544"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR021186"
FT                   /db_xref="UniParc:UPI0001DB2BD7"
FT                   /db_xref="UniProtKB/TrEMBL:Q755G1"
FT                   /transl_table=1
FT                   /translation="MVMKPEVEQELAHVLLTELLAYQFASPVRWIETQDVFLKEYNTER
FT                   VVEIGPSPTLAGMAQRTIKSKYESYDAALSLRRQVLCYAKDAREIYYTKDPAEVAAPAA
FT                   AAAAAAPATPAAAAPAAAAASAAAPAAAAPAAAPAAPAAALQDQPVEAKLVLHTLVAQK
FT                   LKKTYDAVPMAKSIKDLVGGKSTVQNEILGDLGKEFGTTPEKPEESALEELAEVMQESF
FT                   EGSLGKQSTSLISRLISSKMPGGYTITVARKYLQNKWGLGSGRQDSVFLVSLVHEPASR
FT                   LGSESDANAFFDSMAQKYASMAGIDLSAAQAGASSGGSAGSGDAVIDAAAFEELTKDQR
FT                   IMARQQLEVLARYLKVDLNKGERKYLKSQDSFAALQAQLDYLTEELGSFFVQGVATSFS
FT                   KKKARVFDSSWNWAKQSLLTLYFEIIHGVLKNVDREVVTAAINIMNRSNDALIKFMEYH
FT                   VSHTDEEKGENYQLLKALGEQLIENCKQVIHLDPVYKDISKPTGPKTIVDEKGNITYRE
FT                   EPREGVRKLSQYVQEMALGSHVTKQSQPTIQEDLTRVYKSISAQANEANISEGTKLQFE
FT                   KLYGELLQFLEASNEIDASATTTLAGVDDDSLDRDSTKEVASLPTKTAIEKTVSSTIPR
FT                   ATVPFLHLKKQLASGQWVYDRQLSSMFLDGLEKAAINGVTFKDKYVLITGAGQGSIGAE
FT                   LLEGLLQGGAKVIVTTSRFSKKVTEYYQSVYTRFGAKGSTLVVVPFNQGSKHDVESLID
FT                   YIYDDPKSGGLGWDLDVVIPFAAIPENGIELENIDSKSEFAHRIMLTNILRMLGCIKKQ
FT                   KSARGIETKPAQVILPLSPNHGTFGADGLYSESKLALETLLNRWHSESWSNQLTICGAI
FT                   IGWTRGTGLMTANNIIAEGIEKLGVRTFSQKEMAFNLLGLLIPELVQLCQKSPVMADLN
FT                   GGLQFIEDLKKFTVKLRADLMETSEIRRAVSLETSLEHKAVYGPQADTGRDDVYVQPRA
FT                   NIQLNFPTLKPYSEIKKIAPGELEGLLDLEKVIVVTGFSEVGPWGSSRTRWEMEAHGEF
FT                   SLEGCVEMAWMMGLIRYHNGNLKGRPYTGWVNTKTNEPLDDIDVKAKFEPYILEHSGIR
FT                   LIDPQSFDGYDPQRKQLLQEVVVEEDLAPFEASKETAEQFKLEHGDRVDIFEIPETGEY
FT                   SVKLLKGATLLIPKALRFDRLVAGQIPTGWNAKTYGISEDTISQVDPITLFVLVSVVEA
FT                   FIASGISDPYEMYKYVHVSEVGNCSGSGMGGVSALRGMFKDRYKDKPVQNDILQESFIN
FT                   TMSAWVNMLLISSTGPIKTPVGACATAVESMDIGVETILSGKAKICIVGGYDDFQEEGS
FT                   FEFGSMNATSNSLEEFEHGRTPAEMSRPTTTTRSGFMEAQGAGIQIIMNADLALKMGVP
FT                   IYGIVALTATATDKIGRSVPAPGQGILTTAREHHGSMKYPSPLLDIKYRKRHLTAREKQ
FT                   IKDSVESELSLLQYELDGIPEEEQSTFLAERTEAIKRDAAKQLKAAQAQWGNEFYKNEP
FT                   RIAPLRGALATYGLTIDDLGVASFHGTSTKANDKNESATINQMLKHLGRSEGNPIIGVF
FT                   QKYLTGHPKGAAGAWMMNGAIQILNSGIVPGNRNADNIDEVMEQFEYILYPSHSIKTDG
FT                   IKAVSVTSFGFGQKGAQAVVVHPDYLYASLSEKVYGTYMEKVAVRERCAYKYFHNGMIN
FT                   NSLFVSKDKAPYTDDLEQPVYLDPLARVSNDKAGTLTFSAKNIQANQEGSFASKDTAEV
FT                   VKQMTTHLASQGKTGGVGVDVELIRSINISNETFILRNFTREEAEYCRNQPCAQSSFAG
FT                   LWSAKEAVFKSLGVRSQGAGAPLREIEIQRDTATGAPIVHLHGEAKKAATAAGVHSVRI
FT                   SISHDDFQAVAVAIAEK"
FT   ncRNA           complement(178466..178889)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR83"
FT                   /product="AgSNR83"
FT   CDS_pept        179512..180045
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777861"
FT                   /locus_tag="AFL137W"
FT                   /orf_name="AGOS_AFL137W"
FT                   /product="AFL137Wp"
FT                   /protein_id="AAS53237.1"
FT                   /db_xref="HOGENOM:HBG059735"
FT                   /db_xref="UniParc:UPI0000252F86"
FT                   /db_xref="UniProtKB/TrEMBL:Q755G0"
FT                   /transl_table=1
FT                   /translation="MFIYHRPMSCSQRVIIHIKLSPPLHICPASPPFAEGKRSTETQFT
FT                   TTTYIYDLLFRACVRLPPSVPTSASCHLTPSRHSSFVYRTHRRHRARTLPFRISEKNAG
FT                   RHYHIPVTANLPLHFHSIVAATFPKLQEHHLTSSGQEFQLQLIFWDLPPLESCYTFKKF
FT                   FDAYAGLLAVLPPI"
FT   CDS_pept        180213..181388
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761428"
FT                   /locus_tag="AGOS_AFL136W"
FT                   /product="AFL136Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS53238.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059272"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001DB2BD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q755F9"
FT                   /transl_table=1
FT                   /translation="MGVQKRTTPGGGSKNQPRSFKCTGYGNCDMSFTRAEHLARHIRKH
FT                   TGEKPFQCEVCNRFFSRIDNLKQHRESVHSIPTISTTRSKRQSRSKSLQEGAGAVETSF
FT                   GGVLNTATAVRSASLPTFETQGSASPASPRQAPYIYGAGQPAQATAEPTGPGGHTPRMI
FT                   LPPIFMTTPRAGAAGQPALLRQPLAGTSQQAEMHVARGQQRSYPGYYAGQQPLTPNGSN
FT                   GSCDRPFNVAWESRIYVAAPLGSATPPALPPPTLHQALSQNPPPYPKVPYGAEYVVDSP
FT                   PLENTALHSHVIPRNSFMHNPSKIERIAATSPAAADAPGTVPVTVISSKKLAPVLARAQ
FT                   SPPPAGAQRLSTASRDAAPSAAMPAAPAPPAVRAAQDGARVGRISVSSMLS"
FT   CDS_pept        181674..182285
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761429"
FT                   /locus_tag="AFL135W"
FT                   /orf_name="AGOS_AFL135W"
FT                   /product="AFL135Wp"
FT                   /protein_id="AAS53239.1"
FT                   /db_xref="HOGENOM:HBG059273"
FT                   /db_xref="UniParc:UPI0000252F88"
FT                   /db_xref="UniProtKB/TrEMBL:Q755F8"
FT                   /transl_table=1
FT                   /translation="MASTASPPARRGACCDVVQLSRDPEGLGARGDSCTKFGPSQFGLS
FT                   ITQNRPYRTTEIVAKKLLRCLHVREQRPMPYPTPPLSNASLGTSADGGSAAGLAQQAPA
FT                   KSYYPLVPDGAQLTPPLLPVSTAGDDAGLYRYHKQISKSFQDDLIYCPRALLSKVELTQ
FT                   CYQLDMLLLMEQQQQAQPSVKFNPYTSQSFNPAGPASPGS"
FT   CDS_pept        182634..184070
FT                   /codon_start=1
FT                   /gene_family="HOG000111552" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082189"
FT                   /gene_name="CET1"
FT                   /locus_tag="AFL134W"
FT                   /product="mRNA-capping enzyme subunit beta "
FT                   /EC_number="3.1.3.33"
FT                   /function="polynucleotide 5'-phosphatase activity "
FT                   /biological_process="mRNA capping"
FT                   /cellular_component="mRNA cap methyltransferase complex "
FT                   /protein_id="AAS53240.2"
FT                   /db_xref="GO:0004651"
FT                   /db_xref="GO:0006370"
FT                   /db_xref="GO:0031533"
FT                   /db_xref="HOGENOM:HBG059274"
FT                   /db_xref="InterPro:IPR004206"
FT                   /db_xref="UniParc:UPI0001DB2BD9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755F7"
FT                   /transl_table=1
FT                   /translation="MSSEKQEGSPRRVLSLSDLVNREDSKDASGNTAGAALKPLSNDEV
FT                   RRRLAHEDYSSNTASQVDDETDTDDGLGEVAFDRADFRFDFEGQERSGGRASGEAEAES
FT                   GGPGHEKATQQPSDAIATSPDRESTEPRAMDIFEERASLESKKNNLRKDLRVLNEIAST
FT                   ARPGRYKVAPIWAQKWKPTVRALQNVNSKDLMKIDVSFTQVIPDDDLTKSVQDWVYATL
FT                   LSIPPEQRQYVEVEMKFGILMDRSSDSQRVTPPVSSQTVYMEADARMKPDVDERVFVEL
FT                   NRYVKGISELTENTGKFNIIESHNKDEMYRAGINTQRPRFLRMSKDVKTGRVGEFIEKR
FT                   RISQLLLFSPKDSYDVKISINVELPVPENDPPEKYMGQAPLNSRTKERISYIHNDSCTR
FT                   IDITKVTNHNKGKRDDAEVTHEIELELNSQALLAAFDKIAQDSKDYATIVRTFLNNGTI
FT                   IRRKLTSLSYEIFEGGKKVV"
FT   CDS_pept        complement(184172..185128)
FT                   /codon_start=1
FT                   /gene_family="HOG000283250" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761430"
FT                   /locus_tag="AGOS_AFL133C"
FT                   /product="AFL133Cp"
FT                   /protein_id="AAS53241.2"
FT                   /db_xref="HOGENOM:HBG534149"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI0001DB2BDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q755F6"
FT                   /transl_table=1
FT                   /translation="MYSLIGSLLLGGLLAAYTIVYLLSHSPRQAYPEELTYRTVGKDGV
FT                   VAQHALESVLDEKAGTAGIELSVVVPSYNETGRIESMLQEAVDHLRKVHAGKWEILIVD
FT                   DGSRDGTSEFCLELAQKLQLEREQMRVVKFTKNRGKGGAVRHGMLHIRGKYGLFADADG
FT                   ASRFSDVEKLLRAIKEGERIQPGNVSIGSRSHMVKTDAVVKRSFIRNFMMYGLHTLVYI
FT                   FGIRTIGDTQCGFKLFDRKAVQAIFPHLHTEGWIFDVEILILAARKGMKISEIPISWHE
FT                   VGGSKMVLVKDSINMAIDLVVIRLAYIFGIYGDKATH"
FT   CDS_pept        complement(185438..187414)
FT                   /codon_start=1
FT                   /gene_family="HOG000141958" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625306"
FT                   /locus_tag="AGOS_AFL132C"
FT                   /product="AFL132Cp"
FT                   /protein_id="AAS53242.2"
FT                   /db_xref="HOGENOM:HBG124411"
FT                   /db_xref="UniParc:UPI0001DB2BDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q755F5"
FT                   /transl_table=1
FT                   /translation="MSGGQDALSQMLLKILYTVDNEATSFLTRSREPAPVRVEMVPMSS
FT                   PPAKVGVRIGIVEVAHVLGEVCKSSPELFQPAAGPAESDYNVYFKDVVEADEPFVSLGL
FT                   LSKLRGGDADETLVIGRICTNFTSLLPGGGRGCETLEVKMRFSKVLTRSNSHRGSLVKA
FT                   VPARRMNSAAAARRLPAPVGGPAKRRRDANPLPATKAFRTQSLPIWDNPKNSGIRGGTI
FT                   AHKIYMADRNKEQQSIQLSQQQQGTLQDRKPTYQVMSLQSDTTVTKFKVDDSISKRFEF
FT                   MNKPKAKRATAPRQAATSSPAMASGAGKRVHKPKVQQGRGGAAQADSAKQSNTPRDFGA
FT                   LGEDQSLQEFLSQSEIKSDLFELEEQNDESASSNKENVPPSSSSVFQQQLLPTDMDDFF
FT                   NLDLDHMKNTDDEWFQGLFGTPRDATTCNTMPIEDDNDISQADTASTMVHEAQHSTTVL
FT                   HNDHLSDLDRTSPIDTLSMPLLDLEPRSNQPAKFVSCADQLKRLPLLIKGKEGATTNTP
FT                   EDEHLEDDVTSLVIQMSTSPSPEDGDQDALPPKQPQEKHLLCDELPSDCDDDDDDDDER
FT                   LECMKKRKTMPSSPTSMFQPYRDLDGLGAENRADDTSFIATDDFAMAKLPPHADSTPAT
FT                   HISSADDLKKKKDLTNSDNHYWS"
FT   CDS_pept        188088..191660
FT                   /codon_start=1
FT                   /gene_family="HOG000180957" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761431"
FT                   /locus_tag="AGOS_AFL131W"
FT                   /product="AFL131Wp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="chromatin binding"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53243.2"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG056255"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015688"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001DB2BDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q755F4"
FT                   /transl_table=1
FT                   /translation="MAPKKFKTLDSFMEEQGPDPSLTPSPFGGYFSKADAGQGGRRDWN
FT                   KGAARPGGQGGYQAGYAGYGYGGYGGYQAGYQAGYGGQGYQAQGYQAQGYGYQAPQGGR
FT                   APQGAGVASPPAGITPSGSAVSLTSLTNSLSGMELTPLSKHVEALAGAGSIAEVRRYVA
FT                   DATAEFDGEGAGARDIVGWDVAGVISKLLRPKNPALLREGAMLLISAIAARFSGHGVDE
FT                   CHLLQLLPLALDGLAEKDATVKREAQHAVNAIYGAFPTEALAPAVLPALLSYLVSGAKW
FT                   QSKLGALKLVDNVREDSPSDMLEMKFKESVPVLTDLATDFKPELAKQGYATLLAFVSIL
FT                   DNLDLQPRFKLIVDTLQNPKLVPDSVKSLSSVTFVAEVTEPALALLCPILNRSLNLSSS
FT                   SQEQLRQTVIVIENLTRLVNNRIEIESFIPQLLPGVKKVYQTATMPEVRELAEKALQVL
FT                   EEDESKDSKSFPGKITDEEGLEFLEGALKKLGQSPLEDAEANKESIEYLGKVLTALANA
FT                   NDWKTLEKLLLKVLGDEHAEAIEQHFIRDLRLIFHQERAASGDDEGVEIVNTDFSLAYG
FT                   SRMLLNKTTLRLLKGHRYGLCGRNGAGKSTLMRSISNGQLEGFPSQDELKTCFVERALE
FT                   GEDGSVDIVSFLASAPSLENTPRKEIVAALESVGFDADRRAQTVGSLSGGWKMKLELTR
FT                   AILQKADILLLDEPTNHLDVANVRWLEEYLLNNTEITSLIVSHDTGFLDKVCTDIIHYE
FT                   NKKLAYYKGNLHDFVEQKPEAKSYYTLTDSNAQMHFPAPGILSGVKSNTRAVAKMTDVT
FT                   FTYPGAPKPSMADVSCSLSLSSRVAIIGPNGAGKSTLIKLLTGELVPTSGKVEKHPNLR
FT                   IGYIAQHALQHVNEHKEKTANQYLQWRYRFGDDREVLLKESRKISSEEEMKMMETEIDI
FT                   GDGRGKRAVEAIVGRQKLKKSFQYEIKWKWWKPKYNSWVPKEVLVEHGFEKLVQKFDDH
FT                   EASREGLGYRELVPSVITKHFEDIGLDAEIANHTPLGSLSGGQLVKVVIAGAMWNNPHL
FT                   LVLDEPTNYLDRDSLGALAMAIREWTGGVVMISHSTEFVGALCPEQWIVENGTMVQKGV
FT                   VTVDQSRFADGGNAEAVGLNITKTVVDDDSPANIKVRQRKKRMTRNEKKAQAERRRLRY
FT                   LEWLSSPKGTPKPVDTDDEASDSE"
FT   CDS_pept        complement(191721..192611)
FT                   /codon_start=1
FT                   /gene_family="HOG000262181" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761432"
FT                   /locus_tag="AFL130C"
FT                   /orf_name="AGOS_AFL130C"
FT                   /product="AFL130Cp"
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /protein_id="AAS53244.1"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="HOGENOM:HBG049605"
FT                   /db_xref="HOGENOM:HBG460925"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="UniParc:UPI0000252F8D"
FT                   /db_xref="UniProtKB/TrEMBL:Q755F3"
FT                   /transl_table=1
FT                   /translation="MLVFRAKHIARWKTVQAGLQFRNNMSSACIVVIADEVLNGKIVDT
FT                   NSTFFARYCYGLGIPLKEIVTVGDDEAQIVGTLQRVRKQYDFIVTSGGIGPTHDDITYE
FT                   AVAKSCGLPVELNAECQERMRRLSNPEARHSAAALRDHYRMATLPVGENVRNYYVADDL
FT                   WVPVCSIDRQVFVLPGIPQLFERMLRELEPVVRATFWPGAGARAPFRRFFVTTPRMETE
FT                   ASSFLRGLQEEAVRLRKDVKIGSYPHFGMGFNTVSISGSEADEAYLRELVERTISELDG
FT                   KEVSEEDERKFSDAR"
FT   CDS_pept        192828..193265
FT                   /codon_start=1
FT                   /gene_family="HOG000189636" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625307"
FT                   /locus_tag="AFL129W"
FT                   /orf_name="AGOS_AFL129W"
FT                   /product="AFL129Wp"
FT                   /protein_id="AAS53245.1"
FT                   /db_xref="HOGENOM:HBG022846"
FT                   /db_xref="HOGENOM:HBG314532"
FT                   /db_xref="InterPro:IPR008476"
FT                   /db_xref="InterPro:IPR021148"
FT                   /db_xref="InterPro:IPR023139"
FT                   /db_xref="UniParc:UPI0000252F8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q755F2"
FT                   /transl_table=1
FT                   /translation="MSTFNAETADNLEDIEKQFAVVAVEQAETYWGLISKVPGSKLRLT
FT                   KYDDEIYETFMEHFPEYRDIERVARFQEEELKTKEAKERWRKFIGLFEKKIDDFNFGTL
FT                   LRTDARQEYGQFTTCFVVRLQFYAFEIARNKHGLNDWAVGH"
FT   CDS_pept        complement(193301..194668)
FT                   /codon_start=1
FT                   /gene_family="HOG000174851" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761433"
FT                   /locus_tag="AGOS_AFL128C"
FT                   /product="AFL128Cp"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS53246.2"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG410552"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI0001DB2BF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q755F1"
FT                   /transl_table=1
FT                   /translation="MIKLKIPGLFRFEVGPVVPWGRVRALHLYAARLQVRKAGSGDRRG
FT                   EAEKALDKLEEFQAAKEGCAGHSHVHADGGHTHGHGGVSAARLAGLGGHTHTHGGNPLL
FT                   LLDREAIRRNAGVKITWIGLLMNVGLATGKFVGGVVFHSQALIADAVHALSDLVSDFLT
FT                   LFSVSLASRQPTQEFPYGYGKVETVGSLAVSSILAMAGLSIGWGSLCSILGPLVPHALL
FT                   ELAATHAHVHAHAHDLTNINAAWIAGGSIVLKEWIFRATRKVAQETQSNVLMANAWHHR
FT                   IDSLTSLVALVTISSGYLLSIQSLDAFGGLLVSGLVVKTGYAGMKQAASELVDRCLPPT
FT                   DTRYVDIHALTTRTLEQMISNNNAKRKYALHDLTVLASGPNTHAHLVLEVPRQRWDNVL
FT                   SIEEFELVTEHLRSVLSQQVPHLRKVHIEFFGERPTQPAPEAHSHADSPHNHTHEH"
FT   CDS_pept        complement(194909..199474)
FT                   /codon_start=1
FT                   /gene_family="HOG000144390" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625308"
FT                   /locus_tag="AFL127C"
FT                   /orf_name="AGOS_AFL127C"
FT                   /product="AFL127Cp"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53247.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059275"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR013637"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="UniParc:UPI0000252F90"
FT                   /db_xref="UniProtKB/TrEMBL:Q755F0"
FT                   /transl_table=1
FT                   /translation="MKMKHQVTADEIACHSEMISSSPLGCSTLDSSRTLQGEISDVESA
FT                   KIKSCGANGTVEPIKEGGVGYVHGGAPRTSRFMKSLDSSGPAVNAHHCNPYLYTQHKTR
FT                   PNAPFDMLHVRTKNLVRSCREVEKGSVSGFEYSVQDGSIPVFRVAKQQLPDPHVFYEAV
FT                   RSIGEKYGAVKLHIHEEHDDAMRLGSHVLSQSSVLNDFTLNTEYFWFKARRQYMNSPSN
FT                   ENSKRLEFHRRLYRFYREGAKAAEGSTKGKRLIGKIPSIDKRTLDLYRLWNCVQLRGGF
FT                   KTVCQKKLWAQLGRELGYSGRIMSSLSTSLRSAYSKVFSDFDAWELEQRKNTDESSSQP
FT                   SDFSHIKQETRVDSDIGGKRPLDREGHTEDSQKRKKQHTVFQKVFELGGSSAEFTRVRD
FT                   VKRCKGLNTNFENVTEAIPGLTEPDQSTLPGYNFSFWQSGMEIYDKSCYETKNSPIYNL
FT                   RQYYEKSCRHFDLIQTQYSDIIPQVTSWTDKIELQQFEDLYFSILADPTNSLDIDSGID
FT                   LPGIIHGSGFRTISRNSDNTAELLDPWNINNVPLAANSLLSYLDIDYGCLTRPKMHVGM
FT                   TFSTRGWSLGDQYLPTIEYNHLGCSLLWYFIAPESQEAFEKLVEEINLGKRDHPTDELD
FT                   VDPEFKKSEFYNSYLETNMRNRLNDTHKLRSKNGSHMFGQAARGPKSYLLPNDIQIHPE
FT                   ELQKRGIKFYNAIQEAKTFIIKYPRAYNTSIAAGFHVSESCYLAPESWLSHLVPSDKWF
FT                   SDRAMLQSINVFQFLHNIMTRCKSPDVVLYAKRLLAEYSIEELENRKKLVKHFPDMKIV
FT                   ANTFDFISDEDLGFTGASKVLLTTSSDCITLSIKSFLTQLHDETASLRDVIRGISKDEV
FT                   HLSMHTFFSDKLLECLINDVDDPASPIEKLADVEAELTALITRYPGRVPLSKLLPFIHV
FT                   HHASNNPRISEVRQYLRELEPIITDCRLFLDTLHPASEKIVYGSGFNIRELPTLNFQNS
FT                   AKDLQRLCAQLRPLSVEFEEMTHVFALMHQFQCFHRQASVALHADDLEAMKSAYEFGIS
FT                   IGISTPLIPSLAAQILRTHWLHVFDLAIVRRSPSCYQDYQNYNLSDMYRFLRLGIRYLN
FT                   ANLHKDKLQKISSLLKSSQALIQRANAFFKKKNYRVSLNDVELIMEKLSCDFIPLNPTF
FT                   VDGLTKLMAAVKSTKQSIAPSWSRLAVRGDHVTQFVRHFRDGDDAALSQICQFDGSEED
FT                   KRISMEEIAQEKEPQLFGRYVKECRAWLQDLNKLVPNARATLEGLLEQDLRCFELAKDE
FT                   YLPLEHSQRQSVYCFCRQGDVGSTMVECEICREWYHVACINRGRWALPEDDRCVFLCMI
FT                   CHPEPAERPRKVPLQDLLELLCRSASLHVIPDRVLLQRLFELAGCALSFRRHLRRELFD
FT                   NSNVRWGVSVHKLKFYLRKLEGARCELTSELATLRDVVKEHDLQKLHKLRNANCVPVTG
FT                   YEKLTARKQRTPLPQLPAEPAAPSVDIKPDPDTAAKCAVSSAPRRIGIADLLSPLPEDT
FT                   C"
FT   CDS_pept        200198..200527
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930852"
FT                   /locus_tag="AGOS_AFL126W"
FT                   /product="AFL126Wp"
FT                   /protein_id="AAS53248.2"
FT                   /db_xref="HOGENOM:HBG059276"
FT                   /db_xref="UniParc:UPI0001DB2BF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q755E9"
FT                   /transl_table=1
FT                   /translation="MLVIGSWPIAPNSRCCAPICCAPICCAPKCCDAPSWSSNCCERGA
FT                   CWYWAPKSACCWRPKPCSSPTLYWRSSLWPAFFRSSFWPLFLNIFPAADIMILAWCWNK
FT                   SREGN"
FT   CDS_pept        201338..202975
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761434"
FT                   /locus_tag="AGOS_AFL125W"
FT                   /product="AFL125Wp"
FT                   /protein_id="AAS53249.2"
FT                   /db_xref="HOGENOM:HBG059277"
FT                   /db_xref="UniParc:UPI0001DB2BF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q755E8"
FT                   /transl_table=1
FT                   /translation="MGIFDKVKNAIGEDNFNKLQDEVTSRLGALNQNDSGNNSQNASGY
FT                   NNGSGNAYGNTSSGYDNSQSGQGYGNSQSGGNNYGNNSGYGSGNQTSNNNNGYASNSGY
FT                   YNSNSDSNLNTNAYGRNDSKKNSYGNDNEDSSKNTYESKKSDSDNKYDSNKDENKDENK
FT                   DENKDENKNENKDENKDENKDENKDENKDENKNENKDENKNKDEDKNKDEDKNKDENKD
FT                   ENKNKDENKNKDENKDSKNENKTDSTKNSYGSSKKNSYGSKNSDDGKDDSKDTYGSKNS
FT                   YGSSKKDSYSSSNKNSYDNDNEDSNKTSYGSKNSYGSSNKNSYDNEDSNKTSYGSKNSY
FT                   GSSNKNSYDDNEDSNKTSYGSSNKNSYGSKNSYENDNEDSNKTSYGSKNSYGSSNKNSY
FT                   DDNEDSNKTSYGSSNKNSYGSKNSYENDNEDSNKTSYGSKNSYGSSNKNSYDNEDSNKT
FT                   SYGSSNKNSYGSKNSYENDNEDSNKTSYGSSNKNSYGSKNSYGNDNEDSYGSKNQYDSN
FT                   RGSYDRQNDNESSNLYDSSEYESSNRYR"
FT   CDS_pept        complement(203079..204968)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761435"
FT                   /gene_name="HOT1"
FT                   /locus_tag="AFL124C"
FT                   /product="High-osmolarity-induced transcription protein 1 "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53250.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059278"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniParc:UPI0000252F93"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755E7"
FT                   /transl_table=1
FT                   /translation="MIDPVTHIVTPSNDEQRQGRSDGGMQLGLEDLHGGGGGLGQQKVS
FT                   GMAEGTDSIVDVLTNPSSSVNLHSNILSVSTNVEEGQGMQPAAIQGGGTAAGRRFSSVP
FT                   ISDSPVGCGQHGMGTASTQVPSHGSTANLLSMGNPVATNVQVCQRMDEVSARLIVMEET
FT                   VNKLLGNIDAQQQQIASMRSESMEMLGSLMKEVRELKQQVPVLDDPDNNEKDKFVTDLL
FT                   NSITNVSSNYLKKVSSRNLQRFKRQRDIMSTSDLPSLGNTQSSSHFMQDLVNPYASTQD
FT                   FQSFTVLKDKAKEFTLNPTAINKRRRLSAQPLNTLQMSQDQLQQQRGSVQSLISIPTSG
FT                   QKNANFGPQLQNYLIGLQNIPMSEAEKVSSPTVLKQFQNSTTDPDLKTGRRNPGLDFQI
FT                   GSGDDENDENDGASGEDEDGYLEDDEGYRSQSQRTMSSEDDEQFTGGNQGEDEAGPRAA
FT                   GRNPKSLPSSIVRRFANSGSQVSVSGTPETERLVLKNNDKYDKNTMPAPNTKPRAVLAS
FT                   NPEDTLTDVQYTMVKAPDSVRAIWDEYTIGVGGKPSIRQLEQTYGNKWRTKRNKKTFAR
FT                   RKRIYKFILNGVRNGKSESEMIDILESRRVYRTEDNELKKRTIGWLQQSLSGI"
FT   CDS_pept        205462..207459
FT                   /codon_start=1
FT                   /gene_family="HOG000008335" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930853"
FT                   /locus_tag="AGOS_AFL123W"
FT                   /product="AFL123Wp"
FT                   /protein_id="AAS53251.2"
FT                   /db_xref="HOGENOM:HBG111346"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniParc:UPI0001DB2BF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q755E6"
FT                   /transl_table=1
FT                   /translation="MTEARGILQALRDCGTSTVVRYLVPDYAVPSVAKAVALHKGTEPG
FT                   AAEAFHRPRLVRNGDGVPHFAFVVPEERGEYRTLVQSERALKDLGLRADQELEAHCQGS
FT                   RVYHDEQRGIFPYALAYAGHQFGVFAGQLGDGRVANLYDIRDSRGRYQTLQLKGSGMTP
FT                   FSRFADGKAVLRSSVREFIVSEALAAIGIPSTRALQLTLLPKTRARRTMFEPCAVVARF
FT                   APSWIRLGNFDMFRWRGDDHGLLQLVDYCIQHVFAAGREFPTEISVNAFQEDFFPDPLE
FT                   KIPATDELPKAVAGVTTYDLFFRHVVNLNAECVAYWQAYGFCNGVLNTDNTSLMGLSMD
FT                   FGPFSFMDKYRPEYTPNHDDIEGRYSFSNQPYVIWWNLTKFAEALVLLLGSGEQHIGFV
FT                   KTIPERSVIPENIADELGQRVNALVNCAANEYRFRYHVKYAEIMAKRLGIQLNIPLIQS
FT                   DNLSLIAERVRGFMDSVVNPLLDILSKSMVDYNSFFVALQEYQGPFHSTAGVRGVDPAF
FT                   LQIFFTEEDFQLLTKHANGVSSLDPGTATQFFDLVEKIDSWLINYLQSIPEREERYRLQ
FT                   KLVNPLFIPRSYVFDEVLEELEKMHRNVTDANSADIDTTILTQLYTIATNPYDRTKWYG
FT                   ILDDAKIKAWTEGTTNMPNDDYLKQCSCSS"
FT   CDS_pept        207898..210066
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930854"
FT                   /locus_tag="AGOS_AFL122W"
FT                   /product="AFL122Wp"
FT                   /protein_id="AAS53252.2"
FT                   /db_xref="HOGENOM:HBG059279"
FT                   /db_xref="UniParc:UPI0001DB2BF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q755E5"
FT                   /transl_table=1
FT                   /translation="MSNNTDLLTSGGLSVRCQEASSAIENVGSDGCSDLRFRHEIEPPE
FT                   IDPWGGRYSISLAELPKLPPSYENTLSQAAVPSTFEIGVSKEMVREEIKLLQIIDASDD
FT                   ESIMDYRFCYFPPDTYRLSRTIEAHLADVTRRENELIERPRPPSRRPLTRKDPKQNEYG
FT                   HLLDNYGSDSLERELTSQFKKVSLAGGASGSNTYNGASGQGMGSIQEQQNIRNRSNSPI
FT                   GCSITQKELLNLAPAINFGEFATDIEIPSVSNGSQSQRQLSIDSNSLENRSNTRASQES
FT                   LVHPDSRFHGDQKSMRSDTKSRVTFMSTDTGASESRNTVSSIKKQSTGPARCRAGTDDS
FT                   QSVSSLEIKSLERSTMDSRDMCDFLMPNSANLLAGTRDTKDGFSNIETQRTRSSAFTSR
FT                   ERVRKHRISRASRSPKRASVMKNTIPYSHSDREFRNKLNDMLEQTGVLNISDGSTLSIN
FT                   GQDLISEKPYTNRRMYNTWRGVRSKLVSSRCSSLLSTTDPRACGNPTAKGRLPDLKMPK
FT                   KPWFKRVHETNQRLLKSAARVMFSKIDEFQGMSFERLSEAAKKFDRRRQDRSAEPRTAT
FT                   ESCHTPADAPQSAAPTFGPCHTTTLPPEPSVPLPPPEDRRPSPPAASPARPRHSTFSFQ
FT                   PPVLKPQNLFVTTCAAPGSITPPPEPISHSVSSMPSAWKVRLNPDAKPRGGPRSPKIAL
FT                   AQQIIPLKAVGYKTDQLPNNSHGMYGYL"
FT   CDS_pept        210369..213383
FT                   /codon_start=1
FT                   /gene_family="HOG000248236" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930855"
FT                   /locus_tag="AFL121W"
FT                   /product="Lon protease homolog 2, peroxisomal "
FT                   /EC_number="3.4.21.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent peptidase activity"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="peroxisomal matrix"
FT                   /protein_id="AAS53253.2"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005782"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG059280"
FT                   /db_xref="HOGENOM:HBG566281"
FT                   /db_xref="InterPro:IPR001984"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001DB2BF8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755E4"
FT                   /transl_table=1
FT                   /translation="MGLFGKDRGERIAEFPCYLLETGTHLVPLPGILYNLVIERTYGER
FT                   ILGQFRGIGEAVDGALTGAGEAAEVPGRVAEVMKAFQERYDSGDKTQAVYICLVTEAAA
FT                   GRHIGCIARLTGARAEGGELSVLLRGLVRAVVGQPVPSRRNEMWNGSVTVLDDAQRVAT
FT                   WGARQLDFARQGVFGAFEELDAGIGTFTARFKSSQKRGADGAAHLLTLSPLANTLFFHF
FT                   SRSSFERSWKILRTMMHGFRDAKKDIRTAMDMLSVADLTVGLLPTTTAQRLEFLQAEDP
FT                   AARIKTFVRHMQQLLEVFGSLYRATEYVHDRFETHGPIAKSQLIANQLRSLRFYIDDIK
FT                   RNKPESGPGGRSRRLLPRPASGNSAAAGEEDDSEDSELVAIKRYVDEIEVKGVHADGVK
FT                   MLKKDYRSLSKMHVQSTEYQMLRNYFDFIMGIPFGIYVSTPEIDLVASSRKLDNDHYGL
FT                   VQVKKRLLEYLCVLKLSANSPGVTADAGAIEDGSATKRAVVYENKAQEQRKTKVPFLLL
FT                   VGPPGVGKTSVAKSVADVLGRRFQRISLGGIHNEAEIRGHRRTYVGAMAGMIVNALCKA
FT                   GCMNPLILLDEIDKVLSVPAGAGASRLNGDPGAALLEVLDPEQNHTFTDHYVGFPVDLS
FT                   QVLFFCTANDLSGMSEPLVDRMEVIHIEGYTYEEKIAIGRHFLLPKQIRLNSFDMTGIN
FT                   LSLTDDAWRTVVVDYTREAGVRNLDRQLGAIVRGKIVEYVENNMSGSGDDVVTQKNLPK
FT                   FLGLPPHSLREEVTQTTSFAEKYGVVHGLSYNSDGTGGVLVFEVIRSGDSRDKRLTVQT
FT                   TGNLGTVLSESVSIATSLVKSLLARHVVHSSADDTSVAEFFRSECHLHVPFGAVPKDGP
FT                   SAGAAISLALLSLALKRPVDPALCVTGEITLRGKILPVGGVKEKLLAAQLQGMGLALVP
FT                   RGNRNDLVELAEDNAETQQRLLADPALPELATLQHKLGMAVHYCSDFRDLVLHAWPTAD
FT                   NLWHACEDSSVRPQL"
FT   CDS_pept        213848..215911
FT                   /codon_start=1
FT                   /gene_family="HOG000168830" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931090"
FT                   /locus_tag="AFL120W"
FT                   /orf_name="AGOS_AFL120W"
FT                   /product="AFL120Wp"
FT                   /protein_id="AAS53254.1"
FT                   /db_xref="HOGENOM:HBG058898"
FT                   /db_xref="HOGENOM:HBG396900"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="UniParc:UPI0000252F97"
FT                   /db_xref="UniProtKB/TrEMBL:Q755E3"
FT                   /transl_table=1
FT                   /translation="MRLLAVCWLVWSLAGLTEARRKLSTNSLVSCMEDSQLTAKSFDVV
FT                   FNPDDLSLNFRLDLSTEINGTVRAVVEVWAYGFKVITEAKDMCGIGWKQFCPVTPGDIQ
FT                   IQAVQYVSAEYANKIPGVAYQVPDIDAYLKVMVHETQSNDQVACIQAHFTNGRTVAQTA
FT                   VKWATATIAGLGLLASATLSAFGNSNAASHISATTMSLFLYFQSVVVVSMENVERLPPI
FT                   ADAWAQNLAWSMGLIRVEFMQRIFRWYVQASGGEPSLHLTSTTTSVLAQRSLDALVGRP
FT                   VSKATQSLFASTHTMIFRGIRRLAYRANIESSSVVCTGLTFFLLFGYLIAVAFTLFSGL
FT                   LELLIRMKLMNPVRFLDFRKTWVIVLKGVLLRYIFLGFTQLTILCFWEFVNVDSPALVV
FT                   LAVLALLLSLSIMVWAAYRTIYFGRASIGVHSNPAAILYGNENVLHKYGFFYTMYSATH
FT                   YWWSCMILAHILLKAVFIAFAHNSGKTQAVALFVIEIIYLAALAKCRPYLDRATNILNI
FT                   MISSVTLVNSFLFLFFSGLFGQPASVSSIMAWVFFILNAVFSLILLIMILVCIALVVFT
FT                   RNPDLRFKPARDDRRSFQRKSTINILGKASTAELLALGTTAKAHNENWEDELKKQQTVT
FT                   VDDQVVSPEDSPFAEPVQEPKTSVSGYIKRKLSLKRDKSTRSNRSQYDRLQD"
FT   CDS_pept        complement(216140..217402)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762517"
FT                   /locus_tag="AFL119C"
FT                   /orf_name="AGOS_AFL119C"
FT                   /product="AFL119Cp"
FT                   /protein_id="AAS53255.1"
FT                   /db_xref="HOGENOM:HBG059281"
FT                   /db_xref="UniParc:UPI0000252F98"
FT                   /db_xref="UniProtKB/TrEMBL:Q755E2"
FT                   /transl_table=1
FT                   /translation="MRGFFYVAVLLYLDAFVHAFLVKMGTDPICAVPPDKTLLARTMQL
FT                   LLGIKRLPRRFHSLPDKFTGFRFHKSYRFNHRFFRARKTLKISYCQEGRLQFQVDHMLA
FT                   KEIDWNIPFCVLDAPVEQGKFWQQGSTNLNALNCFKLARRKKYAKRSFDIFLPDTWVGG
FT                   LFHCNVTNDVKTKLVSLMDQNLNIRLDTEGGDNMFDITNVCTRENSIPLQPIMSSDYKQ
FT                   YWTNYKTQSRIPLVRQIYKMQVEKIIPFFETPVSVGAGRIKWGLPLDEQFASMAEFWRQ
FT                   NSKTPWYEEIEVQENYNYNPTEEQDISTAHNITMTLLEPFLKYSRKLLTSFLDHDGTLR
FT                   AQAPERFKEMIDSLGAFKRNIWHFLSTSDVVSSLGPEVHEVLSEIKKLWDDLNLAPEKF
FT                   TYGEDLKKDITTVIKVYRSGP"
FT   CDS_pept        join(217686..217703,217857..220337)
FT                   /codon_start=1
FT                   /gene_family="HOG000163444" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762518"
FT                   /locus_tag="AFL118W"
FT                   /orf_name="AGOS_AFL118W"
FT                   /product="AFL118Wp"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="AAS53256.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG029581"
FT                   /db_xref="HOGENOM:HBG330931"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016453"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0000252F99"
FT                   /db_xref="UniProtKB/TrEMBL:Q755E1"
FT                   /transl_table=1
FT                   /translation="MKLETKKTFVSRTDRVKGIDFHPSEPWVLITLYSGRAEIWNYETQ
FT                   TEVRSISVCEAPVRAGKFIPRKSWIIVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALA
FT                   VHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDH
FT                   TVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVA
FT                   TLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHPT
FT                   GKRNFIAAGFDNGFTVLAIGNDEPRLSLDPVGKLVWCGGKTSSATDVLTAVIRGNEEAE
FT                   DGAVLSLQSKELGTVDVFPQALKHSPNGRFVTVVGDGEFVVYTALAWRNKAFGKCTDFV
FT                   WGLDSNSYALINEHGEVRYYKNFKEVSGWSISLDYSAEKIFPGILLGVKTDGCVCFFDW
FT                   ENGTLVRKISVDAHDVIWSENGELLMIVNSNSDSYDEPGAYMLEYNSAAYEQAIENETL
FT                   DPEEDADDMFEVLHEVNEPLTSGKWVGDVFIYTTSSNRLNYFVGGKSYNLAHFDKQMYL
FT                   LGYLVRDNKVYLADREIHVYGYKISIEVLEFQTLVLRGELDMAKNSVLPNVQGNTNLLR
FT                   ISRFLEGQGLLEDALEVSPDPEQQFDLALKLGKLALARDLVKDGSEHKWRTLGDAALEK
FT                   FNFKLATEFYKNANDLDSLFLIYSSFSNQQELVKLGQEAEQSGKYNLAFNAYWIAGDIN
FT                   KARDVLSKSGRHSEAVLLASTYTSDNDAINAAVEKWKEQLNSAGRVSIAERIILSGEDD
FT                   FPAAPQTLVEMDDGSESASK"
FT   CDS_pept        complement(220427..221338)
FT                   /codon_start=1
FT                   /gene_family="HOG000162366" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762519"
FT                   /locus_tag="AGOS_AFL117C"
FT                   /product="AFL117Cp"
FT                   /function="nucleic acid binding"
FT                   /function="rRNA (uridine-2'-O-)-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53257.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008650"
FT                   /db_xref="HOGENOM:HBG266638"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniParc:UPI0001DB2BF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q755E0"
FT                   /transl_table=1
FT                   /translation="MPVQGLPSVSITPMRELLRGFCRFNSSGRWLSRQRRDPYTREAKV
FT                   QELRSRAAFKLIEIDEQFRLFRAGQRVLDLGFAPGAWSQVAHQRTQPGGKVMGVDVLPC
FT                   KPPTGVSSIQANVLSRKTHELVRLYFSRHFQLNMHDELHKKHGYFQHMLEERLEELQKD
FT                   NSFQPLYGMADPVHEHPLDVVLSDMYEPWPQVTGFWNNFTNAAYSRMANTSGVAVKDHY
FT                   MSMDLCDAALLCAIALLRPGGSFVCKLYTGKEDQLLERRLRKVFTKVRRFKPEACRSES
FT                   KELYFVGLDKRKDIDKVAVFTQ"
FT   CDS_pept        221651..222304
FT                   /codon_start=1
FT                   /gene_family="HOG000207014" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082463"
FT                   /gene_name="RPL10A"
FT                   /locus_tag="AFL116W"
FT                   /product="60S ribosomal protein L10a "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS53258.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG316566"
FT                   /db_xref="HOGENOM:HBG529802"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniParc:UPI0000252F9B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755D9"
FT                   /transl_table=1
FT                   /translation="MSKITTTHVRDNVKELLKYSNETKKRNFLETVELQVGLKNYDPQR
FT                   DKRFSGTLKLPVCPRPNMSVCIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLA
FT                   KKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYSKVTDVRSTIKFQLKKVL
FT                   CLAVAVGNVEMDEDTLVNQILMSVNFLVSLLKKNWQNVGSLVIKSTMGPAFRLY"
FT   CDS_pept        222669..223829
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762520"
FT                   /locus_tag="AFL115W"
FT                   /orf_name="AGOS_AFL115W"
FT                   /product="AFL115Wp"
FT                   /protein_id="AAS53259.1"
FT                   /db_xref="HOGENOM:HBG059282"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI0000252F9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q755D8"
FT                   /transl_table=1
FT                   /translation="MTTSPPLSHSCGSDLVDDTDMEQDLAEMLELPLKTRCLSNNFAEL
FT                   LDYKKSRVSEGEGAERRNVEELLQDASRLNDLVGQGMAAGAVARGWGSRDSCASQTNYS
FT                   AAATAASTTCGSITHFRLSESDSDEDLPFDEHLKRVISRRLAMRQWHREDGRLDMLSES
FT                   EFDTVSNSPTASSASPRAAKGTYRGKNSALLTPQENKDNGCAPGAQHMTAEEALQQFKD
FT                   DICIVVHLSQGSMAATTDRNPFEMKAPASVTYTQYLDRINAKCMFAPIVYQTAGCLLLR
FT                   LTLKWPPSETGPVQIRWPIAESYVHRLIVALIRVSTKIVEDTVHSHEYFSKVCGISKKL
FT                   LMRLELALILVLRGEGLMVTAAALNAASNARARLREQSALPAAAAQ"
FT   CDS_pept        224188..224760
FT                   /codon_start=1
FT                   /gene_family="HOG000163690" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778125"
FT                   /gene_name="SAR1"
FT                   /locus_tag="AFL114W"
FT                   /product="Small COPII coat GTPase SAR1 "
FT                   /EC_number="3.6.5.-"
FT                   /function="GTP binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="ER to Golgi transport vesicle membrane"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="AAS53260.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0012507"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:1M2O"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI0000252F9D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755D7"
FT                   /transl_table=1
FT                   /translation="MAVWDLFGWFRDILSSLGLWNKHGKLLFLGLDNAGKTTLLHMLKN
FT                   DRLATLQPTWHPTSEELAIGSIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADSE
FT                   RFNEARVELDALFQIPELKTVPFVILGNKIDAPSAVSETELRAALGLLNTTGDARIEGQ
FT                   RPVELFMCSVVMKSGYLEAFQWLSQYI"
FT   CDS_pept        complement(224956..228444)
FT                   /codon_start=1
FT                   /gene_family="HOG000166882" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762521"
FT                   /locus_tag="AGOS_AFL113C"
FT                   /product="AFL113Cp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53261.2"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG350173"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="UniParc:UPI0001DB2BFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q755D6"
FT                   /transl_table=1
FT                   /translation="MDQSNKEHRPKKEKATAKKKLHSQGHNAKAFAVAAPGKMAKQMQR
FT                   SSDKRERALHVPMVDRTPDDDPPPVIVAVVGPPGTGKTTLIKSLVRRLTKTTLGEINGP
FT                   ITVVSGKRRRLTFIETPADDLNSMVDIAKVADLVLLLMDGNFGFEMETMEFLNLAQHHG
FT                   MPRVLGVATHLDLFKSQATLRASKKRLKHRFWTEVYQGAKLFYLSGVINGRYPDREILN
FT                   LSRFISVMKFRPLKWRNEHPYLLADRMTDLTHPEVLETQGTHVDRKVALYGYLHGTPLP
FT                   STPGFKVHLAGVGDFPIAHVERLPDPCPTPFFQQKMEEYEREKAKSGEASSTGTTTRRR
FT                   RRLDDNQKLIYAPMSDVGGVLMDKDAVYIDVGGKKGEEASFVPGKERGEGEKLVTGLQA
FT                   VDQNLQERFDGVGLQVFSNGTELRAVDEDDDLDEEDLDEDSTEPVNTGRSSLRHARLHG
FT                   KSVQEANDDIDNLESDEEEDFGADEQYDRDDQRMKRADTEFSDADEKLALVTDSEFELS
FT                   DTETWEQSVAGKLNGTIQKHKKWDISKLVYMNNIDPSDVIKRWNNELPDEDLEEEDIHD
FT                   DDDFFRKKESQIPSKLAGNTAGDLEFFAPSFQSLSELASKWSTIDSIKDFFVGAPVLGS
FT                   NTNGGEEDGDEEEVYGDFEDLEAADEEDSAKKETEDPDSDSSFADFEEEEKKDLTQQEE
FT                   RDLNAAKKEKLRLQFEMEEGDNFKEDDPENEYDTWYELQKAKMAKQLEINNAEFEAMTP
FT                   EQRQKIEGFKSGSYVRIVFEDIPKEFVEHFDPKFPIVMGGLLPAELKFGIINSRLRRHR
FT                   WHKKILKTNDPLVVSLGWRRFQTLPIYTTSDSRTRTRMLKYTPEHAYCTASFYGPLCAP
FT                   NTPFCGVQVVANKETTGSFRIAATGIVEEIDSSVEIVKKLKLVGYPYKIFRNTAFIKDM
FT                   FSSAMEVARFEGAQIKTVSGIRGEIKRALSKPEGHFRATFEDKILLSDIVILRTWYPVK
FT                   IKKFYNPVTSLLLKEKKEWTGLRLVGRIRAEQGMETPLNPDSAYKKVERVERHFNGLKI
FT                   PKSVQKELPFKSQVHQMKPQKKKTYMAKRAVVLGGEEKKARSLMQQVMTIAHAKEDKRK
FT                   AKKAEERKERLKRLAKAEEAKSEKEKQSKKEFFAKHGKKRQFAGGEGNKSYKKKR"
FT   CDS_pept        228840..232424
FT                   /codon_start=1
FT                   /gene_family="HOG000065973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082464"
FT                   /locus_tag="AGOS_AFL112W"
FT                   /product="AFL112Wp"
FT                   /protein_id="AAS53262.2"
FT                   /db_xref="HOGENOM:HBG059283"
FT                   /db_xref="InterPro:IPR004022"
FT                   /db_xref="InterPro:IPR013136"
FT                   /db_xref="InterPro:IPR018501"
FT                   /db_xref="UniParc:UPI0001DB2BFB"
FT                   /db_xref="UniProtKB/TrEMBL:Q755D5"
FT                   /transl_table=1
FT                   /translation="MVLYKRKPIVLPTPKPLPANLECKVWHINETGEWFLTYQEYLERL
FT                   DFYTRHYFTCEITGTSCLTFFDALNSEESQFKNVEERFPLKLREPVARFLHFNEVRRLD
FT                   LLVEQVYAKFKTDFFPGEVVYLRKNRQEVTPAPEDLFREGEVGMQSAPHSSPNSAASSH
FT                   QSQSLQYQKPYVVKEKAHFNAIVDPETKRQISPAYSKYMLVEEHSSGNTGYIIADQSQI
FT                   YRDRSSFTKHLIKCFCKITLRRASSKMGAPWCVKEDYLPMYGLTMDWPVDMLKYKEDQM
FT                   EQRPNSLSKRAREEAATSDLDGQIQPWDHENESYDAAKEHKKKVKKDQPGSQAECPIAT
FT                   TDIEVNPAENQLEEQGASVSLHVPNENAPITSIMEDLKLPFVGQHQPLSSLMTYSRNLD
FT                   AIPHTSRIPTFRNFEKVIQCYAFLNTFNEKLCISNFTWENFITTFRCTDVKLLSGKVVL
FT                   VNVTSENTTDTESGEKDSDIEVLDVVDQDDTYMSADVLDFIKAQNNEHITYSIEDDDSL
FT                   DDEYLDAIKDNGSALLVECFVSLLRLFIDEQGDWKTLVMENWYDEEDEDEDKVSGGGRG
FT                   NTSEESTGLNSKITNGNASCDQGNFDAKVQDNDKNAVEVKTENLVQNDDHEITTPEIDT
FT                   LLDKCLTFRKINWSERLTKRQFQNGFWLIVLLGVYQDCMHLPMYTKFIHDFIKSVVPKD
FT                   GTSTQLNKTLWRNFCRNLDVEQKVTALWILVDLCSNFSHDIKAAVEDSMELCGQIRSER
FT                   YKIGRDLKVEYQTLTDLQETSRKLAEKTADSPELMELEQKMARQEDKIARLQEDKSYLD
FT                   RVLCENDLQRLKPLGMDRYGNKYYWLELHGITRPSKSEGDTYRSLTAGRIWIQGPNSWD
FT                   YNYILGISEDQISQWLSIRLEQGSAAATRKVFGVYRAENGSYWLDDESSGQAIELVDQK
FT                   GALNYNVTLTALQKKIIDETPDGLLLSDSQWYCINSVRDYKILADWWENWGRREHDLLR
FT                   QVKNVETEIMGSLEGDTSALDTLQKEKELMQKFKDHQLTPEELQLAANGEQKDQEQSFK
FT                   TEDQLEQIAEEIMKLDDSSKTRKILDRIKVLEAKRDELLAKKQHVEQHKPGSRIQLRSE
FT                   YKRQKLNIDQKLRLQEEVLTELVNFSFSERQRETIEWENERALNLWGFPLVKGASGKTK
FT                   VQMQGTVDDKLSSILKNTLKHQDTATAA"
FT   CDS_pept        232814..233800
FT                   /codon_start=1
FT                   /gene_family="HOG000248113" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778126"
FT                   /locus_tag="AGOS_AFL111W"
FT                   /product="AFL111Wp"
FT                   /protein_id="AAS53263.2"
FT                   /db_xref="HOGENOM:HBG059284"
FT                   /db_xref="InterPro:IPR007129"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniParc:UPI0001DB2BFC"
FT                   /db_xref="UniProtKB/TrEMBL:Q755D4"
FT                   /transl_table=1
FT                   /translation="MIKGVGRPSIGYLNNVTRSILGGVRMQSSGVKGSPESPEALTKSS
FT                   RLESKPMDFSNNAPVNPHTKRPMLSDSKYESRNYQLPKWKEALGELVVRAFRLDMDRVR
FT                   AGPVAGSYYYAMCKEQGLQFENEELSRSGKFFYEDLKLPRTFSQWYQITILHEWILFVR
FT                   MRALPFKYGRNYQQKLVDRTFSDIELRLFEEMNVKSSRIADQYLKDFHSQMMGAVFAYD
FT                   EGFFTDDATLAAALWRNLFGGRKNVDMVHLEAMVRYVRSQLYVLSKLSDREFGMGEFKF
FT                   VPPDEAVEVLSEQDEAQLKERVKEKYLAIDRNPATLPSEKSNLSYEN"
FT   CDS_pept        complement(233889..235532)
FT                   /codon_start=1
FT                   /gene_family="HOG000214306" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778127"
FT                   /locus_tag="AFL110C"
FT                   /orf_name="AGOS_AFL110C"
FT                   /product="AFL110Cp"
FT                   /function="ATP binding"
FT                   /function="hydroxyethylthiazole kinase activity "
FT                   /function="magnesium ion binding"
FT                   /function="thiamine-phosphate diphosphorylase activity "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="AAS53264.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004417"
FT                   /db_xref="GO:0004789"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="HOGENOM:HBG052912"
FT                   /db_xref="HOGENOM:HBG326763"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniParc:UPI0000252FA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q755D3"
FT                   /transl_table=1
FT                   /translation="MKEVDYSLYLVTDSSMLPQGTTLDSQVTAALQNGATLVQLREKDA
FT                   DGCDFVEAALRVKRICAEFNVPLLINDRVDVALAVDADGVHVGQQDIPPPLVRKLVGPS
FT                   KIVGWSVGRPEEVQQLAEWGQGCVDYIGVGMIFPTETKKNPRKVPMGISGAIEIMDALE
FT                   ECRATWCRTVLIGGLHADNIGRVLLQCASSNGKRAADGVAVVSEIMAASDARGATQRLR
FT                   RLLDDGAYRFVVGKFTEDVDYRAPDDMETYVPMLLEASPLVHHVTNKVHQNFAANVTLA
FT                   AGSSPIMSEVSSEFEDLSTAAHSALVLNTGSLVDLEVATAAVRAYNKARRPVVFDPVGF
FT                   AASRTRLDYNGHLLNMGQYTCIKGNASEILALSSSEHRAMRGVDSEHDVDIDTLCNAAR
FT                   QVAYRYRTVVVLTGQNDIVVNGALDCSFNLGFGSAPPQDHLPAYIVSCDSIPLFSKVTA
FT                   TGCSLGSVIACFLGALPPDGSPFHAVLSAVLIYKSAGYFAAGRATGGASFQTELLDELD
FT                   TLFEKGSHGQMAKIYPFGSWPVKVERVDIP"
FT   CDS_pept        235723..236436
FT                   /codon_start=1
FT                   /gene_family="HOG000000976" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778128"
FT                   /gene_name="LEA1"
FT                   /locus_tag="AFL109W"
FT                   /product="U2 small nuclear ribonucleoprotein A' "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS53265.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG059285"
FT                   /db_xref="HOGENOM:HBG204032"
FT                   /db_xref="InterPro:IPR003603"
FT                   /db_xref="UniParc:UPI0000252FA2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755D2"
FT                   /transl_table=1
FT                   /translation="MKLTPASILEAPVYYADHIHGKYDVDKVVILRDCGYVSENEIMPQ
FT                   TLKLLPERTNIVDFTNNELEELPPLGHNDTVHTLLLSRNRLGRLDASRLPRYLVNLNLA
FT                   MNRFEKFEQLQGLRSAPKTLKNLNLRGNVICHKEQYRETVIALCPQLAVLDGERVRQAE
FT                   RQAAPQNEKTDTPTEGPQPVALQATSEKELQLMDHVVNKMDKDTLEDIKQQLAKATTLA
FT                   EIERLEKLLSGGVIQ"
FT   CDS_pept        complement(236472..240833)
FT                   /codon_start=1
FT                   /gene_family="HOG000065972" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762522"
FT                   /locus_tag="AGOS_AFL108C"
FT                   /product="AFL108Cp"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS53266.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059286"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI0001DB2C1E"
FT                   /db_xref="UniProtKB/TrEMBL:Q755D1"
FT                   /transl_table=1
FT                   /translation="MPEAPGSGGRRRNAAKKINYNEKMADAELARRIKQLEKGRGRGGA
FT                   RAGGRGRASNFKYQWYLQDRSVGWNFIPSLPPTCRKHSRFSNILELEEALVDVRRQVVV
FT                   HGGSTLLRRDEHIYMVSEPPGEPYYIGRVMEFVGKTEFRKLIEDAVSEGVAHVFPARYF
FT                   QARMNWYYRARDIQDNPQNADPRLLYASLHSDLCPLHSYRGKCTVVHRSDAEEGYATRP
FT                   NYFVFDQLFDRYTLSYYDVWRTEKLLALGPGSKYLEALSERYPHVYVEEKYPLEHVVRR
FT                   YIVGENVPDKVDGQLWDQRCGQCREWCEQAQSLRCDSCKVPLHLFCFDPPLDRKPAKGV
FT                   SWICSDCVRTQNNETNSDQMSAAEESEFEKLSSVALRELGKGINLENWWFQYFGSRLVC
FT                   HLQDCLSTALVLPYPIKCSRVGNKVQWSSCNEPEWLPRPYTGEECERGEDSSLELLWSL
FT                   DTAKITPETLDAYLERCSSTLPEPLGITPQATNFLDMVLKALVDCRFDLEAAFTWCRNN
FT                   MTRKTLKEPTLTEEEVEKFENAVAEHGSELHPVCKYVGSQPMSMIVRFYYYWKKTPNGR
FT                   RIWGNFKGRSKRGRQKYDDGLPENTPSDSTRKRKRIATEKVEEVSKQWRHVDESCFDSE
FT                   QISKVKACFQCMFCNVDYSPLWYRVTGGCDDEKVQSRMKTGVNEKTNTSEKAPSQQITK
FT                   DDNKLTALCIRCARMWRRYAVKWHAPLDVLKRLNGPSMNNVQSNLQQFLDDPNESVVKT
FT                   SPAQAQTKMVEWELVQDMELIIKQRLEIISNPERLIKMKRNCLSAHAQLNKLVKKLIPE
FT                   SLMSESDMKKELEVYIAHYAAELKKKEQKMQQKNKHLLSVKEHNLEAIGSKMKTELNST
FT                   TSVEQLGAVQKPKRQKTQKTLQNTAVLLDIPGISEPEFTEKITLDNNFEHIKIPEAIHN
FT                   KLFGSMFNDNADHTEDLALINGQNNHQRQLSLRQSPFNSNDIPIVRHMQYEGILREYNS
FT                   HNASYAVWRKNHSGAFTNVEKSGPNKSKSCTPPSSAGRSRAHTLVSVDNLMATNAVEPR
FT                   DFCCICFGKFKTDEYELLCSNCGLNVHTYCYGVNKPRTSVSPGALWLCDPCSNDRNVLV
FT                   STNYQCTLCMAREIDHDSSRKRLKKAVPDALKPDVNGNWCHVICALFNEQIKFGSATNY
FT                   QPVYNIGPTLLKNNGVKCGICTMLGGGLVRCDKCPFKFHVTCAQDSKNFTLCFKKYMVA
FT                   IANSPTHVVDGDEIYTVKPKILCPQHHSDSNTGAYLPLNHTISSGAPLLQFYMENYKAC
FT                   TFVNSYTTIGLRAMEREACSLLLAQYDNLESPPHNGISKEATNKCVKCAATLALCWFEN
FT                   LCHSCSIVVAAESDVIEVDDTPVLPDQGTIDEALAEELLHGIDSTKLSIELNILHSAKG
FT                   KRKGGRYGKRNLPKPSIDASNVVVQPMGTNLPPQTGVAITTTDTEPPNGAC"
FT   CDS_pept        241066..242457
FT                   /codon_start=1
FT                   /gene_family="HOG000162728" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762523"
FT                   /gene_name="CEG1"
FT                   /locus_tag="AFL107W"
FT                   /product="mRNA-capping enzyme subunit alpha "
FT                   /EC_number="2.7.7.50"
FT                   /function="GTP binding"
FT                   /function="mRNA guanylyltransferase activity"
FT                   /biological_process="mRNA capping"
FT                   /cellular_component="mRNA cap methyltransferase complex "
FT                   /protein_id="AAS53267.1"
FT                   /db_xref="GO:0004484"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0006370"
FT                   /db_xref="GO:0031533"
FT                   /db_xref="HOGENOM:HBG052763"
FT                   /db_xref="HOGENOM:HBG330574"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR017075"
FT                   /db_xref="UniParc:UPI0000252FA4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755D0"
FT                   /transl_table=1
FT                   /translation="MDSRDAPEVPGIRQPANVTTDLKMIICKLLNSPKPAKTFPGSQPV
FT                   SFQHVDIEEKLLAQDYYVCEKTDGLRALMLIIMNPVTKEQGCFLIDRENNYYLLNGFRF
FT                   PRLPRANRKELLETLQDGTLVDGELVVQTNPATRLRELRYLMFDCLAINGRALVQSPTS
FT                   SRLAHLGKEFYKPYYDLRAYYPDRCATFPFKLSMKHMNFSFDLDRVAGSLDKLPHVSDG
FT                   LIFTAVDTPYTVGGKDSTLLKWKPEQENTVDFKMILEIPVVEDDTLPKKDRNRFYYNFD
FT                   VKPSFHLYIWQGGPDVNTRLHDFEQPFSKKELEILHRTYKVFAELQISDEQWAKMKALE
FT                   QPLNGRIVECAKDQETGEWKFLRFRDDKLNGNHVSVVQKVLESISDSVKLEDLEHMIPR
FT                   IKARWEERKSKKRTHSSISGPMLPPVAETKAPREATQSRYIDDEDWSDEADDDDEDSLK
FT                   RARIE"
FT   CDS_pept        complement(242546..243868)
FT                   /codon_start=1
FT                   /gene_family="HOG000142042" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778129"
FT                   /locus_tag="AGOS_AFL106C"
FT                   /product="AFL106Cp"
FT                   /protein_id="AAS53268.2"
FT                   /db_xref="HOGENOM:HBG059287"
FT                   /db_xref="InterPro:IPR017082"
FT                   /db_xref="InterPro:IPR019368"
FT                   /db_xref="UniParc:UPI0001DB2C1F"
FT                   /db_xref="UniProtKB/TrEMBL:Q755C9"
FT                   /transl_table=1
FT                   /translation="MLRLQARAFSSSCSVLATARKQAQKKGYNKKDTAAAKPVVKKVVS
FT                   GSLYKPWKFAVGTSKLNANAPALELPVFNPAEPKNEVAVFSGEQQQFLHRIGAFRLGQF
FT                   HELFSRPVCYTREATGQLLERLSGTEHQRVILTGQPGVGKSTLLAQAQVAAFEKGSVII
FT                   NISHPELFLNGRNDFRHDTTGEQEQYTQPMYLKKLLTKILKSNKKSVLSSVALTQEYKF
FT                   PVADTRESASKRVTRLVPGKNTLYDLLSMKTTPAARGMLFQAVIDELVAQSAVPVYLTV
FT                   DNFSRILSEPLSAYKDTSCRSIHVLKLQLGRIIMNFVSGATKLNHKDSRVVLATSGVDR
FT                   ETKTLPTGLGQTPHDPYAAKYNYDAVLAEMMLKGGVKEFRVEPLSKPEVAELVDFYAKA
FT                   GILSEKDQENRREGRLVDEKYLLSGNGNLRELLKSLTLYPF"
FT   CDS_pept        complement(244069..245655)
FT                   /codon_start=1
FT                   /gene_family="HOG000213984" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778130"
FT                   /gene_name="PUS1"
FT                   /locus_tag="AFL105C"
FT                   /product="tRNA pseudouridine synthase 1 "
FT                   /EC_number="5.4.99.-"
FT                   /function="RNA binding"
FT                   /function="metal ion binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53269.2"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG175106"
FT                   /db_xref="HOGENOM:HBG736083"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0001DB2C20"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755C8"
FT                   /transl_table=1
FT                   /translation="MPSDASTGYVDDQPGDEAYKRGALYKQTKARRADYDSDKEAKRPC
FT                   TEDSDVALAGTSEEKEARLPKRKVAVMVGYCGTGYHGMQYNPPNRTIEAELFEAFVKAG
FT                   AISRANSTDLKKNGFMRAARTDKGVHAGGNVISLKLIIEDPAIKDKINEHLPPGIRVWG
FT                   ISRVNKAFDCRKLCGSRWYEYLLPTYSFIGPKPNTYLARTIEQCGEAASEKPDRDQESL
FT                   DFWEAFRKAVDEKFTQEEQDAIVNYVAPSKEDFDENSGLYQKVKQYKQMENAHRRSYRV
FT                   SSAKLARFREAMKQYLGPHNFHNYTLGKDFKDPSTVRFMKDITVSDPFVIGEMKTEWVS
FT                   IKIHGQSFMLHQIRKMISMATLVARCNCSPERIAQSYGPQKINIPKAPALGLLLESPVY
FT                   EGYNKRLLEFGYEPIDFRNYQKEMDTFKMVHIYDKIYKEEVDENVFNAFFNYIDAFNQV
FT                   TGAQGEPTKSHDPAKIQLSIIDFLLPCSSSPQENASPEAQKAPETPAGDNTISAEQPKT
FT                   ATEVPTTQSDA"
FT   CDS_pept        246109..246654
FT                   /codon_start=1
FT                   /gene_family="HOG000168475" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762524"
FT                   /locus_tag="AFL104W"
FT                   /orf_name="AGOS_AFL104W"
FT                   /product="AFL104Wp"
FT                   /function="RNA binding"
FT                   /biological_process="ribosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53270.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0042255"
FT                   /db_xref="HOGENOM:HBG198350"
FT                   /db_xref="HOGENOM:HBG377944"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016686"
FT                   /db_xref="UniParc:UPI0000252FA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q755C7"
FT                   /transl_table=1
FT                   /translation="MRQLTEEETKVVFEKLAGYIGRNISYLVDNKEQPHVFRLQKDRVY
FT                   YMPEHIAKLATCVARPNLMSLGICLGKFTKTGKFRLHITALTVLAQHAKYKVWIKPNGE
FT                   MPFLYGNHVLKAHVGKMSDDIPEHSGVIVFSMHDVPLGFGVSAKSTSEARDLQPMGIVA
FT                   FRQADIGEYLRDEDTLFT"
FT   CDS_pept        complement(246762..248606)
FT                   /codon_start=1
FT                   /gene_family="HOG000000979" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082465"
FT                   /locus_tag="AFL103C"
FT                   /orf_name="AGOS_AFL103C"
FT                   /product="AFL103Cp"
FT                   /function="7S RNA binding"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle "
FT                   /protein_id="AAS53271.1"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0048500"
FT                   /db_xref="HOGENOM:HBG059288"
FT                   /db_xref="HOGENOM:HBG204034"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013699"
FT                   /db_xref="UniParc:UPI0000252FA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q755C6"
FT                   /transl_table=1
FT                   /translation="MAGKDLKSLIERLNLSSSKDEHSQVAAAYLELVANGCDDVCGALE
FT                   KCVTALIKQDRYEQAMEVFAEYADVCKEGRFALLKLYTFYKLGQSAAFETEWAQVAEKV
FT                   EASLAQDTVTAELRPLLHVRAQFDYKMGRYSDMFRTYKYLAAHNEEEADDGMELACNER
FT                   VPLAFLPAEAVAEVSGKLVEDSYDMLLNESMVCSSKGQLEQAESLLKRALELARAEEVE
FT                   DDVHTIQLQLAYVTQLLGRKKESRKLLTDLQKQVSAVSPLVSIIKTNLKSLDDLSRYSE
FT                   NSNLPLVLRELDAERLASSSSKTYSHDQWLRLQANLLFMRLFSNTIIRSKSTILSRTLA
FT                   QYSKLVDNVCLESYTVQAKTLFDHVLSLIAKKDENAVGVLVLAVQLQLKAKNIGRAILL
FT                   CEKYWENMAAESHKELVSSLLVHLYKQTRRKRSLLRHLAEITESFDPVNVRQSYDYWKF
FT                   IGFQLLENQLGSARDVFAALAEVRPADSLVAKVLNPADQHELSEDMITDLVRDIDVEAL
FT                   IANGVDPLEASCRIPKASAGKVSKKRRTGKPKLPKAFDPEKQPDPERWLPLRDRSSYRP
FT                   KKRHGKQTQGGVVDKRAESNLDITKQKKKPKQKKAGHR"
FT   CDS_pept        248850..250514
FT                   /codon_start=1
FT                   /gene_family="HOG000065970" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762525"
FT                   /gene_name="MRH4"
FT                   /locus_tag="AFL102W"
FT                   /product="ATP-dependent RNA helicase MRH4, mitochondrial "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS53272.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG059289"
FT                   /db_xref="HOGENOM:HBG397584"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000252FA9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755C5"
FT                   /transl_table=1
FT                   /translation="MSSVGIASASLWLRGPVKSALKGRWLSCEQMRRYGTKSAPAVRKG
FT                   GHSKKARQAPSLPFVFGRHKQLTGPEFTRRTRIGNLSDKITKFEQLKLLPEVREVMMKV
FT                   IASESVLNKSLDDEDCGLDDKRVAAFLGQVQPTPIQTAVIKKMAKTLMEPQLQVHMVAA
FT                   ETGSGKTMSYLMPLVDYLKQEEQAAGTEEGRARLGALRSLILVPTHELVEQVYMTLEKL
FT                   QEPLQLKTFKLDRDTPYKDIVEAFKGRVDIMVTTPGKLRGLFKIRMLHRPDRILSQVRF
FT                   AVVDEADTLMDQSWVQETYSCIKSLRDANHLVFCSASVPMEFEKAMNKLFPNLQVVASE
FT                   KLHRINKHSNIKIINVALRPYNGSKMKALAQALYAIMKDGTSEGYEKRCVVFVNEADSV
FT                   NSIVDTLRDKFGHDVHGLTGEHSLDDRLATIAPFMRSPPRIQDQVRPSELKKPQERRLP
FT                   NSNIKVADSKDNGQRSVSSPLKVLVTTDVLSRGINFKGVKHVILYDVPAKSIDLVHRVG
FT                   RTSRMNERGHVYIFVGKKGSAQAKGLNPVVKKNRPIQ"
FT   transit_peptide 248850..249011
FT                   /gene_name="MRH4"
FT                   /locus_tag="AFL102W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755C5 "
FT   mat_peptide     249012..250511
FT                   /gene_name="MRH4"
FT                   /locus_tag="AFL102W"
FT                   /product="ATP-dependent RNA helicase MRH4, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755C5 "
FT   CDS_pept        complement(250575..251678)
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931091"
FT                   /gene_name="IPL1"
FT                   /locus_tag="AFL101C"
FT                   /product="Spindle assembly checkpoint kinase "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="cell cycle"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS53273.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020663"
FT                   /db_xref="UniParc:UPI0000252FAA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755C4"
FT                   /transl_table=1
FT                   /translation="MDADAILKKDQRRSSLKQRNLLLSMRLNQTTATNGAPPQARVQPG
FT                   KGYRNPGKVLSPIRNQEMSPGKRPTLEISELKNVSPINQAHKTGKARAGGVPLSKLQNL
FT                   KLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSS
FT                   LRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMADALDY
FT                   MHERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKGSKRKTLCGTVDYLSPELIRSR
FT                   EYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLIFPDHVDTEARHLISRL
FT                   LEYDPGDRIPLKEVKKHPWIEKNKPFW"
FT   CDS_pept        252056..253786
FT                   /codon_start=1
FT                   /gene_family="HOG000142041" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778131"
FT                   /locus_tag="AGOS_AFL100W"
FT                   /product="AFL100Wp"
FT                   /protein_id="AAS53274.2"
FT                   /db_xref="HOGENOM:HBG059290"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR017119"
FT                   /db_xref="UniParc:UPI0001DB2C21"
FT                   /db_xref="UniProtKB/TrEMBL:Q755C3"
FT                   /transl_table=1
FT                   /translation="MDVSRLEKLLAWGLEHGIRLPEHVKFCEAPGKGIAAFASDEVASG
FT                   AAFELPHELILTSGLALEHFNKTRDGNMWLKLLLAKMRFGGGPVNVRGCDVAAKFEPYV
FT                   ACLPARVGSPLEWPVEMWALLQGTNLGKSVGQKLLEVVQQWRDMLAALGAELDTAVQAQ
FT                   AAAAAELLAAGVAEWPAFHARVAGGPATSWLSFQAFLWGHLMLTSRAFPERVLRSDCDE
FT                   SAVVLLPVLDLLNHSTDARVEWSGKDGFTIRQLQPLRQGQEVCNNYGGKSNEELMLGYG
FT                   FAIEDNLFDHVALRVCPPAATVQAMLDAGLKLPTLDDYTTYAFERHPATSSVHDASAYS
FT                   KGVLFLLGRSNVALEQLLDLFAFQEAAAEECHKALRCRLQAMQNLIELLRGRLHVIQEG
FT                   EMAADEQETAAKSYPQAMATVRIYRKQQQELLRAAVKTLKRWEKETLAAIKEKTVAFKN
FT                   VTKHDPGFVDELLPALFSSDVEFENYDDILLLWIILRGKSSVETPKRFQSLFAAYVTYA
FT                   RGPADLSEDLQTMFESKYRAWFPKGSKQVSLDEVLDAASFFMRHSYVRASTGESIIIVE
FT                   "
FT   CDS_pept        254140..256458
FT                   /codon_start=1
FT                   /gene_family="HOG000216584" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082466"
FT                   /locus_tag="AFL099W"
FT                   /orf_name="AGOS_AFL099W"
FT                   /product="AFL099Wp"
FT                   /function="FMN binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="AAS53275.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG265454"
FT                   /db_xref="HOGENOM:HBG628142"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="UniParc:UPI0000252FAC"
FT                   /db_xref="UniProtKB/TrEMBL:Q755C2"
FT                   /transl_table=1
FT                   /translation="MCGANLDAEEPFLSGIPGSAILAAVLASYIGTGGRISIGCVVTAL
FT                   YLLANIEAKKNASFAAALGVPVSGKGKGCCGGKNGGCCSTKAAAKPTGHKCSCSGAKVT
FT                   KSKAPVAASAAARSQEEAFPIAIDFTNSFKAPQSKVPPVKKTPKVISGTAKKKQKDAFI
FT                   KSGLTVSNEKLLASQIYIFYSSLQGAAKRSAELVLAELRELKPLELEPILLNLDEIDDL
FT                   DKYFVDVPCENALYVLVLPSYDSDSPLDLFLETLEENFNDFRIDNYPLRKLVGYSILGI
FT                   GDSEMWPEKFCYQAREADLSIAKLGGRRIYPVGEVCVKFGGDPKVEEWARLFVETLQDD
FT                   EPMLYEYDESVEDELDESSDAAAEALVDLEDIGNGSGGNGTGALKKMVAKDSPTYKNLT
FT                   KQGYSIVGSHSGVKICRWTKNDLRGRGSCYKHSLFNIVSSRCMELTPSLACSSKCVFCW
FT                   RHGTNPVAKNWRWELDEPEFILENALKEHYSKIKQMRGVPGVIAERFAKAFQVAHCALS
FT                   LVGEPILYPYITRFIELLHQKNISSFLVCNAQHPDQLEALGKVTQLYVSIDAPTKTELK
FT                   RVDRPLYKDFWERLMRCLELLRTSQAHQRTVFRLTLVKGFNMADVSSYADLVQKGIPCF
FT                   IEVKGATFCGSSDGNGNPLTMQNIPFYEECVSFVKEFVAELQKRGLAYDIAAEHAHSNT
FT                   VLIAHTKFKRGDKWYTHIDFEEFFKLLNSGASFTHMDYMAETPEWALFGNGGFAPGNTR
FT                   FYKKKNRKDEASVREGKLA"
FT   CDS_pept        256774..258318
FT                   /codon_start=1
FT                   /gene_family="HOG000177048" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762526"
FT                   /gene_name="ALG2"
FT                   /locus_tag="AFL098W"
FT                   /product="Alpha-1,3-mannosyltransferase ALG2 "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53276.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG027993"
FT                   /db_xref="HOGENOM:HBG320579"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI0000252FAD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755C1"
FT                   /transl_table=1
FT                   /translation="MMTPLNIALIHPDLGIGGAERLVVDAAIGLQDQGHRVTIYTSHCD
FT                   KNHCFEEIKRGDLKVVVVGDFLPTNILGKFFILCANLRQLALVFKLVINGSIDKHDLFI
FT                   VDQLSTCVPLLHLFSASGRVLFYCHFPDQLLAQRKSLVSKLYRVPFDLLEQLTMGCSDS
FT                   VVVNSYFTRSVFFDTFKILRLNPRVVYPCVAMDELPIEKIDIGFYDQIIGPNNRYYLSI
FT                   NRFERKKDIALALNAFKASKEGHSSDTKLIICGGYDSRVAENVEYLSELQLICEKANIA
FT                   HVTIFYSEFSRTPEHYTFPTGVREKKVIFLASISSSLKELLLKKAQLLLYTPSREHFGI
FT                   VPLEAMKHGTPVLAVDNGGPLETVVTLKSDNQDTATGWLRRADAGIWAEAIDEQAEYVK
FT                   KNPGIFATNGPKWVKDKFSRDAMTSSFLHNIDNIFMTDRVIQPWAVMVILAASYILWRS
FT                   SHVFGDACRYIYLLTGGILVLRSRYLLAIFWVLLFVMQPQLSVGVDTITATLKPKL"
FT   CDS_pept        complement(258354..259934)
FT                   /codon_start=1
FT                   /gene_family="HOG000142039" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762527"
FT                   /locus_tag="AFL097C"
FT                   /orf_name="AGOS_AFL097C"
FT                   /product="AFL097Cp"
FT                   /protein_id="AAS53277.1"
FT                   /db_xref="HOGENOM:HBG059291"
FT                   /db_xref="HOGENOM:HBG103491"
FT                   /db_xref="InterPro:IPR013243"
FT                   /db_xref="UniParc:UPI0000252FAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q755C0"
FT                   /transl_table=1
FT                   /translation="MTDIHSNIKRLKTHIRLGNLDTEGNSGWKDLIPIAKSSSSERFLE
FT                   DEREHGAAGSLLGAQQLTSAYLSHTVAPLEPPVDYRVCNDCGRPIAYSALLVHLQEHCR
FT                   RRKESENGAKSPPPEMSPATVKQLKRSSSTDMELSPSKKQRKVATPSTKRQRKVKQRNP
FT                   TEPHLVDLDKQCGVELPERGVCGRSLTCKSHSMGAKRAVQGRSKPFDVLLTEYQKKNHI
FT                   KNASKGARAKGQPLNQQQKQKLLDKEQEQDVPILSPEEETTQVLNGVSRSLPLPLETNI
FT                   LTSTKTRTKYFRMREMFASSFSIRPGYSTPGYGAIHSRVGCIDLDRTTEYTFRIRVPQL
FT                   VNQNSPQGSPPQHVHAIQHHRMKQPAQQMQDMPSITHSLPQQQMPAHVSEEHLQYRPQQ
FT                   GSDIKTMENLTGIVDRPITPRDVQTQQLLMQQQQQQQQHRQQHHERQHLPQEKQQQQQN
FT                   EQLQRIQQRKRLEDASAQLDTASKLMQGSPINVSGSMVNNSGVGSPVNVKNQGMVNMGL
FT                   NNGYDSRGN"
FT   CDS_pept        complement(260408..261358)
FT                   /codon_start=1
FT                   /gene_family="HOG000000980" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931092"
FT                   /locus_tag="AFL096C"
FT                   /orf_name="AGOS_AFL096C"
FT                   /product="AFL096Cp"
FT                   /function="glycerophosphodiester phosphodiesterase activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="AAS53278.1"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="HOGENOM:HBG059293"
FT                   /db_xref="HOGENOM:HBG512055"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI0000252FAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q755B9"
FT                   /transl_table=1
FT                   /translation="MPQIIGHRAYRGKYPENTLLAYDKAYEAGVDMIETDIQMSDDGVV
FT                   VINHDMDTGRMYDRSMSIADTEWRKLQKLRLASHPDIGMLSLRDALLWLMKHDNVKLLL
FT                   DVKATNKRLILVRAVDEMLSLVDDLDYWRSRILFGLWQLDWFEYGVSTTILRGFPLVYI
FT                   GLSLDQAAEFLDYSETLAHPDYRLHAVSLHHVATWAPEFHAEWQRFQRSGIQLFLWTVN
FT                   SALDTKYLAHVPVAGVVTDVPVDMSHDTKKWPRKDSPLTPPSIMTREGLRFHFFLAVYR
FT                   VARALTTSSWAKRPIFGPYSVNLICIILLRRIHFI"
FT   CDS_pept        262306..269913
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082467"
FT                   /locus_tag="AGOS_AFL095W"
FT                   /product="AFL095Wp"
FT                   /biological_process="flocculation"
FT                   /protein_id="AAS53279.2"
FT                   /db_xref="GO:0000128"
FT                   /db_xref="HOGENOM:HBG059294"
FT                   /db_xref="InterPro:IPR001389"
FT                   /db_xref="UniParc:UPI0001DB2C22"
FT                   /db_xref="UniProtKB/TrEMBL:Q755B8"
FT                   /transl_table=1
FT                   /translation="MRSLLGVLAALLTTALAQEAVPVQQLQACDPLRANPNLTPRSGFD
FT                   ITYYDYPWLSYSDRVNRGVPDRTTYLSDPYLRGGYANYQRLGSSTGVTNLTFINEFGLG
FT                   RGRERVRGNLPPNYNFPDEINISNFAYVGTGYFRADQDGSYNFTLDFVDDYAAITVGGG
FT                   RAFTCCREESTVTSPSDFQISAVWSREAPAGRAWTVVNLQRGAYYPLRVFYVNTNNWAG
FT                   IRFTFTDPSGVHHEDFQNHIFHFDDQPNECPEIVATTTHPYDGTETVTAYTTLSTYTNS
FT                   DNQLTTGRVVVINTPYPRGETTTTNGWTGSYTTTLSTGVATVTGTDGYGTIETIYHVVT
FT                   PEASAVTTTTSGWTGTHTTTLSTGLTTVTGPDGIATTETTYYVVTPEAQAVTTTTSGWT
FT                   GSFTTTMSTGVTTVTGSDGIATTETTYYVVTPEAEAVTTTTSGWTGSYTTTMSTGVTTV
FT                   TGTDGIATTETTYYVVTPEAQAITETTSGWMGTYTTTLSTGVTTVTGTDGIATTETTYY
FT                   VVTPEAHAITTTTSGWTGTYMTTLSTDVTTVTGTDGIATTETIYHVVTPEGVLTATVTS
FT                   GWTGSITTTLSTGVTTVTGTDGIATTETTYYVVTPEAELVTTTTSGWAGTYTTTFSTGV
FT                   TTVTGPDGIPTLETTYYVVTPEAEAVTTTTSGWTGSFTTTMSTGVTTVTGSDGIATTET
FT                   TYYVVTPEAEAVTTTTSGWTGSYTTTMSTGVTTVTGTDGIATTETTYYVVTPEAEAITT
FT                   TTSGWTGSYTTTMSTGVTTVTGTDGIATTETTYYVVTPEAEAITTTMSGWTGSYTTTMS
FT                   TGVTTVTGTDGIVTTETTYHVVTPEAHAITETTSGWMGTYTTTLSTDVTTVTGTDGIAT
FT                   TETTYYVVTPEAHAITTTTSGWTGTYMTTLSTDVTTVTGTDGIATTETIYHVVTPEGLL
FT                   TATVTSGWTGSITTTLSTGVTTVTGTDGIATTETTYYVVTPEAELVTTTTSGWAGTYTT
FT                   TFSTGVTTVTGPDGIPTLETTYYVVTPEAEAVTTTTSGWTGSFTTTMSTGVTTVTGSDG
FT                   IATTETTYYVVTPEAEAVTTTTSGWTGSFTTTMSTGVTTVTGSDGIATTETTYYVVTPE
FT                   AQAITETTSGWMGTYTTTLSTDVTTVTGTDGIATTETTYYVVTPEAHAITTTTSGWTGT
FT                   YMTTLSTDVTTVTGTDGIATTETIYHVVTPEGLLTATVTSGWTGYYTRTLSTGVTTVTG
FT                   TDGIATTETTYYVVTPEANYVTTTTSGWAGTYTTTYSTGITTVTGYNGIPTIKSTYYVV
FT                   TPEASVVTTTASGWRRTYTTTRSTGITTVTGTDGIATTETTYYVVTPEAHAVTTTTSGW
FT                   TGTYKTTLSTDVTTVTGTNGIATTETIYHVVTPEAHAITETTSGWMGTYTTTLSTDVTT
FT                   ITGTDGIATTETTYYVVTPEAHAITTTTSGWTGTYMTTLSTDVTTVTGTDGIATTETIY
FT                   HVVTPEGVLTATVTSGWTGSITTTLSTGVTTVTGTDGIATTETTYYVVTPEAELVTTTT
FT                   SGWAGTYTTTYSTGVTTVTGPDGIPTVESTYYVVTPEASAVTTDVHGWTGSYTTTLSTG
FT                   FTTFTGTDGIATTETSYYVVTPEARAARRTTSGWTGTYMTTLSTGVATVTGTDGIATTE
FT                   TTYYVVTPSPVTTPVSIRYNTTTAWLNTTFTESTTVVESVPTTETVLVTTTDIHGETSV
FT                   STSTLTTTHVVPTTAWWNTTVVRPTTFLNITLVPTTVMSTTSVPTTKTAWANTTATIRE
FT                   NVTRSEVETVITTVTNTQSISTVAWANSTITVQPTTIVNPTEMVTLTETINYTTTKSDG
FT                   EKTVETTVVTTEVLPTTVWRNSTISAGPTTVVTVPEPGTTTETYYITSTRPDGQTTIEA
FT                   TTTVVTKHVVPTTVWMNSTISHCTDCSTAVIHPTESVTMTETHYITSTAVNGSTAAKTV
FT                   TTVVTTVVPESTVWLSTTVCGDTTASHCTDCVTTVVHPTDLVTTTETYYITSTAADGSK
FT                   ATETVTTVVTTVVPESTVWLSTTVRDPTTIVTTKQAPTAAWQNTTVLTRSTEVITTTET
FT                   QFVTKTGTDGSPTIETTETVITRDPLTTTAWVTTTIDGKTTVVPPPPEPTTTTETILLT
FT                   TTNAKGVTIVETTTNVVTKEAECPTSGRETTVTTAPVLTSLTEQVTITETISYTVTGDD
FT                   GVKTLETTTVRTSTAVITTEIPGPKPPVPTGPGPEIDRSSSSVPGHSSPTGSEPCHSPP
FT                   PATSQPCPPPATSQPAQSSSSASQPCPPPATSQPAQSSSSASQPCPPPATSQPAQSSSS
FT                   ASQPCPPAATSQPAQSSSSASQPCPPSATSQPAQSSSSASQPCPPSATSQPAQSSSSAS
FT                   QPCQTAPATQESTQSAPTTVESAVPCTGGNAGPSTTEIVAPKSSDRSVCGTLTTTVIVT
FT                   TCPVRTDGPSATAGPASTAGSTASVSGGASSIADKTAAAAAVPTDTISRYTKGTTAQTA
FT                   STSTGSLSSSTGSRYTKATAHPAPSGKFSLGNPGSNSSPLSYFTGAAGRLHGSGTSLGS
FT                   IVALFLSMLFLC"
FT   CDS_pept        complement(270537..273344)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762528"
FT                   /locus_tag="AGOS_AFL092C"
FT                   /product="AFL092Cp"
FT                   /biological_process="flocculation"
FT                   /protein_id="AAS53280.2"
FT                   /db_xref="GO:0000128"
FT                   /db_xref="HOGENOM:HBG059295"
FT                   /db_xref="InterPro:IPR001389"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="UniParc:UPI0001DB2C23"
FT                   /db_xref="UniProtKB/TrEMBL:Q755B7"
FT                   /transl_table=1
FT                   /translation="MRTSLSVLALAAVAAAHEDVLQACDPLRGGASARPGFDLTIWNYP
FT                   WTSYNHQTNRGVPDRTTFESAAYLQGGYAQYEELGRARAVTNLTFVNEFELGRGREMVR
FT                   GRLPPNYNFPDEFNISNFAYLATGYFRAEQDGAYNFTLDFVDDYASVALGGGRAFDCCQ
FT                   KDTGVKSPEGFQIDARWARNGPVGRAWTVVNLQRGAYYPLRVFYVNTNNWAGIRFTFTD
FT                   PSGVHHEDFQNHIFHFDDQPNECPEIVATTTQPYDGTETVTAYTTLSTYTNSDNQLTTG
FT                   RVVVINTPYPRGETTTTNGWTGSYTTTLSTGVATVTGTDGYGTIETTYYVVTPEAVVST
FT                   TTTSGWTGTHTTTLSTGLTTVTGPDGIATTETTYYVVTPEAQAVTTTTSGWTGSFTTTM
FT                   STGVTTVTGSDGIATTETIYHVVTPEAQAVTTTTRGWAGNHTTTLSTAVATVTGTDGIA
FT                   TTETIYHVVTPEAQAVTTTTRGWAGNHTTTLSTAVATVTGTDGIATTETIYHVVTPEAL
FT                   SVTKTAIFSSGSSWQNVTAEATKSSSFDGRVNQTIDSVAGTHTQISESLTTVTSSAPTE
FT                   DVCASLEQETVTVILSPMTTMTIPTTGAPQVMTIVKTVYSTITKDYSEDMSESPFEPTT
FT                   VSAPTNSAQVSSTNGPDTQQRISVDELAGGKLATTMNSSAANVSSQFLENTIVPPTSEV
FT                   YTSGSSRSFSLGNTDEMVTILPIGGASGISGISIGNVSTEPSTVQSSFIAVSTGSAEYL
FT                   TGTSEQPVTATPSTKSSVKASSFQSETKEDTNIPISVTSISYSSSGTQASRTSTAEYGT
FT                   AAVTGIPESSGGPANDNETASEEAETELPEESYGQEPSAGSNVATTEDEEDAYGTTVVE
FT                   EYPLPTPQTAFTGSGFVSSAGVVSSSFPNLTKPLLPFFGGAVQLNTNMNKICSALVFVV
FT                   TTLLL"
FT   CDS_pept        273862..275298
FT                   /codon_start=1
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625570"
FT                   /locus_tag="AFL091W"
FT                   /orf_name="AGOS_AFL091W"
FT                   /product="AFL091Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53281.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252FB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q755B6"
FT                   /transl_table=1
FT                   /translation="MDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTK
FT                   HPQLDYESRVYKYLSGGIGIPFIRWFGREGDYNAMVIDLLGPSLEDLFNYCHRKFSLKT
FT                   VMMLALQMICRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKFRDFRTHN
FT                   HIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKR
FT                   QKYDRIMEKKLCISVEQLCVGLPIEFVEYMRYCRNLRFDERPDYMYVARLFKDLSIKLE
FT                   YHNDHLFDWTMLRYTKAMIDKQSQAAETQHQSQQQAQEPANGDSDTDSKNASFMKVKKL
FT                   AMMKFPSHFHYWKPTDTHHPSPEEIKHQTVQNTQIVSTIPDEVLSEIDKNMEALKQEAE
FT                   QGRARPGNALPQQSNGAVVTLLEQQQAQEQGQQEQQLQQQQQQQHHHPQTQVTPAQAQS
FT                   PQAQPPAKPDGNAGGAGIWL"
FT   CDS_pept        275767..276807
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762529"
FT                   /locus_tag="AFL090W"
FT                   /orf_name="AGOS_AFL090W"
FT                   /product="AFL090Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53282.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1APM"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252FB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q755B5"
FT                   /transl_table=1
FT                   /translation="MEIMEQELCVAEEARRRSMLPQRSTVSKGKYSLQDFQIMRTLGTG
FT                   SFGRVHLVRSIHNGRYYAIKVLKKQQVIRMKQIEHTNDERRMLKVVEHPFLIRMWGTFQ
FT                   DARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHAHNIIYRDLKPE
FT                   NILLDRNGHIKITDFGFAKEVDTVTWTLCGTPDYIAPEVITTKPYNKSIDWWSLGILIF
FT                   EMLAGYTPFYDVTPIKTYEKILAGKVVFPPFFHPDAIDLLGKLITDDLTRRLGNLQSGS
FT                   QDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQYPEEHLDYGVQGDDPYA
FT                   SYFVDF"
FT   CDS_pept        complement(276890..277390)
FT                   /codon_start=1
FT                   /gene_family="HOG000248814" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762530"
FT                   /locus_tag="AFL089C"
FT                   /orf_name="AGOS_AFL089C"
FT                   /product="AFL089Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS53283.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG313694"
FT                   /db_xref="HOGENOM:HBG746222"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR015607"
FT                   /db_xref="UniParc:UPI0000252FB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q755B4"
FT                   /transl_table=1
FT                   /translation="MLRQVSRSARVVLRYGTAGRQAVRLNSTSAGAVDPKIAQIVEQIS
FT                   TLTLLETSALIGELKTRLNIPDIAMAVGGAAAPAAPAAPEAAAEEEVKEEKTIFAVKLE
FT                   AFDAKSKPKVIKEVKNLLGLSLVEAKKFVEAAPKVLRENVAKEEAEKVKASLEALGAKV
FT                   VLE"
FT   CDS_pept        277606..277974
FT                   /codon_start=1
FT                   /gene_family="HOG000228134" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762531"
FT                   /gene_name="RPB9"
FT                   /locus_tag="AFL088W"
FT                   /product="DNA-directed RNA polymerase II subunit RPB9 "
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53284.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG067622"
FT                   /db_xref="HOGENOM:HBG717463"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="UniParc:UPI0000252FB5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755B3"
FT                   /transl_table=1
FT                   /translation="MTTFRFCRDCNNMLYPREDKEEQRLLFECRTCTYAEEAGTPLVYR
FT                   HELITNIGETAGVVQDIGSDPTLPRSDRECPRCHSHDNVFFQSQQRRRDTSMVLFFVCL
FT                   GCSHIFTSDQKNKRTTFS"
FT   CDS_pept        complement(277997..279355)
FT                   /codon_start=1
FT                   /gene_family="HOG000144389" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082468"
FT                   /locus_tag="AFL087C"
FT                   /orf_name="AGOS_AFL087C"
FT                   /product="AFL087Cp"
FT                   /protein_id="AAS53285.1"
FT                   /db_xref="HOGENOM:HBG059296"
FT                   /db_xref="InterPro:IPR014842"
FT                   /db_xref="UniParc:UPI0000252FB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q755B2"
FT                   /transl_table=1
FT                   /translation="MEYSQDAWGKQSPLDASPSAWSVSETAGDVPSGASATTASGHNVE
FT                   GSGARSSPYSEASYNNVLSDQAIERIRRQQNQNKLIHLEPIPDFKDKNDIKPWLQKIFY
FT                   PQGIEIVIERSDKIKVVFKCKASKRTKSGSAPGSQAGAAEDELGGQYETLPLSPVVTAS
FT                   QLRKKKRAVSPYNTCPFRVRAAYSLKRKRWSIVVVNNGHSHPLKFNPDSAEYRKFKNNL
FT                   RQECDWDAVKKFDELEYRSKFNLPTEPTPIPCDCGLTQEIESFNVILPSTNILGSSAPV
FT                   FTEKKTVSKPRCRKTLQRDRCSQLRRQSTQSKLTHELHTALSPTLGSSADTLGSPVRYA
FT                   AQDAEVDFTEVFLRSLPPAKPLHSARAPDAARDSWHALEQLLDDPADAPPRTPLPSASA
FT                   DCVNPLLHFAQRPADDPVDSLAYELNALSAMDSPFARPAPDAQFLWEDPKYFP"
FT   CDS_pept        279672..281033
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625571"
FT                   /locus_tag="AGOS_AFL086W"
FT                   /product="AFL086Wp"
FT                   /protein_id="AAS53286.2"
FT                   /db_xref="HOGENOM:HBG059297"
FT                   /db_xref="UniParc:UPI0001DB2C24"
FT                   /db_xref="UniProtKB/TrEMBL:Q755B1"
FT                   /transl_table=1
FT                   /translation="MYAALFQAEAFAAAAVEQVEPGLHHGHVGHVCDPELVCNVGATER
FT                   SPVPAVVVLVQVEQRAVRVLAEHEELAQRGPLHEARLLARDHGEPMLARVVAQHARGGA
FT                   HEHHAVVGAPGHARDGVVVARSAHGQGAERGRAHGPAVEVHVRAVRDAEKLAVAAERRA
FT                   GDAGRQLERVARGRRAPRAEVIHRRVRAAQRDEPRRLVVPHVVHRVRPELHVGRAPRAQ
FT                   VHAQEPPAVRARHERVRARRHHARDLLRAEPQKTEVRHARRLAPVRDQAPPPVRAPQAP
FT                   ARACAVARAHRAVAHRARAPQRPHVAHHLLVEHTAPARGRRWRRPRHLALVRSQLACHE
FT                   QRCRNAHLCPFRSLPLCVCYTLPYIPARRNVCYYPRENIHPMRTAELAGNLEPRLCRSY
FT                   GETAKIAQLLISGAVVHGRRNAAHAQVRFFSVAGPGRAGRRRPDFVHGRPRWLW"
FT   CDS_pept        complement(281143..282963)
FT                   /codon_start=1
FT                   /gene_family="HOG000184677" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082469"
FT                   /locus_tag="AGOS_AFL085C"
FT                   /product="AFL085Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53287.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG059298"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001DB2C33"
FT                   /db_xref="UniProtKB/TrEMBL:Q755B0"
FT                   /transl_table=1
FT                   /translation="MLTRPIDLMNGEATHGGGDSGGATTRLRAAPDAPDGDDAGAGGGG
FT                   AGGDRRGGGSAATALEDAGGVVEDIVNPALDAGALPHMLAEEDDAVSTMMMPFSPLLPH
FT                   HLPLNSSTAGAGDHIVRRGTPVGVYGSATPELAGEHGSQLHSGLLSYNLRSSKLLTQKP
FT                   SLVGRGPSKAGSSPPQLGGMPKKKLAAAKTKPAFVNKLWSMVNDPVNQSLIHWSHDGKS
FT                   FIVTQREQFVHEILPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSIQSNSDDRWEFANE
FT                   NFLRGREDLLANIIRQKSSAGSRDGAGMSVGAAHPNAVLVANGEEVDLGILFSELETVK
FT                   YNQLAIAEDLKRISKDNELLWKENMLARERHQNQQQALEKIVKFLSSLYGSNTTRLLSD
FT                   HVFREPQQAVAAPQGYGVHSTASMSPLHMADPLDAAPSPDVTATPVHRPRLLLKQRASP
FT                   ASDWPAQVQELRTSQVPSPVLQPLPARIHEIHPDAQLPADTPVLSPAVVDQASFFNDLQ
FT                   DNLDKQGESIQEIQDWIDKLSPASPFSRFDPRDYLAAPGFPAPPPDAADPISPRPAYKR
FT                   PSNHREETRSEDYSPASKKQRQLSARDPPT"
FT   CDS_pept        283597..284613
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625572"
FT                   /locus_tag="AGOS_AFL084W"
FT                   /product="AFL084Wp"
FT                   /protein_id="AAS53288.2"
FT                   /db_xref="HOGENOM:HBG059299"
FT                   /db_xref="UniParc:UPI0001DB2C34"
FT                   /db_xref="UniProtKB/TrEMBL:Q755A9"
FT                   /transl_table=1
FT                   /translation="MWREEAREQLRRGRCCFAAASVVSTAKHNKSLGNCTHGSGVMTEA
FT                   EGILNNVWDAVDSKQQGFIYAKDMPDLVGRFGQFLAQSLTSRANDEAIAAFASEKPFYK
FT                   LDKEQFKSTFQTLVGTSLQTAVELAGHGEPRPRLFGAIRRASATGDEQAREELERKSAE
FT                   LSRVRDELDEWKSKYQFLEREFLFYQTHHENSVDSTQHEFIISEMKRTIEEQTRMIGQL
FT                   RRQVQGGTQVLARAGKRASPVDVFMYVSRQGLLLLMRMPKAAFLLLLLGYFVWYTVMGG
FT                   AVQGPDPSVALPEPPKQPWWEQNNIISALYWYLTDTFEPSQRINDTVNDNYNSLFGL"
FT   CDS_pept        complement(284734..285495)
FT                   /codon_start=1
FT                   /gene_family="HOG000205925" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762532"
FT                   /locus_tag="AFL083C"
FT                   /orf_name="AGOS_AFL083C"
FT                   /product="AFL083Cp"
FT                   /protein_id="AAS53289.1"
FT                   /db_xref="HOGENOM:HBG059300"
FT                   /db_xref="HOGENOM:HBG756721"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR013899"
FT                   /db_xref="UniParc:UPI0000252FBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q755A8"
FT                   /transl_table=1
FT                   /translation="MSVVLDRGAFLSQDRDYNHATDGEYKRLRDLADQAFKKRAELSHQ
FT                   SQQAYKQGDGARAKELSEQAKRQLEAAERYNMQAAEYVFTSNNADSGSDEIDLHGLYVK
FT                   EAQWIMKKRIAAGVQSGEPRLRVIVGKGLHSANGVAKIRPAVEELCSEAGLRSYVDSKN
FT                   AGVLIVDLENANVPASWDTTPYSGQLQPSKPPAAHTGGQPQAGYQAPAQPQYQQQPAAG
FT                   QAPGQGAQNGPENPLVAALLTFFCQTICKLK"
FT   ncRNA           285797..285852
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR39b"
FT                   /product="AgSNR39b"
FT   CDS_pept        join(286109..286116,286384..286477,286692..287321)
FT                   /codon_start=1
FT                   /gene_family="HOG000170917" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762533"
FT                   /gene_name="RPL7"
FT                   /locus_tag="AFL082W"
FT                   /product="60S ribosomal protein L7 "
FT                   /function="structural constituent of ribosome"
FT                   /function="transcription regulator activity"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="AAS53290.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG359947"
FT                   /db_xref="HOGENOM:HBG618766"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="UniParc:UPI0000252FBB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755A7"
FT                   /transl_table=1
FT                   /translation="MADKILTPESQLKKSKAQQKSAEQVAAERAARKAANKEKRAAILE
FT                   RNAAYHKEYETAERAVIQAKREAKANGSYYVESQPKLVFVIRIKGINKIAPKPRKVLQL
FT                   LRLNQINSGVFVKVTKATTELLRLVEPYVAYGYPSYSTIRQLVYKRGYGKINKQRIALS
FT                   ENSIVEANLGKYGIISVDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKHF
FT                   IQGGAFGNREEFINKLVKSMN"
FT   ncRNA           286556..286630
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR3959"
FT                   /product="AgSNR39_59"
FT   CDS_pept        287773..289401
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082470"
FT                   /locus_tag="AFL081W"
FT                   /orf_name="AGOS_AFL081W"
FT                   /product="AFL081Wp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53291.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004756"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000252FBC"
FT                   /db_xref="UniProtKB/TrEMBL:Q755A6"
FT                   /transl_table=1
FT                   /translation="MSLAERDSMDLVKRHPSGQCCEDGEKSNVGMTTCQVDEGQLLRKS
FT                   FSLWSVLGVGFGLTNSWFGISVSMITGIGSGGPMMIVYGIVIIALVSVCVGVSLAELSS
FT                   AYPHAGGQFWWSLKLAPPKHRRLAAYLCGSLAWAGSVFTSASTTLSAATELVGMYALVR
FT                   PEFVVRKWHVFVCYQILHCFLMLFNCYGRSLPLVSSSALYVSLFSFVTITITVVACSRG
FT                   HFNDPKFVFATFRNETGWQNSAIAFIVGLINPAWSFSCLDCATHMAFEVEQPERVIPIA
FT                   ILGTVAIGFLTSFCYVIAMFFSLRDLSEIMTSNTGVPILDIYYQALGSRAGALVLGSLV
FT                   LLTSVGCIISSHTWQARLCWSFARDGGLPYSHLWARVNRSVGVPLNAHLMSCVCISLLG
FT                   ILYMASSTAFNSLITGCIAFLLLSYIVPVICLLLKKRQIKHGPFWLGPFGAFCNYVLLA
FT                   WTVFVLIFFSLPPLKPVTKDNMNYVSVVVVGYILYVLIFWRLQGRWSFHLVEEEEECTE
FT                   LEGEPQMTPEGSEEREMIPTTKISP"
FT   CDS_pept        289639..291246
FT                   /codon_start=1
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762534"
FT                   /gene_name="DBP3"
FT                   /locus_tag="AFL080W"
FT                   /product="ATP-dependent RNA helicase DBP3 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS53292.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000252FBD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755A5"
FT                   /transl_table=1
FT                   /translation="MSKHELKDKKRKSVDGEDVSKSKKVKKDKKDKKDKKAKDGNDKVK
FT                   DKKDKNKKDKSKTDKNLKEVQETEAHTGSETAPVGDSTAAAGYVESKELASVPQADVDT
FT                   FFSENEVAVEDPESLGFRPLLSFSHLNLHSAIQKEISKFPKPTPIQAVSWPYLLAGKDV
FT                   IGVAETGSGKTFAFGVPAINSLMSEKSTPRGVKCLVISPTRELASQIYDNLVQLTDKVG
FT                   LNCCCVYGGVQKDSQREQLKKAQVVVATPGRLLDLIEEGSAKLAGVQYLVLDEADRMLE
FT                   KGFEEDIKRIIKETKSDVRQTLMFTATWPKEVRELASTFMRAPVKVSIGNRDELSANKR
FT                   ITQVVEVIDPFKKEKRLLELLKQYQSGAKKNDKVLIFALYKKEASRVERNLKYNGYNVA
FT                   AIHGDLSQQQRTQALSEFKAGTANLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHR
FT                   IGRTGRAGATGVAHTLFTEQEKHLAGALVNVLNGAGQPVPEELMKFGTHTKRKEHNAYG
FT                   AFYKNVDLTKKAKKITFD"
FT   CDS_pept        291568..293184
FT                   /codon_start=1
FT                   /gene_family="HOG000184828" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625573"
FT                   /locus_tag="AFL079W"
FT                   /orf_name="AGOS_AFL079W"
FT                   /product="AFL079Wp"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with oxidation of a pair of donors resulting in the
FT                   reduction of molecular oxygen to two molecules of water "
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS53293.1"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016717"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052500"
FT                   /db_xref="HOGENOM:HBG325617"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="UniParc:UPI0000252FBE"
FT                   /db_xref="UniProtKB/TrEMBL:Q755A4"
FT                   /transl_table=1
FT                   /translation="MAVLSKSEVEERIANGEVIVIYKSAVLKLDKWIKYHPGGDKAIYH
FT                   MVGRDATDEMNAYHSDESVQQFMRWKIGHVEGEWKNLVPPIQRNACETSMQPGTPGDED
FT                   TCYEDDACDAKVETMGQAYKNHVVVDPMQLSELFDEERAALDRKLFPSADSETQQRISA
FT                   EYNKLHQELIDAGFYACPYWKYGVELLRISTLLGASYFTLIRLNWQIVSALLLGVAWQQ
FT                   AVFIAHDAGHISITHNYQVDSVFGMLVSAWFGGLSLGWWKRNHNVHHLVTNDPEHDPDI
FT                   QHLPFFAVTSRLFTGLKSTYYERDLAFDLPARIFIPLQHILYYPILAFGRFNLYVLSWT
FT                   HLLGGKGPRHGQAAWFRYFELCGLVFFCYWFCYRLLACSLSTATDRVLYVLVSHLTTMI
FT                   VHVQITLSHFAMSTADLGVSESFPQRQLRTSMDVACPRWLDFFHGGLQFQVIHHLFPRL
FT                   PRHNLRDAQPYLLRFCERVGIKYSIYGFSHCNSMVLSHLEQIAQQARTVLACAHTMGPH
FT                   KDVAMPAPGGDSRQYSNPKHA"
FT   CDS_pept        293366..294079
FT                   /codon_start=1
FT                   /gene_family="HOG000195803" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762535"
FT                   /gene_name="OXR1"
FT                   /locus_tag="AFL078W"
FT                   /product="Oxidation resistance protein 1 "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS53294.2"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG192656"
FT                   /db_xref="HOGENOM:HBG748961"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniParc:UPI0001DB2C35"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755A3"
FT                   /transl_table=1
FT                   /translation="MDGWRSRFKRLHRTLSVGEEQCTPAIKLNSPDATLQTEACAPEDE
FT                   GGLPPVQLCGYLSSTRDRLLTAELCAELRPLMPSRIQLYTKWCLLYSLEQHGASLHSLY
FT                   EHVRPEEPAKARVGYLLIMRDRRGGLFGAYANEPFRPTESRRYSGNGECFLWSADLHPM
FT                   LRLRAYPYTGLNEFCIYCTSGFLSMGAGSGHYGLWCDEGLVHGVSERSPTFGNDALSRE
FT                   GPRFHIVALEVWRVG"
FT   CDS_pept        complement(294119..294691)
FT                   /codon_start=1
FT                   /gene_family="HOG000000928" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082471"
FT                   /locus_tag="AFL077C"
FT                   /orf_name="AGOS_AFL077C"
FT                   /product="AFL077Cp"
FT                   /protein_id="AAS53295.1"
FT                   /db_xref="HOGENOM:HBG059301"
FT                   /db_xref="HOGENOM:HBG104221"
FT                   /db_xref="InterPro:IPR019371"
FT                   /db_xref="UniParc:UPI0000252FC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q755A2"
FT                   /transl_table=1
FT                   /translation="MSDDVDSETRSRTPSISSRQFIIPEDELATLDSENSSLDSGGEEA
FT                   SSGGSDAYSAAGGSTPVFSRLGQHPSTFFTGSQVAPIFDTSLYLFESLTQSLDSVDFSE
FT                   ALSLQTKTSATINSKSRELQLLVGEVQTHLRRLQTAFEQGQHTAQRVRHNLRDITRGVE
FT                   SLKQTFARSYPIEYHQALERAYERRAE"
FT   CDS_pept        294832..297531
FT                   /codon_start=1
FT                   /gene_family="HOG000000981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762536"
FT                   /gene_name="APL5"
FT                   /locus_tag="AFL076W"
FT                   /product="AP-3 complex subunit delta "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus"
FT                   /cellular_component="clathrin coated vesicle membrane "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="AAS53296.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="GO:0030665"
FT                   /db_xref="HOGENOM:HBG114048"
FT                   /db_xref="HOGENOM:HBG739063"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017105"
FT                   /db_xref="UniParc:UPI0000252FC1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755A1"
FT                   /transl_table=1
FT                   /translation="MSSLYAPTDEVKRRLRPFGLFFEKSLKDLIKGIRSQQSPEQLHEF
FT                   LTRVLSECREEVKHADFNMKTNAVLKLTYLEMYGFDMSWANFHVLEVMSSTRFQQKRVG
FT                   YLAASQSFYKDHDILMLATNLLRKDLKYSLSNETVRMGVALSGLSAMVTPELARDICED
FT                   LFLMLHSTKPYIRKKAVTALFKVFLQYPEGLRDNFEKFVDRLEDDDLSVVSATVSVICE
FT                   LSKHNPQPFIQLSPILYQMLIKVDNNWVIIRLLKLFTNLAQIEPKLRVKILPNVLELMD
FT                   STTAISVVYESINCIVKGNMLNSDDYDSAVACLDKLHDFCTSNDPNLRYLSCVLFYKIG
FT                   KINTDFIANFDVLILRLLVDVDVSIRSKTLELLEGIVTEDNLVDFVQRLLKQFVDVDKI
FT                   CVNDQEFSIDIPEYYKSKMIHAICKITAMKNYANVTDFEWYIALLSDLCIVSQDLQDKT
FT                   LAQKLGEQIRNIMVKVPDLRDRTLAQIVQLVKSEDITARLPGVLKECIWCLGEYSSLLD
FT                   NKDEYILLLAENSKLYEPELQQTLIPAILKIYSNWCNESVVDTGRIKWVTERIITPLED
FT                   LIISKNFEVQERSSEALEFLRLCLDSLSEDASDSLPLLLTEVLPSFFNAFELQPITSGT
FT                   QRKLQQSISVDCDTPFLTESELEQLLADDTSVDGIVSPDVSDTESDSEMYVPGAAPKDK
FT                   GSSPTHELTTAELEAINERRKQERVGNPFYLDDADVGSVKKVDILDNLSNSKPSSSGSL
FT                   VRLSSESKAKEKKKKVKVRVISDAVIVDGVNTADVTDDRPSNTPSARNKIALQLKNKLD
FT                   SFDFTKPRDEGDYDPDVDLQKLREKFAQQRLLDESAAAEEEVVVVKKKKRSKDGSKSSK
FT                   KKSRSKSKPSSKGGDTAEAELLPGLTTE"
FT   CDS_pept        297725..299356
FT                   /codon_start=1
FT                   /gene_family="HOG000000982" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762537"
FT                   /gene_name="DDC1"
FT                   /locus_tag="AFL075W"
FT                   /product="DNA damage checkpoint protein 1 "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53297.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG059302"
FT                   /db_xref="HOGENOM:HBG104220"
FT                   /db_xref="InterPro:IPR007268"
FT                   /db_xref="UniParc:UPI0000252FC2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755A0"
FT                   /transl_table=1
FT                   /translation="MSFRAVITSSEHQAVWSRLILTLSTINQDIKFTIMSNELILWSMN
FT                   STDTTMYQVRLKASFFSEFSFDPGNIVFGEEGLQVIEDLQKQQHTLYSFVINGRHLSIL
FT                   SRKPEYDNIKEFSLSIDNSTAAPEAIINRLHIRVYTESLITKEFSPAFNPVKYDPIVID
FT                   LKYKKKFLDVYGTEESVNGEQADPRLLDFFRQVRKQLEEAKFNEGIIDAPRPAELRSEH
FT                   EINFLSMDSLIWRNAIDLCTNNTEELKLDLTMNKMVITAFTKGVQNMKSSDVLKQAISI
FT                   SNSVSTEDVEHYCLFTTSGNPGMSKKDADSKQAVFKLRDFRNFFSANQAWKENATVNCW
FT                   FCSPGDPILFEIDRGHVKLSLVQITDTAGKAVGAAPDLAIHPVLVSPRKPVSPLRAACT
FT                   NTNAASNALHGVQLDAANMDAIKTLFVQDVEIGVSAAAMAHSPANRCTDENLRSMCSIS
FT                   QQGQHSCDGSPATNLRRVSRAGTTIAWGAGKDHVMCPDSDYGVAQDVNQLKRRKVGELA
FT                   HASQSPESQDYGLGPTQQYQPKGIFD"
FT   CDS_pept        complement(299448..299813)
FT                   /codon_start=1
FT                   /gene_family="HOG000188911" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762538"
FT                   /locus_tag="AFL074C"
FT                   /orf_name="AGOS_AFL074C"
FT                   /product="AFL074Cp"
FT                   /protein_id="AAS53298.1"
FT                   /db_xref="HOGENOM:HBG335382"
FT                   /db_xref="HOGENOM:HBG627499"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniParc:UPI0000252FC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Z9"
FT                   /transl_table=1
FT                   /translation="MSQPVQRAAAQSLISKYVNKETLKYMLTTHFWGPVSNFGIPIAAI
FT                   YDLKKDPELISGPMTLALVVYSGIFMRYSMAVTPKNYLLFGCHFINESAQLGQAFRWLK
FT                   FNYFGEKPAVKGTEKTA"
FT   CDS_pept        300152..301159
FT                   /codon_start=1
FT                   /gene_family="HOG000000983" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082472"
FT                   /locus_tag="AFL073W"
FT                   /orf_name="AGOS_AFL073W"
FT                   /product="AFL073Wp"
FT                   /protein_id="AAS53299.1"
FT                   /db_xref="HOGENOM:HBG059303"
FT                   /db_xref="InterPro:IPR019496"
FT                   /db_xref="UniParc:UPI0000252FC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Z8"
FT                   /transl_table=1
FT                   /translation="MQNTSGNLPKPTFSGTLDGPSTQRTRPWEQGSEQPYATQSYAAPF
FT                   PQQAPGYSNASLPLYGGASAAYAGQWQQPVLYTAQPYYQPPPPAGAPHLLPLEPYQTSV
FT                   VGGRKPDARRGGARQAAGRVRKAPRAAYSGEKRKASHGGAQGTTVTQAEGSGDEGDEQA
FT                   ETGSEAGPTVDGAIAGTSIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEELGVSEQE
FT                   LRCSPLVQGRKDKKFISGIQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFIKELGDAN
FT                   LLEHVLTEKEKEALFGKAMRAAENRKQFAGRSFTSQNDGRGRPPTRQPAGGPTN"
FT   CDS_pept        complement(301212..301571)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059107"
FT                   /locus_tag="AGOS_AFL072CA"
FT                   /product="AFL072C-Ap"
FT                   /protein_id="ADJ41786.1"
FT                   /db_xref="UniParc:UPI0001DB2C36"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGF6"
FT                   /transl_table=1
FT                   /translation="MVDEPDTPPPQGVDALADPEVTLVHSRPQLQESKETRLDLLAEQN
FT                   WETLEKITYVAPEKRPRVKGRIKKPSRRKKSKRRKSRHHQEQQQPASQDGLFHGLLLGS
FT                   FIGAALAEFVLAKFK"
FT   CDS_pept        complement(301898..302842)
FT                   /codon_start=1
FT                   /gene_family="HOG000144388" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762539"
FT                   /locus_tag="AFL072C"
FT                   /orf_name="AGOS_AFL072C"
FT                   /product="AFL072Cp"
FT                   /protein_id="AAS53300.1"
FT                   /db_xref="HOGENOM:HBG059304"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="UniParc:UPI0000252FC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Y3"
FT                   /transl_table=1
FT                   /translation="MEHFGSHEQRRLIFNINEGLAEVIGRASERDAERVARADNLFFAE
FT                   RSLSKQHAMLYVKRFTGPGGAQDGDEENIRIWVEDLGSTHGLVDLQSTARGVSQLIDLK
FT                   NGERFGVVYMDKPITSTQSRGARLKFQVNVMQKQGPLWELLVRDVTFGDSPCITKGSPL
FT                   DGTDGSLTPYHTEPSSDWSYSEMWCGEDMCRIPSDVECSHHAHQKERNMLQSNYVDLLQ
FT                   HQEELGVPSSAAESDFGSLDEPVKLLDEYEKGRPLLPEELHAGQQLGPSVGARAPRGEK
FT                   HQRARTIWSARSILFGTLFGFVIGFIFGAANLD"
FT   CDS_pept        complement(303114..304208)
FT                   /codon_start=1
FT                   /gene_family="HOG000000927" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762540"
FT                   /locus_tag="AGOS_AFL071C"
FT                   /product="AFL071Cp"
FT                   /protein_id="AAS53301.2"
FT                   /db_xref="HOGENOM:HBG494130"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="UniParc:UPI0001DB2C37"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Y2"
FT                   /transl_table=1
FT                   /translation="MSLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAE
FT                   TTSQLRNLAQAPTVTLRDLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPAFN
FT                   GTFREGDEMALFRMFQVGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGS
FT                   VASEKADQLLQDAHILRSFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQ
FT                   EGELFILVTDLGYQYRHDIVWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDTAAGED
FT                   PFADKNATFSAPSLPPDSAFLTDEELARHLQQEEDGLYVRSLQRQQERSHRRPAPDPPA
FT                   RNASRASRTKTKSKNTKRKICIIM"
FT   CDS_pept        complement(304701..306974)
FT                   /codon_start=1
FT                   /gene_family="HOG000113718" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762541"
FT                   /locus_tag="AFL070C"
FT                   /orf_name="AGOS_AFL070C"
FT                   /product="AFL070Cp"
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="translation"
FT                   /protein_id="AAS53302.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059305"
FT                   /db_xref="HOGENOM:HBG204043"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000252FC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Y1"
FT                   /transl_table=1
FT                   /translation="MSEDNDKLKAIMDALKKSQDFASDGAESDDKQDAAKEELGAESNS
FT                   EEDSNGSDLYREEETESAGEPMEAVIAAEDGLSVEEDEVSGLGGVEDSSENREDYDPLK
FT                   DDADDATRASDSGDDDMAATEKGREDTAVVVVPENDEKENKEGSSDGRRRDSKSGEEQE
FT                   VALQSREAVGSGGKEDDRVCNENIDRDLLQRQVQYVLDSDMLSLPEFQELSSREKVVAI
FT                   VTLLNSNGDTSMPSKGSSTGVSEAIKRRRFPPPDMSQAMTPEERQRYTEYLRGENRITE
FT                   IEHFPPKSRLFIGNLPLKNVTKEDLFRIFSPYGHIFQINIKNAFGFIQYDNAQSVKDAI
FT                   ECESGTMNFGKKLILEVSSSNSRPQFDHGDHGTNSSSTFVTSSKRPFDEQGEEEDMYSD
FT                   NHYKKTKKRIPQCMILVKRTADRSYANEVFNIFRNGSGLETDMVFLKPRMELRKLINDA
FT                   AYDGVWGVILVNKTRNVDIQTFYKGPQGETKFDEYVSVSCEDSIAIFNNLKTTRAGRTG
FT                   SISPPVQQRAKLPPQQQQQPPPPPRQQQYYAGYAMPPQQPPYVAQPSIYGAINPASQPP
FT                   PPQRQQQQYASMQPYGAFPAQQLPIAAPPTHATAPMDQSQLLAAIQHLPQNVLSSLLSM
FT                   TQQQPNQQQQQQQLLGLIQQLQSGQQPQLQQPLPSNVGAPYAAFGSPPQNANMLAGSPP
FT                   PMPPQQQIPQPQQHQPPQPPQPQPPQPQPQPPHQKQPSVPQVQPQQAGSNVQSLLDSLA
FT                   QLQK"
FT   CDS_pept        complement(307397..307573)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762542"
FT                   /locus_tag="AFL069C"
FT                   /orf_name="AGOS_AFL069C"
FT                   /product="AFL069Cp"
FT                   /protein_id="AAS53303.1"
FT                   /db_xref="HOGENOM:HBG059306"
FT                   /db_xref="UniParc:UPI0000252FC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Y0"
FT                   /transl_table=1
FT                   /translation="MHLKAATRNRVTNKLFVTTFLVAFSSVALGSVLPCPAHSLDSDTP
FT                   VRERNEGARAAQE"
FT   CDS_pept        complement(307843..310185)
FT                   /codon_start=1
FT                   /gene_family="HOG000141821" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762543"
FT                   /locus_tag="AFL068C"
FT                   /orf_name="AGOS_AFL068C"
FT                   /product="AFL068Cp"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53304.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG059307"
FT                   /db_xref="HOGENOM:HBG204299"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252FC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Z4"
FT                   /transl_table=1
FT                   /translation="MGLWSTRSGISVNYSYSSSPTFTAEPWSVHTGRPRSSSSGSSRVS
FT                   VFIFDKRKFENYLLNYGVIQSRSSSADRQLISDAYDILRTQVNNMAKLKHPMLLGLVAP
FT                   LEEHSKSFMFVTEYVSGCLLSIYQGHDSDQDLFSTESQDIIIQRGILQISHGLDFIHNT
FT                   ASSVHLDLNPRTVFVNEHSDWKVFGLGHLFKLAAGTNTAEYFMPQYDSRVPSFMQLDLN
FT                   YTAPEIVFENTVSPRSDYFSLGALVYFLYYGRNLFNCDNSTSNYRDEYSRFERKLSQMS
FT                   WESIFSKLPDKVRATIPRLMSRDLYARYEDINEFIASEFFEDPLIKTLVFLDDLPTKST
FT                   EEKTVFLNGLAKLLPKFPAQLLQRKFLTALLQLLDQSSSSNEINSECLSQTLHIIIQIG
FT                   RSLSQLTFNEKVAPYLTSKHNFDILLKNASMCLISNLETLKEKLKSEVFCEQMLKPLFA
FT                   HALSSANDSAVELQCSALSKLHVALETLDFTSAKRSFFPLITELFVRTTSLTVKVSCIS
FT                   SFLEMVKRRSIDKFTVLEELLPLVRSMKTRDSRVLVKFLDLFRVLPDFIQDDEAFVQSI
FT                   LPIMWTFSMSKTLSPAQYSEFTEVLNNITQQIQRSHLQALHKNESHQKKTSNFSKVIEK
FT                   PASPPVEQPPAVATPVLQPKKPARPANKYNLLAKPNGGYGTASSADKPTAKPSGGYGVA
FT                   SSTDKPAVKPLTLSKGMPLGTRRARGSPRIPQPAPQVPEDDFDAFVSSSEHKPSPPKPS
FT                   AAALPPGFSASLLQPSKRSSTPAAPGT"
FT   tRNA            complement(310402..310472)
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        310646..312382
FT                   /codon_start=1
FT                   /gene_family="HOG000182736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762544"
FT                   /locus_tag="AGOS_AFL067W"
FT                   /product="AFL067Wp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53305.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG356915"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniParc:UPI0001DB2C38"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Z3"
FT                   /transl_table=1
FT                   /translation="MLHSLWDATLTCVSRLFSLEALDARLAPSNDPKIRQRITMQATPS
FT                   RWKTAEFKFYYAVFAIAVPLMFKAAVDATNAWNPNYKKIEPLLDQGWLFGRKVDNSDSQ
FT                   YGFFRGNFALLFALAAGHLLTKRVALMLFPIQKLTFDLYFGLFFIVVAHGVNTFRVLIH
FT                   VVIMFAIARILRNQRKAATILCWVYGIGTLFFNSKYDTYPFGDVLPFLSFLDTAYKGLI
FT                   KRWDVFYNFTLLRILSHNLDYLEKWSDEPQQEASRSVSPSQEFDTFKDGKCPELLDERS
FT                   RLTAPHPISDYNMANYLAYVAYTPLYIAGPILTFNDYLYQTRRTLPSITPSRTFYYALN
FT                   FLCCIMTMEVVLHFIYVVAAAKAKAWEGDTPFQLSMIGLFNLNIIWLKLLIPWRFFRLW
FT                   ALIDGIDPPENMIRCVDNNYSTLAFWRAWHRSYNKWVVRYIYVPLGGSTNRILTSLAVF
FT                   SFVAIWHDIELKLLVWGWLIVLFLLPEIVASSVLSAYSNRVWFRFLCSVGAIVNIWMMM
FT                   IANLVGFCLGTDGTITLLKDMFSTVKGISFFIVANGALFVGTQTMFEQREHEKRQGIYV
FT                   KC"
FT   CDS_pept        complement(312428..313258)
FT                   /codon_start=1
FT                   /gene_family="HOG000212133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931093"
FT                   /locus_tag="AFL066C"
FT                   /orf_name="AGOS_AFL066C"
FT                   /product="AFL066Cp"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAS53306.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG059308"
FT                   /db_xref="HOGENOM:HBG329968"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="UniParc:UPI0000252FCB"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Z2"
FT                   /transl_table=1
FT                   /translation="MSDNSVATPAHLLQAKVIFLSFLLTGGFVATYSAFNRHLRQITSV
FT                   HDIPTNVFRRKYLYGKVTSVGDGDNFLFFHTPGGVLGGWHWLRKVPTLQRKGILPRRAQ
FT                   KATGNALSTLSPLNLFRGLVGLRSEGGGRDQFALYRGRRKLPTLSIRLCGVDAPERAHF
FT                   GNSSQPLSEEAYKWLNKTLLGRFVWVKPLSTDQYGRCVAKVEYWSWFRWKNVSIELLKQ
FT                   GLGVVYESKSGAEFDGQDTLYRYHESKAKKSKRGVWGLRHFETPGAYKKRINKQ"
FT   CDS_pept        complement(313433..315412)
FT                   /codon_start=1
FT                   /gene_family="HOG000113453" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762545"
FT                   /gene_name="MAD1"
FT                   /locus_tag="AFL065C"
FT                   /product="Spindle assembly checkpoint component MAD1 "
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53307.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG059309"
FT                   /db_xref="HOGENOM:HBG204298"
FT                   /db_xref="InterPro:IPR008672"
FT                   /db_xref="UniParc:UPI0001DB2C39"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754Z1"
FT                   /transl_table=1
FT                   /translation="MSQTGDSSSFVEEPASPEARQRELERQVLGLEYRLRTEHSEAEMA
FT                   RLALERELAGMQGKYKQCMGELEAALADTRYLYEQNAALEARARAADEDAGGAAAAERA
FT                   AAAEERARAAEARARELEEALQAARGEAAAAGRAAAGAAAGAAAAEQSGLLRKYEAEIE
FT                   RQMGELRALAERLAEREDEVAGLKAQRVLQAHRSYSAEEVEELGVLRRTLQEQLALSKE
FT                   LERANLEQANELKRLRQRSESQQFLQLENSKLRARLEKTDALRQQLDDLQLENVQLQEK
FT                   LTKWEVYQADGSSPENVLHEMALAKQERLALVEQVGKLQLDLNNMKILNDELALERNQL
FT                   LDLNKKYESSILNLKKLNYEIEQQKLLSFEECKLLRQQLDDLSEVDKDHTPDTRDRKKI
FT                   QTLVDTYKNQTEDLTNELKKLNEQLLERSDLDGNPRKRRKASDDLAFNYSQRLNELQLR
FT                   NKDLERRLANSDENASLLEEKLRKLQSLNEKKIRILQLRNNPLLKDQFVKQKQLTLLKQ
FT                   ENLELAQQLDAQQGLEAVPRSVYERQQYDIQLLEDELFSINKRTTRLKEMFNRKSLEFI
FT                   DAVNSLLGFKLEFQVGGKVKMIPCFKTDRYLIADLQTNTLKSNLDKVMPEWDAMLAEYV
FT                   GKRQQLPCFLAKIMLLLAESSSSQ"
FT   CDS_pept        join(315643..315653,315706..316111)
FT                   /codon_start=1
FT                   /gene_family="HOG000036561" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778132"
FT                   /locus_tag="AFL064W"
FT                   /orf_name="AGOS_AFL064W"
FT                   /product="AFL064Wp"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="AAS53308.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000252FCD"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Z0"
FT                   /transl_table=1
FT                   /translation="MSKVPRSFRLLEELEKGEKGMGPESCSYGLADGDDISMTHWNGTI
FT                   LGPPHSSHENRIYSVVIECGAEYPDRPPKVRFISRINLPCVDPSTGEVRPEAFHALRDW
FT                   KRSSNMETLLQDLRKEMASSANKKLPQPPEGSTF"
FT   CDS_pept        316245..317396
FT                   /codon_start=1
FT                   /gene_family="HOG000172029" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762546"
FT                   /locus_tag="AFL063W"
FT                   /orf_name="AGOS_AFL063W"
FT                   /product="AFL063Wp"
FT                   /function="NAD+ kinase activity"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53309.1"
FT                   /db_xref="GO:0003951"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG328966"
FT                   /db_xref="HOGENOM:HBG535922"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniParc:UPI0000252FCE"
FT                   /db_xref="UniProtKB/TrEMBL:Q754X9"
FT                   /transl_table=1
FT                   /translation="MKKLQVWRSVPRPWGARGYAGLPRAGAEVRAASALGVSRAPSFPC
FT                   VPGSRLRALVWPQAPANVFVVKKPGSAETTAAAIELIRHMHAQYPGLNVMVAADTAEEL
FT                   RAGLCAAAPGCVLYTGTDSEIAARADLLLSLGGDGTILRAAGLFSEARVPPVLAFSLGT
FT                   LGFLLPFEFSEHAQALDDVLQSRAHCLQRSRLVCRVLRDGLPVDGRWAHAMNDVFIHRG
FT                   GAPHLAHLDIYVGKQFLTSTVADGVAVATPTGSTAYSLSAGGSIVSPQVPSILLTPICP
FT                   RSLSFRPVILPSTSLLRLVIGAKSAQDPAAIKLCMSVDGVSKPPLSVGDELHVTDEVST
FT                   AHAPRDAGVYCVARSENDWTRGINELLGFNMGFRGGRRTHPPS"
FT   ncRNA           complement(317424..317647)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR10"
FT                   /product="AgSNR10"
FT   CDS_pept        318116..318463
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762547"
FT                   /locus_tag="AFL062W"
FT                   /orf_name="AGOS_AFL062W"
FT                   /product="AFL062Wp"
FT                   /function="mating pheromone activity"
FT                   /biological_process="mating"
FT                   /biological_process="pheromone-dependent signal
FT                   transduction involved in conjugation with cellular fusion "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="AAS53310.1"
FT                   /db_xref="GO:0000750"
FT                   /db_xref="GO:0000772"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007618"
FT                   /db_xref="HOGENOM:HBG059310"
FT                   /db_xref="InterPro:IPR008675"
FT                   /db_xref="InterPro:IPR016326"
FT                   /db_xref="UniParc:UPI0000252FCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q754X8"
FT                   /transl_table=1
FT                   /translation="MKISLLFSVSALLGAVIAIPVNGSRPEVTIDDVRGNIPEDAVLGF
FT                   LDLSDVEGLAVRPIQTEERTGLLFVNRQLAEKGTEAASSQGSPKLEKDIARVYKRLMEY
FT                   GHRRIFPAIDL"
FT   CDS_pept        complement(318880..320529)
FT                   /codon_start=1
FT                   /gene_family="HOG000248109" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625574"
FT                   /locus_tag="AGOS_AFL061C"
FT                   /product="AFL061Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS53311.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG059311"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001DB2C3A"
FT                   /db_xref="UniProtKB/TrEMBL:Q754X7"
FT                   /transl_table=1
FT                   /translation="MSYQEYQGLGFQHPSRMQSPLSETHSMTPTSDISISNRAQAWSDP
FT                   MYDQTWGTAGYGGNGAAYGLAQPPMGRYEASGLCSESSNGSGTVGESQAPPMGVLAQYA
FT                   QVSHPMTLQSGQMNNPRDFTSAPSRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEK
FT                   MCAFISFVEENSALLFHSDAILKRLNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNV
FT                   YIGKLNTNKDICAQWGVDPNEEVITEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIF
FT                   AAIKVVANLANINPYYAQKKIFYGKDRCAFITKTQQHNAAQFLGIQPGMESFFSNDREL
FT                   ISQTLLQQSAAAAAIATSAGGANNLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLL
FT                   SDRHVCFVTFIDPTAAAQFYAMSSLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGAS
FT                   RNIYLGNIDFAADKKSQHPIFTEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAI
FT                   LAIDKIKSIPTFKDLKINFGKDRCGNVPRQFC"
FT   CDS_pept        321263..322852
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762548"
FT                   /gene_name="NBP35"
FT                   /locus_tag="AFL060W"
FT                   /product="Cytosolic Fe-S cluster assembly factor NBP35 "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53312.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG411641"
FT                   /db_xref="HOGENOM:HBG586485"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="UniParc:UPI0001DB2C3B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754X6"
FT                   /transl_table=1
FT                   /translation="MSPNGAGLELADPGGAGGQQAGGGAAGGSELAREGVCVGVCGVEA
FT                   RAQLCGATAQRPGRRCVRGGREAWRDGLEQRQRRTRGPGGEAGLFEQPGAVAAEYGPVA
FT                   VEHGVGGVVCGGEEVEGGGVAQPARGRGRCERDAWRCDAERGELVAELCVGREGLAIGP
FT                   EGDRKPGGHGLRGGRCRRRALLRKPRRFAVAHHMQTSAEMGGIIEAMPALAQDGYALEQ
FT                   APPEHCPGPASENAGKGDACQGCANKDICESLPKGPDPDVALITQNLAPVRHKVLVLSG
FT                   KGGVGKSTFSAMLGWALSADEALQVGVMDLDICGPSLPHMLGCVNETVHESSVGWTPVY
FT                   VADNLAAMSIQFMLPEDDSAVIWRGAKKNALIKRFLKDVYWDELDYLVVDTPPGTSDEH
FT                   ITINTLLKESGIDGALVVTTPQEVALLDVRKELDFCRKAGIRVLGLVENMSGFVCPSCE
FT                   NESTIFKPTTGGGRALCEELGIKFLGAVPIDPRIGRCCDSGESFLDAYPDSPASTAIMH
FT                   VVEALRDAVGDV"
FT   CDS_pept        complement(322932..326888)
FT                   /codon_start=1
FT                   /gene_family="HOG000113874" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082473"
FT                   /locus_tag="AFL059C"
FT                   /orf_name="AGOS_AFL059C"
FT                   /product="AFL059Cp"
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="AAS53313.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG059312"
FT                   /db_xref="HOGENOM:HBG204295"
FT                   /db_xref="InterPro:IPR007230"
FT                   /db_xref="InterPro:IPR021967"
FT                   /db_xref="UniParc:UPI0000252FD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q754X5"
FT                   /transl_table=1
FT                   /translation="MFGAASGGNSLFGGANASTPTPTPAPAGNLFNFNKKPGEGFAGAG
FT                   QNNVSTPSPAGDLLGAKSTTTGGLFGPKTEQKPAGGLFGQSSAAPNGTGGGGLFASTGN
FT                   SGSTQLGGLFGNSAAGGGGSLFGAGSAANNNASTSLGNLFGKPNDTAPAAGGGLFSNRP
FT                   NTATTNTVSSTNSLFSNNQGNGAQNNGGLFGAKPTGGLFGNSTAQPQSSLFGASSSQNN
FT                   QQQQQQTQQLSLLGSNPYGLNLTGVPVTTMPESITAAITSKKKNELPLVHEKKRMFSTS
FT                   SASNVLPLVSNQSTLISKLSSRLNSGKNGESTRGLFSPSRKVLSQGPLVAADNTRDLNP
FT                   PLNHPSSSIPSRPLLSLANRTDLSDMRKLKLDPHRSAAKKLRLLNGQSATTKLKILDTN
FT                   YQSQREESSEIFVSTKTDRQPLEEKCEVSSTTGIPESDNGCDGYWCSPSIEQLQRLTPQ
FT                   QLSAIPNFVIGRKGYGSISFDLDVDLTAFSDDFKHALFGSVIMFNENKTVEVYPDDSLK
FT                   PPIGLGLNVPATITLERIYPIDKKTNQPITENSDLAKVQYFVKRLKSMRDMEFISYNPY
FT                   GGVWTFKVKHFSIWGLVNDSDVEIDDVELEAAREAEIKQRIVAIPKRPGFGKQADSTVP
FT                   GGFDQLVHIPSSVDIDMTQTSPDDYSLTSAPVDALLHDEAMTDLIEEKPYEPSDVDEED
FT                   FEGLEAEPNLEVSSDWHQQLQLAADPYKSVFANSTSLNRVNKMDDVIFNTFQKDMDEFK
FT                   SIRRQRRLDSAPSFVRFNNDSTITMKTDKSTSGCTVTASPLPLQTQRSSIDSVLKKSLI
FT                   DSTIELRNNNYPIVKQFSLTFDDIAAAYKPIPAEYRIWKLASILFDPISVSKSRSHPDD
FT                   AVKDVLVKKKQYELLCDWIINEINSEVGAKIASAGPLEKIFLYLVKRDIIGATTAAIAS
FT                   NNNHLAVLVTLLGSNDPLVRELSTSHLSKIKKLGSSLDINIIKIYQLLTGSPFAESANS
FT                   VISEGLSWLATLGLQIFYGDIDALSLRELIERGLEYSCKDQWPLNDISANILRLYCSDV
FT                   TPDILVGNLKISSNNLDVRLSWFFIQILTRDDISPSLRDHLTLQYVEQLKLNRMFGEAL
FT                   FIMCFINDDRLAKQQVDHLLSSQITFFSQDSNYELLTRLRIPKSSYYAFLALLDKYNRN
FT                   HLSEARNLLKAGHFQEAEKVVIVSVAPKLVLDGSAANLQTLRQLLETFPAQQMETWTHG
FT                   LGVFEKYLQIALDNNHNQELLSDLVRVLPVLATDFGSHRELSVVCCVMSKLVCHIILEN
FT                   YRQALETPSFKDRLLALPLGQPETIYLKRALAST"
FT   CDS_pept        complement(327354..330044)
FT                   /codon_start=1
FT                   /gene_family="HOG000141822" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762549"
FT                   /locus_tag="AFL058C"
FT                   /orf_name="AGOS_AFL058C"
FT                   /product="AFL058Cp"
FT                   /protein_id="AAS53314.1"
FT                   /db_xref="HOGENOM:HBG059313"
FT                   /db_xref="HOGENOM:HBG104213"
FT                   /db_xref="InterPro:IPR013253"
FT                   /db_xref="UniParc:UPI0000252FD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q754X4"
FT                   /transl_table=1
FT                   /translation="MEPHKRYSLPPRSILKQKSNYDDDERTSDTLQISSQIQFPTHGLT
FT                   KDQLLNGNNTTSRINTTQLEAKLNRRVSFAPDVTLHKFDFIPEVPVKFREPRRKSSLSV
FT                   LEKSHDNDTMELTNPVTHAFDGLGRVEEPDAGYEAVFDKEVSMEITQLFTKHSARPESE
FT                   AEGAEAGLGRAPVEETMELTNLHNLHGPLNTGTGDESMEMTDTHQAGPAPNEAEKNDAN
FT                   NGAEEEEDGGDDAPTPATEESMEITGQQSVGRIPSSGSPSAKLSGVATARMVSMDGDSM
FT                   EITGLQQLSQAHEYREAPDATLTLSNVFEGPKHLNEQRAEETMDFTAFPKLNEALTIDS
FT                   QVVTSTQEPPAYKALSTIKISPKRRKIAEGIYVSPVKPNPIEELFSDAERLSPIPLPPE
FT                   YSPSRQANSSNPVLSPADVPKLPHDNYAMKAVDQQPKEEPVEPISLQMFLDTTGISFVI
FT                   DLDGVQNYDPITFTYTDRIEDISTRQIYDALYLQIPLLEIYAFIVKELHRRILDSQRLF
FT                   QELEEQISNNPPPYLFRNYFESSDEVKQLMKEQIVLIKSFARLEAKKVWFEWRCQHLKG
FT                   IKSVLEENLSLVQTEYAEVVARLNEISDIKHRLQALEQSLRHELELLRNGEKPMRVTTL
FT                   ADRLKIEKIKSELKANMIKLNNTANLEEQKEAISADINALRSQIKDVREEISSLKSLVL
FT                   KNKLHTAHDVSKLRLLFSQMQLFTGVSFRGLSGSELQLALNSTINVSFDLTQVDNIKDI
FT                   AVSYQTESQFERHISTLFINEARHAAPNAFTFVLAVQSKLQHIRNVCMEYDRLQAIFPT
FT                   RLVTVRDTDLIELTDLDAVRNAKVHYHIGIPDFVAAVTSADQKKITIRARVAYGKGVTQ
FT                   ELLERHLLSRTKKPLPWFRQFQVVL"
FT   CDS_pept        330294..330536
FT                   /codon_start=1
FT                   /gene_family="HOG000111586" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762550"
FT                   /locus_tag="AFL057W"
FT                   /orf_name="AGOS_AFL057W"
FT                   /product="AFL057Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS53315.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059314"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="UniParc:UPI0000252FD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q754X3"
FT                   /transl_table=1
FT                   /translation="MFSTRICSLLARPFMVPIVPRFGSALLQKPLNGVVVPQFTRGFKV
FT                   RTSVKKFCAHCYIVRRKGRVYVYCKSNNKHKQRQG"
FT   CDS_pept        complement(330647..333577)
FT                   /codon_start=1
FT                   /gene_family="HOG000074499" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762551"
FT                   /locus_tag="AFL056C"
FT                   /orf_name="AGOS_AFL056C"
FT                   /product="AFL056Cp"
FT                   /protein_id="AAS53316.1"
FT                   /db_xref="HOGENOM:HBG059315"
FT                   /db_xref="HOGENOM:HBG397529"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000252FD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q754X2"
FT                   /transl_table=1
FT                   /translation="MNMSLDKVNDIAPCTAVRILGDGRCLAGCGPEIYVYEYRGGVLLN
FT                   RCRVFQRNKVHGICVQDGWVIAYGDRSVSILELEDVMTRRNLKYHEYMTPEWVLGAAFS
FT                   ADGRSCYLLTCYNSVLEMDLEMRVVRSINAGERSLLYSGSVKVVGDAVYVCAGTVMGGV
FT                   VVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGIAWGH
FT                   TARIWDLRFLRVADKLVSVSEDCTCRVWAVGAERMQEEAVYDVHQTKSVWAVDVQEDDM
FT                   VAVTAGNDGRLRLVDLTRPGSRERPAIDLTTEGLYNMDHTTFKGFCWFERGPIAITSCG
FT                   KILQRRMLGRWECILADQRLAGYSVTRRERALGLAVIANASADVLVLRVDTHEPLASKW
FT                   HRVPEIGKCTNILVTRSGEDLLILAESPQPSDPLVCLRLESQTLAMKAQYVFRKPAEFS
FT                   TRALGVYEHYIIVGSRFSTVAVFDLDDPSYEFVLRKLLPGDTITAITHISGHLFAITDR
FT                   DGHYNFVCFDFAKRAHRVVHSNKVQKGFLEGIIRNAKGDYITYGFKADSFYMYNETKQY
FT                   EIGTVLCGGANRQWDLVHRIDDSFLLCYIKAGDPYVCLVRDFPFSRVLGNGLHGREIRD
FT                   ISIRSDEPYKNGYLFITGSEDTNIKLNCFDVDTGEIRTFWTLKEHVSGLQRCEFINKRL
FT                   FVSCSAREELFLWQVTDTFDIPYVHLLQKLPVSSSNPDLRIMDFSCKFVNGTENFVIAT
FT                   VCSDSSIRLWYYDSEKNAFTLLVNGFYTQCCILNAELIVLQGRLYLLVSATDGHLVVWD
FT                   MAPVMPFAVEDQLQQLEGAAMAETKLPEPSVLLKVHQSGVKALGVSVRKSEFVVYSGGD
FT                   DNALAISIFSCSNDSALVAKIAAFNPSAATSTITSLSVVSEGSYILTSSIDQILRVWSV
FT                   ARDQLQLHSQSYTTVADTGPTAVVASPSGTWALAGGAGLTLRRLLP"
FT   CDS_pept        333836..337324
FT                   /codon_start=1
FT                   /gene_family="HOG000230585" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762552"
FT                   /gene_name="PAN2"
FT                   /locus_tag="AFL055W"
FT                   /product="PAB-dependent poly(A)-specific ribonuclease
FT                   subunit PAN2"
FT                   /EC_number="3.1.13.4"
FT                   /function="nucleic acid binding"
FT                   /function="poly(A)-specific ribonuclease activity "
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53317.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0004535"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG059316"
FT                   /db_xref="HOGENOM:HBG735259"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0001DB2C50"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754X1"
FT                   /transl_table=1
FT                   /translation="MNQWQLSYQSPVELTEHLRKSYWAYDAKEKSATKMAFDQDVNLIW
FT                   VGDTYGRVSSYDPSYSLYTRHTAHIGAEPVVELLSHKQGVLSLGGESLNFANRRSVTKL
FT                   HVTSADIAQLCDMRAMCYGSNSQNTVYCGGTNLASGLVAVDLVKGRLSNTVQYSSKVKL
FT                   MQSSNRLMAVARQNGMLDLLDPNSNTVVKTFSGHSCMVSSMDFRDHTLVTAGKSKRFNM
FT                   MYPDQFVNVYDLRIMKQLPPISFSKNTEYMGNGACYMVGADFVQLHPILPTVVVIGSVT
FT                   GAFDFVDLSNPTVRTQYCHPCQSVTQLQLSPSGDYIAFIEHDNNINMWSRSNGMTGFTS
FT                   TATTILEYPDYPDDGILAGATSIDDYSYPLSSVGLPYYNEKLLSAWHQTVFRSDGTIPM
FT                   KVPLPPKSSAASSSHTALSTSSDSRPNTARSGNPSSGGQKYRLLPYDRHKYGHRNVAVP
FT                   YRSLRERKKKLLITDEDGKDKQELMNYKPSNDREVPPAFTKLQMVYGRFGVQDFDFKAF
FT                   NKTRYSGLETDIDNVYTNAVLQMYRFVPEVYNFLVSCLKMENFSDNSLLTELGSLYDMM
FT                   VRANGEICRSSNFQEALASIPKSYLLGLITDSIDNALEPNTTVSGTSISDSDASGSSMT
FT                   AKLESMVLGDDKTTISCHDNNDNSLTTPQKFNTFLLNRLLFEELQMKINTTQSIVLEEL
FT                   LGIDVQVTTRSISPCANFTRRSDIIPVLTVTSPISNNIKYVNKKLNNQTILPYIESSMS
FT                   RLKHTKAMCEKCFKCETVESEKTVRNLPPLLSLNISLTSDEWATAKTVRGWLTKEFYAT
FT                   ISKDRPILKLQPTDLKTTNAIFKYELNGYVARICDYITEPHLVAYSKIFDPTTRTYKWY
FT                   MFNDFLVQEVDEEEALNISYWWKTPEIAIYSDAEELTKPFVPASFYTINYSILYRDHFA
FT                   NGMRESIKKEYRLLTAEEAPKPGSLVALDAEFVALSEDQVEISCKGTKTLIKPAKTALA
FT                   RVSVLRGEGDLAGVPFIDDYIVNTKHIEDYLTKYSGIEPGDLDPDTSSKPLVTRRVVLR
FT                   KIWLLLQLGCIFVGHGLYNDFRNINIHVPKEQTRDTALYYLQGRRYLSLRYLAYALLDK
FT                   DIQKGNHDSIEDAYTALVLYRKYLDLREKGIFETVLNRIYEEGRASNYRVPGDLQ"
FT   CDS_pept        complement(337610..339664)
FT                   /codon_start=1
FT                   /gene_family="HOG000141823" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778133"
FT                   /locus_tag="AGOS_AFL054C"
FT                   /product="AFL054Cp"
FT                   /protein_id="AAS53318.2"
FT                   /db_xref="HOGENOM:HBG059317"
FT                   /db_xref="InterPro:IPR018857"
FT                   /db_xref="UniParc:UPI0001DB2C51"
FT                   /db_xref="UniProtKB/TrEMBL:Q754X0"
FT                   /transl_table=1
FT                   /translation="MSSGACRGRSFRSEADMGGHGGHGGAAGHGGGKTRGKKLKQFSTR
FT                   SRSKSNANFKGLVSLHRTSSHDGTYSRGDGEPSNGSMKRTRSYDSLSKRKALSMLSMTA
FT                   LGRTETGADGRAGRGAHGRLVLQLHEQGGSSADEEVDYFSGEDLRDGGRWGAGDEAEGD
FT                   EAEGGAARAAPALPALPALPALPALPAGAGGSTQGLGRMQLSYKAPSSLRNKQLDSNDE
FT                   DRIEHSKDYGAGYGDCEVSKALHAGETIAESAHSLQRQGATAAEGRTEYPSTPRRAEGP
FT                   EQADRTGRPERTPEADGARAAEVAEQPGDGGKAGKSAVEAQEGNVHGDPDKDSDHYAPD
FT                   MILSQSTGVERHFNQTLSRQNSVASHAAMIDNSAYDTQHANHNRFNYINNDLASSLKSG
FT                   ELKAEEKPSKDFSTSISSLTSHLQGRAPNSRSGNRTNNLMALRTSQNALLRGQQASFLG
FT                   EHGLGQGQQRSGTQVPLNHFSQFLQSNDQNNESRTQQKLWLQRESSFLDVSAQSATGSD
FT                   ALFLASNVEVRREFERISREYMSVRRFGNPLNDAMTRVVTQHKIDVKKHNKSSSPMYDA
FT                   SNGSLFGSYQRNMKTFGELHPDIRNRDMEIRQILTSLWNEGTTEFNKDSNPLSQKGPYL
FT                   QQNPKVAAAPRSRTTGPTPHHNQRLINSLQPTTRAFNRRMETALNQQRL"
FT   CDS_pept        340067..341812
FT                   /codon_start=1
FT                   /gene_family="HOG000200803" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625575"
FT                   /locus_tag="AGOS_AFL053W"
FT                   /product="AFL053Wp"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /protein_id="AAS53319.2"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG028551"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniParc:UPI0001DB2C52"
FT                   /db_xref="UniProtKB/TrEMBL:Q754W9"
FT                   /transl_table=1
FT                   /translation="MDLFKVADFYLERVVNWQNRATLSVVEQSRVRLLLLDKHTTAVIS
FT                   VVTTQSELLAREIYMIDRLENAERDVMRNLGCVCFVKPTEETIEWLLRELEEPRYGKYQ
FT                   IFFSNTVSKTQLERLAERDDLEVVARVEEVFLDYGVVNADLFVLEQATPQLLAGPGTWR
FT                   PAGLDEVRRSVLAVLLSLKLNPRVVFEAGSELCARLARELQHEIDKNAKTLFDFPALDT
FT                   APVLLLLDRRHDPLTPLLQPWTYQSMIHEYIGIHGNLVDLSGVAELDEELKQVVLSPKQ
FT                   DQFFRETMYLNFGDLGDRVKQYVAQYKSKTKSNSQINTIEDIKHFIEKYPEFKKLSSNV
FT                   SKHMAIVAELDHQLQKSDIWQLSEIEQNMSVHEDDNNDYHEMLKLLQSPTLDSYYKLKL
FT                   ACIYSLKPNPVAQKLQQVAKLLSVSCSPREMAIFHKFREQFGAHVSQVRKSPENDLISG
FT                   LSKKFNKLNHNSADNVYMQHKPKLGAILADLAKGRLSQDIFSSTSGALPTNKPVQDVVL
FT                   FIVGGVTLDEARLVHQFNESSRRQEGSLRVVLGGNTLLRTRDFIDEFEQLYCSAGKETG
FT                   LGDLL"
FT   CDS_pept        complement(341883..343238)
FT                   /codon_start=1
FT                   /gene_family="HOG000000985" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625576"
FT                   /locus_tag="AFL052C"
FT                   /orf_name="AGOS_AFL052C"
FT                   /product="AFL052Cp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS53320.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG189648"
FT                   /db_xref="HOGENOM:HBG204046"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI0000252FD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Z7"
FT                   /transl_table=1
FT                   /translation="MTRAELKEPQSMDHALLHRKRARVHDDGQDGRVMDEEDEDEDVAH
FT                   EAEEDGDDDEEGETRCVCGELDPPDASGFFIQCESCSVWQHGYCVGIMEGESTPDKYWC
FT                   EQCRPEQHAVYTNDLGKRRSNYKPTQQRRRQSRRAKRGDRSADSASDADRQRRRYDDEL
FT                   RPRSRDSGQYDDDARGPNSSAGSEQDERRLLNRKRATLSAREEKQYQLMLEAIRESRRT
FT                   SQPEEVLKAEHKDLSDRELSGEDTSPTTATSSTSMGTLPPVTTKQEQGKGSSSEASRVL
FT                   GSGPPVSSGSAGAMRKRTRGKSATSNSSSEEDGGRKRSRRGGTRKSAGSSMQRVPPGSN
FT                   SSVGGNNASTNGQEVGIGKPIKPRLPTQKTSISEMRRRIYAILEYLSRTQSQLTDGELG
FT                   KEQLIQFVENDDFICKINTIFQDYSKSLKLMDSLTRKLLLWEQKYASEGPAT"
FT   CDS_pept        344000..345607
FT                   /codon_start=1
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778134"
FT                   /locus_tag="AFL051W"
FT                   /orf_name="AGOS_AFL051W"
FT                   /product="AFL051Wp"
FT                   /function="cofactor binding"
FT                   /function="magnesium-dependent protein serine/threonine
FT                   phosphatase activity"
FT                   /protein_id="AAS53321.1"
FT                   /db_xref="GO:0004724"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG488218"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="HSSP:1AUI"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011159"
FT                   /db_xref="UniParc:UPI0000252FDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q754W8"
FT                   /transl_table=1
FT                   /translation="MGNSPSKDSPYAFQSTTQQAGAGSQQQSSLADENPNEPNDPDDSR
FT                   LTPTHTKNISISKPRNSHVITSGVSAVAPTSVRRSPYYDLKIDVNMARALQPVSTSSDS
FT                   FSSSSSSSSAASSSSTASSSTSLCAKPGETAAVPGHCGYGREHGFLSLKSSLSSSSDTA
FT                   LSSINVSGGGSLPTIAEERENSHIIARNSKATSAPSYSHMAKKSRIANPRSETPIVLKR
FT                   NPHDPYNNDKLNIDDAIEKLLYIGDSRSYHSRDFPFHSWEVQLICATVREIFLEQPSLL
FT                   RLQAPIKIVGDVHGQFTDLLRILKLSGVPDETNYLFLGDYVDRGKQSLETILLLLCYKI
FT                   KYPDRFFMLRGNHESASVTKMYGFYDECKRRMSTKTWKQFVDVFNTLPFAAIVQDKIFC
FT                   VHGGISPQLSNMRQIEKIARPTDIPEEGLLTDLLWSDPDPAVSDWSLNDRGVSYTFGKR
FT                   NVYDFCANFKFDLIIRGHMVVEDGYEFFAKKKFVTIFSAPNYCGQFQNWGAVMSVTTGM
FT                   MCSFELLKPHGLKDTRRK"
FT   tRNA            complement(345945..346016)
FT                   /gene_name="tRNA-Glu"
FT   CDS_pept        347055..347711
FT                   /codon_start=1
FT                   /gene_family="HOG000217589" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082474"
FT                   /gene_name="CBC2"
FT                   /locus_tag="AFL050W"
FT                   /product="Nuclear cap-binding protein subunit 2 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA capping"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53322.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006370"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG201637"
FT                   /db_xref="HOGENOM:HBG735807"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000252FDB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754W7"
FT                   /transl_table=1
FT                   /translation="MSLAEFDELRWDHSCDRLDVPSNYLKRKARKTPGGLEELRKSMTS
FT                   ATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQEALAAL
FT                   KYLSKTKLDDREITIDLDPGFEEGRQFGRGKNGGQVSDELRFEFDASRGGFYVPLENRI
FT                   GAVNHFGARRIRDPHKNHHHHHHGHHHHHGQPHAAAAKVNPMEVEEELDSYIPGQ"
FT   CDS_pept        complement(347977..348750)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625577"
FT                   /locus_tag="AFL049C"
FT                   /orf_name="AGOS_AFL049C"
FT                   /product="AFL049Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS53323.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG059318"
FT                   /db_xref="HSSP:1B72"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI0000252FDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q754W6"
FT                   /transl_table=1
FT                   /translation="MPGNPIKLPSIHHILNIVDVVDTEQYPYGEQPVGYAHGHSPRAVA
FT                   PGLNEFGAAPPAEAPVFFGRMRSPSLPQIRPWPQPPPRHHSISHFLSPVEGAPAAPATE
FT                   PFTVYGRDDQQEPAPDGTKGKLKETKKQHRRSNLPKETVDILNEWLRNHYDNPYPSPQE
FT                   KKELLKQTGLNPVQLSNWFINVRRRKIFQNYYKLSKSYSGNITAQSPSEPSSDQGEISR
FT                   SDSELDKRFSIMPLTRRKKLIDRLEDLKNLSGTNA"
FT   CDS_pept        350866..352353
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082475"
FT                   /locus_tag="AGOS_AFL048W"
FT                   /product="AFL048Wp"
FT                   /protein_id="AAS53324.2"
FT                   /db_xref="HOGENOM:HBG059319"
FT                   /db_xref="UniParc:UPI0001DB2C53"
FT                   /db_xref="UniProtKB/TrEMBL:Q754W5"
FT                   /transl_table=1
FT                   /translation="MPIKKSILSSSRTEPYYAPCNQELSGTKCKVIQLKNLKCRGTLIK
FT                   HKTPVPPILVFNSLNFENNPLMDVHDSANLRVQLVLSHDTCYLPGIFTQQESLATTTAS
FT                   ARSSADDEMLLQSKSVFAGYVHITVKGQSGVLFQDLKVQLSGYSSEFVCLTQFGEKVVR
FT                   LLKDLTSDSCSHLRPMIQDTIHFKPKLTLLSPGTYTYPFNFVLDPYHFHASIGTHLGST
FT                   QYRMELTCTIMRQKAQYETIFLSRPFAVKKTLPPGNLLRYDCVESQGTWRDGLLDYKIY
FT                   LSTKLLEFDQPFQFHLHLVKGEAHQIEVQTIEVILEQNMLIPCVKKKDLHKPVAKAKSY
FT                   MATNMFLLAKHSVTSKHDIQHILQFPDLLVSSSKQSIVMGKSLHPYYCEMSDTFGADRC
FT                   KLKITHVLKAQVSLRLHDGGKVTNMLICLKLPVLLVDKDMSSGLHLPPYRESCSASAKD
FT                   TLSTLCPTMSDDSRLCSSPPTYAELFDSAYPPAESSS"
FT   CDS_pept        353030..354124
FT                   /codon_start=1
FT                   /gene_family="HOG000220501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762553"
FT                   /locus_tag="AFL047W"
FT                   /orf_name="AGOS_AFL047W"
FT                   /product="Phospho-2-dehydro-3-deoxyheptonate aldolase "
FT                   /EC_number="2.5.1.54"
FT                   /function="3-deoxy-7-phosphoheptulonate synthase activity "
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="AAS53325.1"
FT                   /db_xref="GO:0003849"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG000409"
FT                   /db_xref="HOGENOM:HBG670536"
FT                   /db_xref="HSSP:1KFL"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000252FDE"
FT                   /db_xref="UniProtKB/TrEMBL:Q754W4"
FT                   /transl_table=1
FT                   /translation="MTSFPMFAADADQAEDVRILGYDPLVSPALLQSQIPATQACLETA
FT                   QKGRREAIDIITGKDDRVLVVVGPCSIHDLDAAQEYAQRLKKLAEELEGDLVVVMRAYL
FT                   EKPRTTVGWKGLINDPDVNNTFNINKGLQAARQLFVNLTSIGVPIGSEMLDTISPQYLT
FT                   DLLSFGAIGARTTESQLHRELASGLSFPIGFKNGTDGSLDVALDAVKASSHSHHFMGVT
FT                   KHGVAAITTTKGNEHCFVILRGGKRGTNYDATSVAEAKAKLPPTGVLMIDYSHGNSNKD
FT                   FRNQPKVNEVVSEQIANGEDKIVGVMIESNINEGSQKIPPEGKAGLKYGVSITDGCISW
FT                   ETTEEVLRKLAGAVRKRRDLRKTK"
FT   CDS_pept        354394..356043
FT                   /codon_start=1
FT                   /gene_family="HOG000162393" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762554"
FT                   /locus_tag="AFL046W"
FT                   /orf_name="AGOS_AFL046W"
FT                   /product="AFL046Wp"
FT                   /function="imidazoleglycerol-phosphate synthase activity "
FT                   /biological_process="histidine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53326.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0000107"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG052794"
FT                   /db_xref="HOGENOM:HBG330620"
FT                   /db_xref="HSSP:1JVN"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014640"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI0000252FDF"
FT                   /db_xref="UniProtKB/TrEMBL:Q754W3"
FT                   /transl_table=1
FT                   /translation="MVQVVHIVDVESGNLQSITNAIEHLGYEVKLIRSGADPELDKAET
FT                   LILPGVGNFGHFTRNMRARGFVDAISSYIASGRPLMGICVGLQVLFRSSEEDPGAEGLA
FT                   LVDMSLSRFRDESKPVPEIGWNTLQLDGDQFFGLDPCGRYYFVHSYAAMLANGAGRLRE
FT                   QGWRVATARYGDERFVAALARGNLFATQFHPEKSGKLGLQLLANFLKQQHPSIDRGSQD
FT                   IELLTNDYSNYGLTRRIIACLDVRANDEGDLVVTKGDQYDVRDKQESGAIRNLGKPVEL
FT                   AQLYYEQGADEITFLNITSFKDCPLRDAPMLEVLRLAAKTTFVPLTVGGGIRDIVDPDG
FT                   TRISALDVAGLYFRSGADKVSIGTDAVYAAERYYEAGTRGDGSSPIETISKAYGSQAVV
FT                   ISVDPKRVYVDSPDDTPNKTIESKYPNSKGQRWCWYQCTLKGGRECSKIGVWELVRACE
FT                   ALGAGEILLNCIDRDGTNVGYDLELLKLVKYAVKIPVVASSGAGKPEHFQEAFLETGVD
FT                   ACLGAGIFHRGEYTVREVKDHLSRNGLKVRLI"
FT   CDS_pept        complement(356222..357682)
FT                   /codon_start=1
FT                   /gene_family="HOG000170207" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762555"
FT                   /locus_tag="AFL045C"
FT                   /orf_name="AGOS_AFL045C"
FT                   /product="AFL045Cp"
FT                   /protein_id="AAS53327.1"
FT                   /db_xref="HOGENOM:HBG352103"
FT                   /db_xref="HOGENOM:HBG593714"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI0000252FE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q754W2"
FT                   /transl_table=1
FT                   /translation="MESVKMQKRGSSPMSSPRKKRKHLVSTLNKHYKSINKLDDYRQLY
FT                   ISDSRMDIFVWGTGSMCELGLGPLAKNKEVKRPRLNPLLQREKAGIVSFAVGGMHCLAL
FT                   DSDNNVWSWGTNDSGALGRDTSGAAEQLRDMDAAESSDDEDGDLNELEATPTMLPRDSL
FT                   PLDTQKVVQLAATDNLSCVLFENGDVYAWGTFRCNEGILGFYQDAIESQRSPWKLPSFS
FT                   GSRIVQMAPGKDHILFLDEHGVVYAWGNGQQYQLGRKIMERSRLRTLDPRAFGLDGVKY
FT                   IASGENHSFALADDGRLFAWGLNQFGQCGISNEVEDGAMVTVPTEVLLPPDVKVESIAA
FT                   GEHHSIVLTQDGDLYTFGRLDMFEVGISAEDYPESTYKDVHGKARSVPVPTKLKGLPKF
FT                   KAIAAGSHHSLAVARNGIIYSWGFGETYAVGLGPAGEDVEVPTRIKNTATQHESIVFVG
FT                   CGGQFSVAGGIELSDEEAEKRAKEMGDE"
FT   CDS_pept        358144..359520
FT                   /codon_start=1
FT                   /gene_family="HOG000178028" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762556"
FT                   /locus_tag="AGOS_AFL044W"
FT                   /product="AFL044Wp"
FT                   /protein_id="AAS53328.2"
FT                   /db_xref="HOGENOM:HBG028479"
FT                   /db_xref="InterPro:IPR007955"
FT                   /db_xref="UniParc:UPI0001DB2C54"
FT                   /db_xref="UniProtKB/TrEMBL:Q754W1"
FT                   /transl_table=1
FT                   /translation="MGRATIGRTKKQRHDPLLQDLASQHGKLRKQANAQTEETEEQDEE
FT                   YVDAQASRKILQLAREQQEELEEEDQARAQSETMNRFRVADYGLAKDSDEEEMAEEISD
FT                   FEPEEELEEEVVEIDEEDAAMFEQYFKRSSDFNSANGTYILADKIMAAIREKEMEMKVK
FT                   AQAAQAGDAGMPSEGVALPERVIRAYTTVGSILKTWTHGKLPKLFKVIPSLNNWEDVLY
FT                   VTNPEAWSPHVVYEATKLFVSNLSAKGAQKFINMVLLERFRENIETSEDHSLNYHIYRA
FT                   LKKSLYKPAAFFKGFLFPLVETGCNVREATIAASVLARVSVPALHSSAALTYLLRLPFN
FT                   PATTVFIKVLLEKKYALPYQTVDECVFYFMRFRAVDDGSTGEDATRVLPVVWHKAFLSF
FT                   AQRYKNDITQDQRDFLLETVRQRGHRDIGPEIRRELLAGKSREFVSDVGNTADLMIDVQ
FT                   "
FT   CDS_pept        complement(359619..360383)
FT                   /codon_start=1
FT                   /gene_family="HOG000000925" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931094"
FT                   /locus_tag="AGOS_AFL043C"
FT                   /product="AFL043Cp"
FT                   /protein_id="AAS53329.2"
FT                   /db_xref="HOGENOM:HBG059320"
FT                   /db_xref="InterPro:IPR019150"
FT                   /db_xref="UniParc:UPI0001DB2C55"
FT                   /db_xref="UniProtKB/TrEMBL:Q754W0"
FT                   /transl_table=1
FT                   /translation="MSEVETAETASIADRLRAQYASLPVDSDSVLDYVLVSKLATNLAC
FT                   IREQTVARELQDGSGSEDYDKELGKLELDTLHKLYRYRKGLISLYNEQKEAKARRRYSV
FT                   DFDSADPRLDEESEAIGDTGQLNGDDDSLQQLRQRLIGGQEGKEDREALEKQMQVQDDV
FT                   QRELVSDMAQLVTSLRRGAEAFQNALAEDSTVLRATELGLQATSQSLSTLGTKLKKYNR
FT                   SRVGFFFYMGCAFFIIMSLLVTYLIIRIFPKM"
FT   ncRNA           complement(360613..361005)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR82"
FT                   /product="AgSNR82"
FT   CDS_pept        complement(361030..362955)
FT                   /codon_start=1
FT                   /gene_family="HOG000172552" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931095"
FT                   /locus_tag="AGOS_AFL042C"
FT                   /product="AFL042Cp"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS53330.2"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG064217"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="UniParc:UPI0001DB2C56"
FT                   /db_xref="UniProtKB/TrEMBL:Q754V9"
FT                   /transl_table=1
FT                   /translation="MPLKKEPVKKWKQPVGPKPIQRKNKNTIGLGKAIQNARSKENAIE
FT                   YLPDGEMRFTVDKHEANWVKLRSVTQESSLDAFLSTAELAEKDFTADRHSNVKIIRMDA
FT                   GADVATSHGIMLSNQQRAALNEKQRAHSAELIVPRRPYWDEEMTRFELERQEKEAFLNW
FT                   RRKLATLQEENDDLLLTPFERNIEVWRQLWRVVERSDLVVQIVDARDPLLFRSTDLEEY
FT                   VKELDERKQNLLLVNKADLLTTKQRIIWAKYFIAKGIAFTFFSARRANELLELQKELGE
FT                   DYVQREEQDEPVAMVDGETVDAEVLERIRILKIEELEDLFLSKAPSEPLQEPRPGHEPL
FT                   IQIGLVGYPNVGKSSTINALVGAKKVSVSSTPGKTKHFQTIKLSDRVMLCDCPGLVFPN
FT                   FAYNKGELVCNGVLPIDQLRDYIGPSTLVAERIPKYFLEAVYGIHIETRSEEEGGGEHP
FT                   SAQELLVAYARARGYMTQGFGSADEPRAARYILKDYVNGKLLYINPPPHLEDDTPYTRE
FT                   ECKEFNKALYTLQNLPESRREQLLEAAKNKGITSLDLARDLSKLTFSSHIGGDSLTQAK
FT                   SVTHGGKQAALYNAAKDLDREFFQLNGIQGKLTKPFHQANAQQGNGKKHNKKNKKGKKK
FT                   AAMFSD"
FT   CDS_pept        complement(363155..364264)
FT                   /codon_start=1
FT                   /gene_family="HOG000248415" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762557"
FT                   /locus_tag="AFL041C"
FT                   /orf_name="AGOS_AFL041C"
FT                   /product="AFL041Cp"
FT                   /protein_id="AAS53331.1"
FT                   /db_xref="HOGENOM:HBG131392"
FT                   /db_xref="HOGENOM:HBG396373"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0000252FE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q754V8"
FT                   /transl_table=1
FT                   /translation="MQEITVLERARSEFPPCAVRIMDGGYVVVGTYELDKTSGARHGSI
FT                   EVYDGGLQLVGRTATYGAVLDLKASPFDKETLVSAHSTGNVMVWRMAEGVLAAVANLQL
FT                   FGCDSVVTSVNFSTQEPGLLVVTTAGGAVATVDVETGAPDVRYASAAKVYEKADLKEYD
FT                   VQGKREVAADLSRGVREFSRGHSVECWIGEFGALSPLENVVFSGGDDCAVHAYDVRTGG
FT                   LIWANSAVHGGGVVALRPSTPSFRPHMPTALLTGSYDDRIRSLDLRMMGNTLCPGNVRP
FT                   LAVSELDLGGGVWRFVESPSNALAAETNELLVCCMYDGARIVAVDGHDFTVKNVLKEGH
FT                   ESMCYGADWCDQFAVTCSFYDKSLQLWKP"
FT   CDS_pept        364593..367853
FT                   /codon_start=1
FT                   /gene_family="HOG000192862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082476"
FT                   /locus_tag="AFL040W"
FT                   /orf_name="AGOS_AFL040W"
FT                   /product="AFL040Wp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="nucleosome binding"
FT                   /biological_process="ATP-dependent chromatin remodeling "
FT                   /cellular_component="chromatin remodeling complex "
FT                   /protein_id="AAS53332.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016585"
FT                   /db_xref="GO:0031491"
FT                   /db_xref="GO:0043044"
FT                   /db_xref="HOGENOM:HBG522470"
FT                   /db_xref="HOGENOM:HBG717285"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR015194"
FT                   /db_xref="InterPro:IPR015195"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI0000252FE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q754V7"
FT                   /transl_table=1
FT                   /translation="MENQEYAEKLRPFQEGLGHKPDAVETRARYLVGGGQNRRRFDTEG
FT                   TTKRFQHLLGLSPLFRHFIERKAAKDERFGQVLRVLDDGRQAGRHEDKRRRKTEREEDA
FT                   ELLREEDAELLREEEEGPDAAAADYEFQFRESPGFVDGRLRPYQVQGVNWLVSLHKNNL
FT                   AGILADEMGLGKTLQTITFLGYLRYIEKKRGPFLVIAPKSTLNNWQREINRWTPDVDAF
FT                   ILQGDKEERARLCQERLLACNFDVAIASYEIIIREKASFKKIDWEYIVIDEAHRIKNEE
FT                   SMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDSAAFDEWFSSEASDD
FT                   DKDKIVKQLHTILQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQRKWYKQILEKDLDA
FT                   VNGSNGSKESKTRLLNIMMQLRKCCNHPYLFDGAEPGPPYTTDEHLVYNSAKLKVLDKL
FT                   LKKLKEDGSRVLIFSQMSRLLDILEDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDS
FT                   RKFIFLLTTRAGGLGINLTTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVT
FT                   DNSVEEKILERATQKLRLDQLVIQQGRTSISKKENAKDAKDALLSMIQHGAVDMFRSTD
FT                   TSNASSAKGTPQPETGDKDDEVDLESLLNKSENKTKSLNEKYAALGLDQLQKFNQDSAY
FT                   EWDGQNFKKKLTKDIINPLWIEPTKRERKENYSIDNYYKGVLNTGGARPNQAAVPRMPK
FT                   PQPFNSHQLLPPQLKILYEKERMWMAKRTKYTPTMEDVKTTYGDIESEEERASKLELLK
FT                   IAVANAQPLTEEEEKNKAEWEREGFHNWNKLEFRRFITASGKYGRNSIKAITAELGGTK
FT                   TEEEVRAYAEAFWTHLERIEDYEKYVKAIETEEEKLKRVKMQQEALRRKISQCTNPLFD
FT                   LSLKHPPSSNNKRTFSEEEDRFILIMLFKYGLDRENVYELIRDEIRDCPLFELDFYFQS
FT                   RTPAELQRRAFTLLQCLEKEFSTGVVLDDAMKARMKEEDTAAEKLRAEEAKRIKEEEDA
FT                   EKERESPMPVHVDAVADPVAEVPTANEDGPEAKKPRIE"
FT   CDS_pept        complement(368010..368657)
FT                   /codon_start=1
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931096"
FT                   /locus_tag="AFL039C"
FT                   /orf_name="AGOS_AFL039C"
FT                   /product="AFL039Cp"
FT                   /function="glutathione peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="AAS53333.1"
FT                   /db_xref="GO:0004602"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG648990"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000252FE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Y9"
FT                   /transl_table=1
FT                   /translation="MIRIGSRLTPSLRHYTSSSQRITKFTMSGFYDLSPLDAKGEPFPF
FT                   SQLKGKVVIIVNVASKCGFTPQYEELEELYKKYKDQGFEVIGFPCNQFAHQEPATNEEI
FT                   VQFCKLNYGVTFPVLKKVDVNGADADPVYVYLKSQKSGLLGFKGIKWNFEKFLVDRKGQ
FT                   VKDRYSSITKPLSLEKTIETLLKEEGGPAPTATTEATATATADAAKPSGESL"
FT   CDS_pept        complement(369012..370004)
FT                   /codon_start=1
FT                   /gene_family="HOG000216896" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762558"
FT                   /locus_tag="AFL038C"
FT                   /orf_name="AGOS_AFL038C"
FT                   /product="AFL038Cp"
FT                   /protein_id="AAS53334.1"
FT                   /db_xref="HOGENOM:HBG144577"
FT                   /db_xref="HOGENOM:HBG590901"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000252FE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Y8"
FT                   /transl_table=1
FT                   /translation="MKPFTTGHEDLVHDICYDFYGRHVATCSSDQHIKVFRLDKDTNEW
FT                   TLSDSWKGHDSSVVALDWASPEYGRILASVSYNKTIKVWEEDPDAPEGSGRRWTRLCTL
FT                   NDATGPLYSVKFAPGHLGLRLGAIGNDGVLRIYDALEPSDLRSWTLTSEVKVLATPPAS
FT                   HLQSDFSLDWCPSRFSAERLVVCALDQAFVYERNKAGKLFQAARLPGHQGLIRSVSWAP
FT                   SFGRWHQLIATGSKDGRVRIFQLTEKLDATDDASTDDASTDDAGPAPHISVQLLSEHAD
FT                   HKGEVWSVSWNLTGTILSSSGDDGKVRLWKSSFSNEFKCMSVICAQKKK"
FT   CDS_pept        370180..371544
FT                   /codon_start=1
FT                   /gene_family="HOG000163915" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082477"
FT                   /locus_tag="AFL037W"
FT                   /orf_name="AGOS_AFL037W"
FT                   /product="AFL037Wp"
FT                   /protein_id="AAS53335.1"
FT                   /db_xref="HOGENOM:HBG024638"
FT                   /db_xref="HOGENOM:HBG412014"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniParc:UPI0000252FE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Z6"
FT                   /transl_table=1
FT                   /translation="MAVIRVCALLAIAGTAIVYSKYSSAVWSAAGFAIIGYLATNTLIP
FT                   RVADSFIRVGLYGKDLGKPGRPVIAETMGAVAATVYLFMMFLSIPFVFYKYLVVTSGAG
FT                   ARDWSEEAAGRGAFPHGKLSEYLSAILSLQSTVLLGVADDLFDLRWRHKLYFPIISAIP
FT                   LLVVYYADFGVTYVLVPKFVHQWVPQLSEFALIDLGWFYYIYMASMTIFCTNSINILAG
FT                   INGLEVLQSIILAIVCLVNDALYLVWGSERTRESHLFSIVMLLPFLGVSYSLWKWNSWP
FT                   ARVFVGDTYCYFAGMIFAMIGILGHFAKTMMLFFTPQIFNFAYSIPQLLGLVPCPRHRL
FT                   PRFNEEDGLMYTSRTDLQKRPPMRPVALALKLLAYLHLLDVTVDEQGNLLDCNNMTLIN
FT                   LCLVWFGPMREDQLCLTVCGIQLVVGLLCVFARHAVGTLLFGEDNYTRIIKYIRT"
FT   CDS_pept        complement(371575..372216)
FT                   /codon_start=1
FT                   /gene_family="HOG000216981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762559"
FT                   /locus_tag="AGOS_AFL036C"
FT                   /product="AFL036Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS53336.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG237380"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniParc:UPI0001DB2C57"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Z5"
FT                   /transl_table=1
FT                   /translation="MPATWTPEEHIPAEIKALLAEPSPNYVLTFLHIVELLKTQRRTGW
FT                   VDHGILPCESISDHMYRMGITSMLIKDPAVDRNRCVRIALVHDLAESLVGDITPVAEVT
FT                   KEEKHRREWETIQYLCQQLIAPYNPVAADEIMRDWLAYENTDCLEARYTKDIDKFEMLV
FT                   QCFEYERRHGGTKNLQQFWSAVDSIKTDEVRSWVQDLQARRNRFFESLAH"
FT   CDS_pept        join(complement(372983..373031),complement(372377..372777))
FT                   /codon_start=1
FT                   /gene_family="HOG000231263" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762560"
FT                   /locus_tag="AFL035C"
FT                   /orf_name="AGOS_AFL035C"
FT                   /product="AFL035Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS53337.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG380059"
FT                   /db_xref="HOGENOM:HBG727142"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniParc:UPI0000252FEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q754V6"
FT                   /transl_table=1
FT                   /translation="MPTRLTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGMHHHRTNL
FT                   DKYHPGYFGKVGMRYFHKQKNHFWRPVLNLDKLWTLVPEEKREQYLSSASKSAAPVIDT
FT                   LAAGYGKVLGKGRIPNVPVIVKARFVSKLAEEKIKAAGGVIELIA"
FT   CDS_pept        373258..374682
FT                   /codon_start=1
FT                   /gene_family="HOG000199277" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931097"
FT                   /locus_tag="AGOS_AFL034W"
FT                   /product="AFL034Wp"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53338.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001DB2C58"
FT                   /db_xref="UniProtKB/TrEMBL:Q754V5"
FT                   /transl_table=1
FT                   /translation="MSQDQLLLGSERPPRGSVTPALAGSVFVVCLGALQFGYHMAELNA
FT                   PQEVLMCHGPLDPGYADTWWGRHGWEQCLHLDDSQYGLVTSIFSVGGLLGSLCTGSQAD
FT                   RYGRRAAAIGSSVLAAAGSAAMVFANSYAQLLLGRLVAGVGCGGGIVVTSLMLNEMAPA
FT                   ELKGALGALNQTCINLGILVTQLLAFAWANSVQWRLLFAVSAAVAVAHCGLLLGVEESP
FT                   RWLAANGHEQRAERALRWLRADDAAAAHELREWRRAREHEAAAQCSSLRRYIADARYAH
FT                   VRRVVAVLLMGQQFCGINSIVFYGVKLINGALPGLSIAVNFGISAVNLVVTLTAAALVD
FT                   RVGRRPLLQCSAAAMAVASTLMAAGILLESAAVLVVCTFAYITFFALGFGPIPFLIIAE
FT                   LSSPGTAAVAQSYGLALNWVATFFVGFGFPVLNQLIGGYVFMLFGAFAAFMALYVRNRV
FT                   PETRGKHDYREVWQGF"
FT   CDS_pept        374916..376064
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762561"
FT                   /locus_tag="AFL033W"
FT                   /orf_name="AGOS_AFL033W"
FT                   /product="AFL033Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53339.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059323"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000252FEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q754V4"
FT                   /transl_table=1
FT                   /translation="MFPDRNERHRAGARKPRIRCFTGCWACRFKKRRCDEGVPFCALCV
FT                   KHGDACSYDVRLVWLEENMLLVSRTDGQMRSCAVRAPAARRGLSKSEFQTLAQYRRRQA
FT                   GLSLAAQDDATQSSFTISLRRLKVYDNAVEAIHGRPRRYEAGHVVRRLEQCLQQIEAGP
FT                   PGSAGPYGAFPLRPADIAREAAVGRRALAEKFFAHHWWPLISACDNVVLHNVAYAQWIA
FT                   AHVSAVAHDTQDFPTDIFEAIALRSINLPRWLTRLRGASVPEQVVCYMLLSLLLSAQEL
FT                   HASVLRLLRGLRPLPLAACALIANLDMHPAAKQLLFAQVSPADVLEKQLAASVASEMAA
FT                   QRATPGGSGAQPRCIEPDYSSTYLCKRPRPCAPDLANDSTFS"
FT   CDS_pept        complement(376057..377172)
FT                   /codon_start=1
FT                   /gene_family="HOG000167473" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625578"
FT                   /locus_tag="AFL032C"
FT                   /orf_name="AGOS_AFL032C"
FT                   /product="AFL032Cp"
FT                   /function="tRNA binding"
FT                   /protein_id="AAS53340.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="HOGENOM:HBG065808"
FT                   /db_xref="HOGENOM:HBG328185"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0000252FED"
FT                   /db_xref="UniProtKB/TrEMBL:Q754V3"
FT                   /transl_table=1
FT                   /translation="MPDLVSKFESLSLTVPERGPEQAAYEAQWRSVLQTGQVQAKLGEL
FT                   NLFLRDHSFVAGTERPLRVDAELFEAVLPVTREVLAASKDVREQCGKHRHVIRWAKYLQ
FT                   ELLDVPEAERVLVDEAMELPREVIEKKKKEAKGEVAAAPAGGKGKAEDKAEGKAARGKP
FT                   DEATLARLREEAKAKKAAKKAAGAQQQQQQAAAPAKTSPGMIDFRVGFIQKAIKHPDAD
FT                   ALYVSTIDLGEPEGPRTVCSGLAKHIPLEEMQQRHVVVVCNLKPVNMRGIKSAAMVLCG
FT                   SSDGKVELVIPPANSAAGDKVFFEGYGDEEPLKQLNPKKKIWEQEQPHFTTTADLEVAY
FT                   KDDSDAVPLRKLTNARGETFKVSSLAHAHVS"
FT   CDS_pept        377592..379145
FT                   /codon_start=1
FT                   /gene_family="HOG000247854" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762562"
FT                   /locus_tag="AGOS_AFL031W"
FT                   /product="AFL031Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="signal transducer activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53341.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059324"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniParc:UPI0001DB2C6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q754V2"
FT                   /transl_table=1
FT                   /translation="MMTVHRDKAAKRKKTNVACVNCSRSHVTCESQRPCTRCVKKGLEM
FT                   SCVNAPRKRRKYLADVPEDQLPIPLKPADADAGPGMSERDGAAESGSKGPEHQFQDQGK
FT                   IVHKPKFLSNAANLEYSTLSDIIHQDTLLNKIPVSLLYNGTDSPTPPSEALSGTHSASH
FT                   GADVAGSRLSERPVHNVLNSMSSSRFVLRGLLGPQTDSILSSNVDLFKVHFPLVPQAVA
FT                   DGTLDFKRHSQGSMVAKKLRYDKSINQYYLSPACALPEVPNPNKHLCNGTVSFSLESRA
FT                   PDEHQVLYRSDWPHSLRYGTPMEIYTLISEPFCHTSGFHSLLKYLHSRFHRHDLVEMCR
FT                   SIAEFRPIFIASAVDLTEEDMIFMEQSYQRTLLEYDRFITQIGTPTCVWRRNGQISYLN
FT                   DEFCLLTGWTREELLSKMTFIVELLDDNSVREYFKTFSKVAYKDFKGFEQMETCVLLSP
FT                   IEGRTIECSCMWTWKRDVFGMPMMIVGHFLPVIAHPEPRDTDRLADSDFCISAGEGNPI
FT                   "
FT   CDS_pept        complement(379246..379674)
FT                   /codon_start=1
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762563"
FT                   /locus_tag="AFL030C"
FT                   /orf_name="AGOS_AFL030C"
FT                   /product="AFL030Cp"
FT                   /function="calcium ion binding"
FT                   /protein_id="AAS53342.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG483331"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="HSSP:1AHR"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0000252FEF"
FT                   /db_xref="UniProtKB/TrEMBL:Q754V1"
FT                   /transl_table=1
FT                   /translation="MSRINKDIFTLFDKQAKGSISKSQLGDYLRAIGYNPTNALIQEIG
FT                   SRLPEQLTLDDIASVEQSHAKVLEATTEGRLEDFVKAFQVFDKENTGKVTVGDIRYMLT
FT                   GLGERLTDDEVDELMKGVEVDSEGGVDYKKFIEDVLRQ"
FT   CDS_pept        384489..386492
FT                   /codon_start=1
FT                   /gene_family="HOG000000732" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762564"
FT                   /gene_name="RMD9"
FT                   /locus_tag="AFL029W"
FT                   /product="Protein RMD9, mitochondrial "
FT                   /biological_process="sporulation resulting in formation of
FT                   a cellular spore"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS53343.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0030435"
FT                   /db_xref="HOGENOM:HBG059325"
FT                   /db_xref="HOGENOM:HBG204289"
FT                   /db_xref="UniParc:UPI0000252FF0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754V0"
FT                   /transl_table=1
FT                   /translation="MFRFVQQSQLRKAWVPNQLVSASRNSLHAQNSLRFNSAAAVERTA
FT                   ETVGGGANGYGGSGDAGAPLDRAVNKVRSMRRGFKLGKSFPKPPSPESPWYHKVCAFDE
FT                   YVASSLNAGNETGSAGWAKSQRATMFWDSITKAMNLYRELLLSQELTQARVSRLLSLLH
FT                   LALKINRSNMTGLNKKPDYDSQSFHKTMTNYLYASFKEISQDVLNGQVTVAHVGAFHLL
FT                   ESFRELLLAEEAVLLWRTATASEKPGLVAPFMHPDPVGIMLPLLHEGGMTFEEVSALYE
FT                   KCKKGQNPTALHCLTLGMIKVCLSAGANAEAVGLFQEICSLPGNSVSKATLTGIHLAFI
FT                   GECKDLQLATVFFNRALSGETPYKMNIHVSSVKQLLQNIWDQTEDFEQVFDVWRRASNY
FT                   YVGLSSQGIFSSLNSKFFEIFFQKYRNDKVAGMQHLMEIITGYNEIRSVDEPFLNIILT
FT                   KCVVWKDLEIIENIEESYQIYQLSKSIVSCRILLKAMGCVEVSNEQIYSRWLRLVQKAD
FT                   QIGQTYIANADWAALRDATVGYIHQNQKEEHADSPENLATSYPDYNPALEAANASGAFD
FT                   SDLPFGEHGNAIKKHIIATDDRSELYFRMVKKFGQYCRDSKQLVRITRGITESYPFTKE
FT                   YSDNFMSMDVSDIQMPKLVNLRSKSQLFASYF"
FT   transit_peptide 384489..384524
FT                   /gene_name="RMD9"
FT                   /locus_tag="AFL029W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754V0 "
FT   mat_peptide     384525..386489
FT                   /gene_name="RMD9"
FT                   /locus_tag="AFL029W"
FT                   /product="Protein RMD9, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754V0 "
FT   CDS_pept        386889..387323
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762565"
FT                   /locus_tag="AGOS_AFL028W"
FT                   /product="AFL028Wp"
FT                   /protein_id="AAS53344.2"
FT                   /db_xref="HOGENOM:HBG059326"
FT                   /db_xref="UniParc:UPI0001DB2C6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q754U9"
FT                   /transl_table=1
FT                   /translation="MGLIGKKSSQRPKPKLVRVKEVKEEPPIPSIRDPKPKKAIAKRPT
FT                   RPPPTEREKLLLRYLNSHKEQQLQRTKTYLKKRTLQERKDMERQLTLKQREGIRTIEMI
FT                   QKTQDRFLVEGATWNKYLESVAAARRAEERRSRQLGVFQD"
FT   CDS_pept        complement(387429..389996)
FT                   /codon_start=1
FT                   /gene_family="HOG000007229" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931098"
FT                   /gene_name="PRP5"
FT                   /locus_tag="AFL027C"
FT                   /product="Pre-mRNA-processing ATP-dependent RNA helicase
FT                   PRP5"
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53345.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001DB2C70"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754U8"
FT                   /transl_table=1
FT                   /translation="MEPNTPAIDPKKERLARWKQKKQQQDMLRQKSGASSKSSHDQAED
FT                   GDAARSTQPFEGLDKMAERRKRLELWKKKKKEQDEQKWKGDDAGQESATDIPVKGKAAP
FT                   AEDAKAVPRGRKSRKGADPEKRQIWDDSDDELEAPKLKLFKPGSTIQTETPPDEDPEDT
FT                   LDTYMNTIQEKNEVQLLAPREVFDQEDDETTAFDYNRTDNGTGSEFMRLAKLKAKKQLK
FT                   PVIYSADELKPFIKNFYQEPEEISKLSEEEVADLRLSLDNVQVRGRDCPRPILKWSQLG
FT                   LNSGIMNLLTRELEFTVPTPIQAQAIPAIMSGRDVIGISKTGSGKTVSFILPLLRQIKA
FT                   QRPLGGDETGPLGLILSPTRELALQIHEEVTKFTSGDPSIRSLCCTGGSELKRQINDIK
FT                   RGVEIVIATPGRFIDLLSLNSGNLINPKRIVFVVMDEADRLFDLGFEPQVNQIMKCIRP
FT                   DKQCVLFSATFPNKLKSFASKILHDPVYITVNSKSLINENIEQKVEIFSNEEDKFKSLI
FT                   HWLALTQQNLNDEKTIVFVSSQQICDILYNRLEANGFTTFAIHAGKIYTERAWNLKCFK
FT                   ETANGILICTEVLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGSNKGTALTLLMN
FT                   TELAASYILMKSMRDEELNKHHDATVSTLKQMSEKFNKGLKTGEYRLVKGFGGKGLDHL
FT                   GKVYEEKHTEERNQLALEAGLAATEVSVSAPDGGLGDESTSVSIPKLDYTVKKRSNPDG
FT                   TSTYFAHVQVNDLPQIVRWEATKYTTLSSIKHETGCSITNKGRYYPSGQGPQGPSDEPR
FT                   LYLLVESATDQDISLAIDLLESKVRDGVRKSNMQEIRSNKYTI"
FT   CDS_pept        390191..391483
FT                   /codon_start=1
FT                   /gene_family="HOG000242614" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778135"
FT                   /gene_name="ABD1"
FT                   /locus_tag="AFL026W"
FT                   /product="mRNA cap guanine-N7 methyltransferase "
FT                   /EC_number="2.1.1.56"
FT                   /function="RNA binding"
FT                   /function="mRNA (guanine-N7-)-methyltransferase activity "
FT                   /biological_process="mRNA capping"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53346.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004482"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006370"
FT                   /db_xref="HOGENOM:HBG059327"
FT                   /db_xref="HOGENOM:HBG377892"
FT                   /db_xref="HSSP:1RI5"
FT                   /db_xref="InterPro:IPR004971"
FT                   /db_xref="InterPro:IPR016899"
FT                   /db_xref="UniParc:UPI0000252FF3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754U7"
FT                   /transl_table=1
FT                   /translation="MALRPEKPVWMSQEQYDRQYGKLEEPKPPREESKPGDQAKPSAEP
FT                   KSGSEEKTEGSSSSTGQGEERPHFKIQKRRHQNYDLEERKKKQQLNKLREEQLKQHDIE
FT                   MAANKVVNVDQIVREHYNERTFHAKRYNRNYSPIIKLRNFNNAIKYMLIDKYTRPRDVV
FT                   LELGCGKGGDLRKYGACEISQFIGIDISNESIREAQRRYLNMRDLDYQVILITGDCFGE
FT                   SLGVAVQPFPECRFPCDVVSTQFCLHYAFETEEKARRAILNVSKSLKVGGFFFGTIPDA
FT                   EFIRYKLNKFSKEVERPSWGNSIYKVVFANNSYQLNDYEFETPYGNMYTYWLEDAIDNV
FT                   PEYVIPFETLRNLCDEYGMELEMQKPFNKFFVEEIPQWMNKFSPRLREGLQRSDGKYGV
FT                   EGDEKEAASYFYTVFAFRKVKDYVENAPAHA"
FT   CDS_pept        complement(391581..394901)
FT                   /codon_start=1
FT                   /gene_family="HOG000188913" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931099"
FT                   /locus_tag="AFL025C"
FT                   /orf_name="AGOS_AFL025C"
FT                   /product="AFL025Cp"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS53347.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059328"
FT                   /db_xref="HOGENOM:HBG396827"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000252FF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q754U6"
FT                   /transl_table=1
FT                   /translation="MSKLYTNPDESRPHDDPESERSQLLGQRQAYHAYYTYRETPVQRK
FT                   TSSKHDPENPHRNKLGTFDGVFIPTTLNVLSILMFLRFGFILGQIGILGTLLLLVLSYC
FT                   VDLLTTLSISAISTNGTVRGGGAYYMISRCLGPEFGGSIGLIFFLGQILNSGMNAVGLI
FT                   EPLLYSFGLPEGDTVPSVVGLLPRGRVYEFIYSTLILLLCLGISMVGSGTISRAGNVLF
FT                   WLLLISTISIPFSALVVAPFERGNIVYTGPSWETFYGNLYPKFTEGAAGSVRSGKETFN
FT                   SLFGVFFPATAGIFAGAGMSSELRKPSTSIPKGTLWGLLLTFSCYMLVIISLGATVPRQ
FT                   SLHQDLQIVQTISISQVIIFIGEVSTSLFSILVGIVGAAYVLQAISNDKIIPGLSIFAK
FT                   NPSYSLLFSWFLTQVCLLSDVNRIATFITMAFLITFIVVNLACFLLEISSAPNFRPSFK
FT                   WFDRYTAFTGCVVSILVMLIVDPISATVVMLSCAFLLVLIHYTCPAKPWGYVSQSLIYH
FT                   QVRKYLLRLRQDNVKYWRPQVLLLVDNPRTSWNLIRFCNHLKKGGLYILGHVTVSNNFQ
FT                   SQFNELRKQTRAWDKIRDMANIKAFVHIGTGPTLPWGVRNVYLGSGLGGMKPNITVLGF
FT                   FDLTSYYNTLKKKPCSPLSPGDVCRMASYSPKKDGFTDCLGENVGSLPTDDCKNEKKIQ
FT                   IQQWVQIIEDLSLMQSTIAVAHGFKNLILPSKCDSDEVRFIDLYPIQMAARMVNASSEA
FT                   IVTTNFDTYTLILQLGAILVTVPDWKRTHKLRVIVFVEHENERCNEKRRISNLLSILRI
FT                   EAETLVLSLDQFRVYKTIVEGDVHHMDYVNSVLKEDEWWKEISDARRTHKWNRRFTMSG
FT                   NQVTVLESAASKTDYNVSKLQRLGVSLTMNPNIPVPEDVANFFLYDGSDDDELSEFMDT
FT                   SNSFRSYDHEEMNGSAKRVLRRTRSKTRFRDDRSIRSLLPVFSSDSLPKTKIIEDSTGE
FT                   QPSLVPVIDKPAECATRRKEWHCLSSSHTNESSPEDAVELTFNSIPSRAQHLVLNDIMT
FT                   QVSSSSHLIFSTLPIPPLGTHNDKSASVQYVQDLDLWLDGLPPTMLVNSQTMTVTTAL"
FT   CDS_pept        395358..397154
FT                   /codon_start=1
FT                   /gene_family="HOG000248413" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625579"
FT                   /locus_tag="AFL024W"
FT                   /orf_name="AGOS_AFL024W"
FT                   /product="AFL024Wp"
FT                   /protein_id="AAS53348.1"
FT                   /db_xref="HOGENOM:HBG059330"
FT                   /db_xref="HOGENOM:HBG396371"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="UniParc:UPI0000252FF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q754U5"
FT                   /transl_table=1
FT                   /translation="MSRQPRILEFGAEEKVSLPIVKFPPFGLRAALVEKDPVVWVQLLE
FT                   TYVTHLQYLMAQGRIDKIDGTTHERLVVFVQAYLHEMAEEDGKVLSLGMNMEVQRQLAA
FT                   LRRMVLVVVRSCGLLHLQIFSDAMWNLVRVYVREYPDTVRSLIEGSLQPVINTQKASLN
FT                   RVYQVQQYVQQRVEANRFTRGDLKALEDLLAARSRAANTFVLSFVNVQWVNILEGMYQN
FT                   ESNARLRTWARNLGVLSYLSASETRLEELLRELDVVSLQTLAVFPLLGSLLISAAFRER
FT                   MPRLYIKVPFLALVDYDGVEEESPPVDPVAADKAALATVHELFPQVTEYQVAQLLLTHE
FT                   NNVELVINDLFEDPTLLDRIPAEEPTKPPLKVANNRSKKKELRLRDRIVRKQLAYSSNV
FT                   PDEVRNKTLTQALRLLYENDGDERDDTYDEAETLHPTGERVQVEAAESPETSQYDRVEA
FT                   HLWELLKKDKSLFTREQRGSANRRDLKQSTLWSDEQIEGWARMLERSPRRAQILEEKYM
FT                   FAGNVRTGKKKFTQNSGDQPAQSTEEPAASPRSDSNSAGRKQAPPSKKQFAGNERNKRS
FT                   RANHNRKAARGKKVSRGSEPQP"
FT   CDS_pept        complement(397232..398539)
FT                   /codon_start=1
FT                   /gene_family="HOG000113855" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762566"
FT                   /gene_name="NSA1"
FT                   /locus_tag="AFL023C"
FT                   /product="Ribosome biogenesis protein NSA1 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS53349.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG059331"
FT                   /db_xref="HOGENOM:HBG204287"
FT                   /db_xref="UniParc:UPI0000252FF6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754U4"
FT                   /transl_table=1
FT                   /translation="MRLLIGSDDSGCIKELVANRGTNTSEQSALQPLHLEAHLERGLNA
FT                   KAHQMLQISDNECLLARMSGDIELVSWSREPRGGEEDKPVFEVSSFQVMATLGGLLDGE
FT                   KMQELHKRSQRRAASADRFVALFALPGQPQRYFAATMSGQFHFLALADGDLKLQKTFSV
FT                   RGPVEFAQLYDLEETEKLVFAYGGEDNLIKLVEVSRDLEQLEQIWEAKNVKNDRLDLKV
FT                   PIWPAALRFLQPAVSPASEGLNYQFIAVTRHSHLHFYQTTHGRKPFRSVDLLPNREPTT
FT                   SLEVVGDVTPLGNVKSTSFEGFSIITTDTKKSILQFEPSGHLLGKFGGSDIKGFPSYIH
FT                   VQGKYLVEGGLDRYVRVFELKNRNMLLKVFAGGKVSSVLLLDVSDVELPLSKKEKNKRR
FT                   HKRVLDEDQEREEDNELWAQLDGSSKRRKSKPRLDG"
FT   CDS_pept        398785..399900
FT                   /codon_start=1
FT                   /gene_family="HOG000181752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762567"
FT                   /locus_tag="AFL022W"
FT                   /orf_name="AGOS_AFL022W"
FT                   /product="AFL022Wp"
FT                   /function="actin binding"
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="AAS53350.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="HOGENOM:HBG026058"
FT                   /db_xref="HOGENOM:HBG716994"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017383"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0000252FF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q754U3"
FT                   /transl_table=1
FT                   /translation="MSSIVANYKLVKAPIYSHCFNADRTLLAITCDTDCYVYRIGAGHP
FT                   KLVAILADHDKTVTAVDISIHGRIVTCSQDRNAIVWEPLSDGSYKPTLVLLRINRAATC
FT                   VSWAPNGYKFAVGSSARIISVCYYEHDNDWWVSKHIKKPIKSTINALSWHENGVLLAAG
FT                   GTDGYLRVFSGYIKGLDQKEQVAGSPWGDKFPFGAVIREWYHGAWIHDVQWRSQQERLA
FT                   YVTHDGLLAVVDHAGEHAMVENPGGLPFKTLLWASDRSILCGGFSCHPVLFAETATGWK
FT                   FAKNLDEAAPVPRSQRATPDDGDDDDDGTFGMSALKKFKELDLKGKISAQQDRSTHENT
FT                   ITRFFPFAEVAGQLSQVSSSGLDGKIVIYQL"
FT   CDS_pept        complement(399936..400193)
FT                   /codon_start=1
FT                   /gene_family="HOG000000731" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082478"
FT                   /gene_name="DAD3"
FT                   /locus_tag="AFL021C"
FT                   /product="DASH complex subunit DAD3 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS53351.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG059332"
FT                   /db_xref="HOGENOM:HBG398749"
FT                   /db_xref="InterPro:IPR013965"
FT                   /db_xref="UniParc:UPI0000252FF8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754U2"
FT                   /transl_table=1
FT                   /translation="MSDALSTLQRSVLEKYRTLADCLHELNDTLVELNTDSDTNPEQVL
FT                   AQMREIEVKIALVGTLLKGSVYSLVLQRNMGKQAPGGKAK"
FT   CDS_pept        400368..401882
FT                   /codon_start=1
FT                   /gene_family="HOG000159894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625580"
FT                   /locus_tag="AFL020W"
FT                   /orf_name="AGOS_AFL020W"
FT                   /product="AFL020Wp"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="transcription initiation factor activity "
FT                   /biological_process="regulation of transcription factor
FT                   activity"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53352.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016986"
FT                   /db_xref="GO:0051090"
FT                   /db_xref="HOGENOM:HBG182997"
FT                   /db_xref="HOGENOM:HBG320214"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR011442"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI0000252FF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q754U1"
FT                   /transl_table=1
FT                   /translation="MSQQQISPQQLSYTIWSPQDTVRDVADSLGINNVNDDVLRSLAMD
FT                   VEYRILEIIEQAVKFKRHSKRDVLTTDDIARALRVLNVEPLYGYEDNSTRDKEVSYSKV
FT                   TGQGGQTMYYVNDEEVDFDKLINEPLPHVPRLPTFTTHWLAVEGVQPAIPQNPNLNELR
FT                   MTQLPLTRGAIVTALNDTSIQTSVSEEKAEHVSQVKPGQTNEVKPLVKHVLSKELQIYF
FT                   DKVVGALTSKDQTLNAQHMKVAALTSLKSDTGLHQLVPYFIQFIAEQITHNLSDLDLLT
FT                   TMLEMIYSLLSNQSVFLDPYIHSLMPSILTLLLAKKLGGSPSSTLPEDEQDFLEKTIAL
FT                   RDFSSTLLDHVLQKFPQVYKSLKPRVTRTLLKTFLDSNRSFGTYYGCIRGVCILGNETI
FT                   RFFLGNIQNWAKLVFEESASTLEDVQLKETSKISKREVELLVDVMVNALAKLNSDLPAD
FT                   FKPATEDITDADKAKLVSRLGVTISSVLLKRDDARLLIDAIFFGEV"
FT   CDS_pept        complement(401981..403996)
FT                   /codon_start=1
FT                   /gene_family="HOG000141771" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762568"
FT                   /locus_tag="AFL019C"
FT                   /orf_name="AGOS_AFL019C"
FT                   /product="AFL019Cp"
FT                   /protein_id="AAS53353.1"
FT                   /db_xref="HOGENOM:HBG104408"
FT                   /db_xref="HOGENOM:HBG124614"
FT                   /db_xref="InterPro:IPR013948"
FT                   /db_xref="UniParc:UPI0000252FFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q754U0"
FT                   /transl_table=1
FT                   /translation="MDLNTVCLIGSFVRVPRNLIFREEEPRIVEGAALPDTVVREISNK
FT                   DVTIKHLLKTGDGHAYMVERYYGETWVLWCVEAPADQTLYEKSYKRHTRACYEAKTLAE
FT                   WERYDVPELLGFWQEDVDSEPDLNAYEGLELDMKPPDALPAPTAIPAVSGDYADPQLYL
FT                   NKKYYEALFQLRIPLAFFVKSKLARAKNLCSNVSACSYEQAVATLAQDFQEFDRRHSTE
FT                   NFGLLRYALPQFAQELRTRCVKDEFKLNMDHLDDTSSEYAAELAQILKIRELKLQLIMH
FT                   IELIALRSLDGRFRDFEARYENTLTKRSLNTLRTKRIYSRKSTKEKKKAVKPLELDVCE
FT                   QLDLLLDKMAIIDILLSTESSVSKNGAPSNKNETHELLAEHKRNLSRDGKEESSLGFIR
FT                   YVLVPYWSRKIPNVTAFITKKIKGLNMQRCAVSSSQSSSIQEGSTTTSRRSSFSSNLPI
FT                   SSTPSSPSIPTTSSGSSVIAPKLMKAKANSNLLEFLESESSLNKHPSTLSKSNSDLALN
FT                   RLQKRQLAVTDLAASATRNGSYEGIGNSSKGANRSFISAKQSFKRASKRKLDQITESKV
FT                   GANTGVVQITATPARTLAKPAAEKMTIVKSPFSEAKQATSLVEIAATPLRNHPESSSAP
FT                   VFEQHGIVKTPVNRDNDASGINKPKAKKVRRRLFAP"
FT   CDS_pept        complement(404279..405457)
FT                   /codon_start=1
FT                   /gene_family="HOG000000730" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931100"
FT                   /locus_tag="AFL018C"
FT                   /orf_name="AGOS_AFL018C"
FT                   /product="AFL018Cp"
FT                   /function="RNA binding"
FT                   /protein_id="AAS53354.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG059333"
FT                   /db_xref="HOGENOM:HBG397626"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI0000252FFB"
FT                   /db_xref="UniProtKB/TrEMBL:Q754T9"
FT                   /transl_table=1
FT                   /translation="MSDSDVACDSPNALKRKPDDDEKALEAEIKRVALDDVLPGAARIS
FT                   DYIHMRMLCLVKDASMVVGHKGERISRIKLETGTRINVSENIKNVPERVVFLRGSCENV
FT                   AKAFGKISRAINDEDDRESNDRSLPLTVNLLVPHHLMGYVIGKQGSRLREIEDLSAARL
FT                   VAGPQQLPLSNDRVLCITGVADAIHIATYYVGQTILSCEPKYRARKTIFYQPSAMHSVL
FT                   VNNYGIAIQHQQHHQYHPGDKAKRSRSRMSPALPPTPNEVVFHSYLPLGAPVPGSLAVA
FT                   NNLALPHVRIVEGINPQTRITSVVQEIFIEELMVGNVIGRGGKNITQIKESTGCSIQIA
FT                   DPVPGKDERKLTIIGTPIGNQTAVMMINNKIDIDKRNQHNRHSQQHNGHMKT"
FT   CDS_pept        405643..406503
FT                   /codon_start=1
FT                   /gene_family="HOG000000729" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762569"
FT                   /gene_name="SWC5"
FT                   /locus_tag="AFL017W"
FT                   /product="SWR1-complex protein 5 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53355.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG042679"
FT                   /db_xref="HOGENOM:HBG329484"
FT                   /db_xref="InterPro:IPR011421"
FT                   /db_xref="UniParc:UPI0000186178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754T8"
FT                   /transl_table=1
FT                   /translation="MIAPTEPTEGNSRASVLEFDEEGYVESEDEDFDPSKPADDDKEEE
FT                   LSDKSDGDYQEADEEAEKYDYSHIESSEGGLVSTRNARRLQHEREQREKYEHFEMQGVS
FT                   SRAGELWAQLQEESQARLHDTSSVMHAGGEAGKDRMQEEQIMIERAYWFAGEMVREKKM
FT                   VLKSSAEAQEYLNSLKFKPKELVPSTMQEMDGGSKLRRPLKRPPILEQIIAGALKPKLT
FT                   TLEKSKLDWATYVDKEGINEELQLFNKDGYLAKQDFLRKVDGIQNEQYKELRRQELQKN
FT                   GAQGM"
FT   CDS_pept        complement(406542..408656)
FT                   /codon_start=1
FT                   /gene_family="HOG000205560" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762570"
FT                   /locus_tag="AFL016C"
FT                   /orf_name="AGOS_AFL016C"
FT                   /product="AFL016Cp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS53356.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051029"
FT                   /db_xref="HOGENOM:HBG397627"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI0000252FFC"
FT                   /db_xref="UniProtKB/TrEMBL:Q754T7"
FT                   /transl_table=1
FT                   /translation="MLTAVSWADKPALKQVTVRATLVGLFIGSLVLISNFQFGLQTGWV
FT                   SMMSLPSALLACGIFRHIWPLLFAEYPPFSDVENVYVQSIAVAVGTGPLAYGFVGVLPA
FT                   IEKFMTREESGGLRDPGDPFTLRQLLLWSLGLAFFGIFLAVPLRKQVIIREKLAFPSGS
FT                   STALLISVLNSSEILQEVTPQELVQMRRYRLARQEDEQPLVASAASVSPVGSVLSPNYM
FT                   ERREEAPPRPGQYASNVSILLRTFAVSSAYTLLSYFVPYIKAIPLFGRHLSETYLWNVQ
FT                   FSPAYIGQGMIMGFNTVFFIMIGCVLGWGILAPLARHMGWVPPDADINDWEKGVQGWVL
FT                   WSSLAVMVADSVVGFIVLTVKATVKFLLIDNKADALNSFLDDSIESMLLEEQRELDVKG
FT                   EGSIPVKLVNADQEHEVDSKYLVRCTTVISGWIVSSLICVISMIYLFGKDCIPIYSLLL
FT                   ALLIAIFLSILGVRALGETDLNPVSGIGKLAQIIFALVVPRDHKAAVLINLVAGSIAEA
FT                   GAQQAGDLMQDLKTGHLIGASPRAQFTAQIIGASWSIVLSSVMYIFYNKVYEIPSQQFR
FT                   IPTAFVWIDCARLVMGMALPPYALECSIILGSIFAVISLVKNCIDKDKYRWAQWLPSGV
FT                   ALGVGMYNSPSFSIARFIGGMLSYYWLRTRRGDAGAKTNMIIFSSGMILGEGVCSIVSM
FT                   TLASIGTPHM"
FT   CDS_pept        complement(408908..409915)
FT                   /codon_start=1
FT                   /gene_family="HOG000176880" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762571"
FT                   /locus_tag="AFL015C"
FT                   /orf_name="AGOS_AFL015C"
FT                   /product="AFL015Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS53357.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG183531"
FT                   /db_xref="HOGENOM:HBG446629"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000252FFD"
FT                   /db_xref="UniProtKB/TrEMBL:Q754T6"
FT                   /transl_table=1
FT                   /translation="MSAFMARKSNIGPEQSASVEKNNVELEQKVAIQSIRMFLKSKTSY
FT                   DVLPVSYRLIVLDTSLLVKKSLNILLQNNIVSAPLWDSGTSKFAGLLTSLDFINVIQYY
FT                   FSNPDKFELVDKLQLNGLKEIEKAIGVEPPDRGSIHPFKPLYEACCKMIESRARRIPLI
FT                   DQDEDTHREIVVSVLTQYRILKFVALNCREIRYLKRPLHELNIITSTKMLSCSMSTPVI
FT                   DVIQLLTTGGVSSIPIVDEQGKLINVYEAVDVLGLIKGGIYNDLSLSVGEALMRRSDDF
FT                   EGVYTCTMGDKLSTILDTIRKSRVHRFFIVDENGLLTGVLTLNDILKYILYAEN"
FT   ncRNA           410319..410913
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR20"
FT                   /product="AgSNR20"
FT   CDS_pept        complement(410922..412595)
FT                   /codon_start=1
FT                   /gene_family="HOG000195514" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762572"
FT                   /locus_tag="AFL014C"
FT                   /orf_name="AGOS_AFL014C"
FT                   /product="AFL014Cp"
FT                   /protein_id="AAS53358.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG737652"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000252FFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q754T5"
FT                   /transl_table=1
FT                   /translation="MVDTKEPRLSASRSMLLLSSPSRLNVVSSDWSKVEKHNKVMKPRA
FT                   AHGSLSNVTNVAHSAGGGMQRTKLTQAVPPLLRKSSSYFKEEAVKEAAAEEHGSQTYAS
FT                   SDRFIPVRNKGTGARCDEEAEDQDVSPPPNASPSTHLKARTKIVFKQNIAEACGLDMSQ
FT                   RILQYLPQPPQASVKRTIYSIGSRAERYSAGAQPLSKFTRLRKINTNPERILDAPGFQD
FT                   DFYLNLLSWSKKNVLAIALDQSIYLWNGETGEVSLLTEFETETITSVVWSNDDCHISIG
FT                   KDDGNTEIWDVETMSHVRTMRSSLGVRICSQDWLDTVVCIGAKSGEIQVNDVRVKDHIV
FT                   STWEKHTSEVCGIKFRQDGLQLASGGNDNTVMIWDTRQDEPLWVKRNHNAAVKAITWHP
FT                   DVVNLLATGGGSLDRHIHFWNTTTGARIGSINTGSQVSSLHWGQSYEDSHMNREIVATG
FT                   GSPDNSISIYNYDSKVKVAEITQAHESRIVSSQLSPDGTTIATVGGDENLKFYRVFDAK
FT                   RKKSRDHEAESFLEIMGVGKKGDEDSSASLSPKKSSFLIR"
FT   CDS_pept        complement(413068..413718)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059108"
FT                   /locus_tag="AGOS_AFL013C"
FT                   /product="AFL013Cp"
FT                   /protein_id="ADJ41787.1"
FT                   /db_xref="UniParc:UPI0001DB2C71"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGF7"
FT                   /transl_table=1
FT                   /translation="MRGRNPISPDNQRLLNKIVHQLATSLQRQMVEFVDILLDGLTAAS
FT                   TNKRNLVASLVRGTEIPIFDEDDRMVYRDLGFNDLVGIVHLRNLVLELRGPAKPDAPDP
FT                   AYVPRVLRQLDLVRDYFVYLLECLGSYLELPTCTGTYRATLVELLPCFELFFADMRSFK
FT                   RIAAQLLHDARETGASDSSTFAVEDSVLLEIEALERRKLQFRGLVAGLDVRPC"
FT   tRNA            join(414649..414684,414713..414748)
FT                   /gene_name="tRNA-Trp"
FT   tRNA            complement(414835..414906)
FT                   /gene_name="tRNA-Asp"
FT   tRNA            complement(414911..414992)
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        complement(415195..416073)
FT                   /codon_start=1
FT                   /gene_family="HOG000175584" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762574"
FT                   /gene_name="SEN34"
FT                   /locus_tag="AFL012C"
FT                   /product="tRNA-splicing endonuclease subunit SEN34 "
FT                   /EC_number="3.1.27.9"
FT                   /function="nucleic acid binding"
FT                   /function="tRNA-intron endonuclease activity"
FT                   /biological_process="tRNA-type intron splice site
FT                   recognition and cleavage"
FT                   /cellular_component="tRNA-intron endonuclease complex "
FT                   /protein_id="AAS53360.2"
FT                   /db_xref="GO:0000213"
FT                   /db_xref="GO:0000214"
FT                   /db_xref="GO:0000379"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG059335"
FT                   /db_xref="HOGENOM:HBG396297"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016690"
FT                   /db_xref="UniParc:UPI0001DB2C72"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754T3"
FT                   /transl_table=1
FT                   /translation="MPHTKVAISLNSKTGVPLVFDLDDVRRIRGLGVLGTLCGSLPTAA
FT                   QQNLFLTVPLRLMLEDAVWLVLSGHAYFSFDDKLLVQAAGSLTAAEVCRWRQDTERGLE
FT                   QQRELRRREQQLKLAALHRTADETDTQRRLLEQSLFLETENCSKMIAAAEPAGLQLAIL
FT                   REMVAQHLDLGNYLIYRYLREEQYFLSAGGRFGARYVAYPGDPLRYHSHMAVQPAMDYY
FT                   NESLDLLHVVGGGRLGTGVKKLWVVGGVRYREAEAAATAEEQIPPPDTLDRLLATSPPV
FT                   SVFSIEWSGFG"
FT   CDS_pept        416691..420419
FT                   /codon_start=1
FT                   /gene_family="HOG000265623" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625581"
FT                   /locus_tag="AFL011W"
FT                   /orf_name="AGOS_AFL011W"
FT                   /product="AFL011Wp"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53361.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG456486"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000253001"
FT                   /db_xref="UniProtKB/TrEMBL:Q754T2"
FT                   /transl_table=1
FT                   /translation="MTTDPNPENQGPGRRSSRQLAPEFTITPTQLSELHNPKSLAAYCA
FT                   LFGHSENGLCDALKTDKKNGLALADEEVRETARCRRFGANRVPERTARGFLRLMWEAFK
FT                   DKTMIVLMVAAVISFSLGLYEAIGQPPELDDDGTPMAQVDYVEGLAIMAAVAVVVLVTA
FT                   ANDYQKERQFARLNRKKEDTEVVVVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILV
FT                   EGKCECDESGITGESDTIKKVSLAMSLQVYRTVAADNPSADIGSSDNGHSLVPDPMLIS
FT                   GSKLLSGIGHAVVTAVGPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYGSVAAFL
FT                   LFVVLFLRFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALA
FT                   FATTRMTKDGNLVRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFLGSSHFDDISED
FT                   SNCAQSDALRQDMSQHTLNDILANIALNSTAFENKQVADPVITENPYHKPRRSLFPWSR
FT                   NNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRDDPHHIGIASIVQ
FT                   MIPFESSRKWAGLVVRLVDGNYRFFIKGASETIFKSCHYMRSSNDDVIKLSPQKHGEIF
FT                   GLINNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLLGDEYVPTATDRP
FT                   SIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACG
FT                   ILSESEYADHECAMEGPVFRKLSRRQMMDAAPKLKVLARSSPEDKRIFVDILKKMNEVV
FT                   AVTGDGTNDAPALTLADVGFSMGISGTGVAREASDIILMTDDFTSIVNAIKWGRCVSLS
FT                   IKKFIQFQLTVNITAVTLTCVTAVTSTEENPVLTAVQLLWVNLIMDTLAALALATDKPD
FT                   PHILERIPTGRDSPLIAVSTWKMILGQAVLQLIIAFVLHYGGRKLFYPHQVPFTGRDQK
FT                   RLDTLTFNTFVWLQFFKLIVTRKLDEADGISDWRKRITARNLNFFQDLGRNYYFLTILL
FT                   LIGICQVLIMCFGGAAFSIEPLTPGMWVTSILCGMLSIPWGALIRICPDEWALKLYPKR
FT                   LMHIIQHIFGLKFLRGRKKSNNEDMDSHMETSKASDLMAYEAFEKARSEMLNFKESSKS
FT                   GMATYLNPVNIIRKWSHESSDYQSFDDEHSLIASLTMVPTLVGGAVGGFSHISTPLLQG
FT                   SPTSAKSSAKTYINKDV"
FT   CDS_pept        complement(420559..421317)
FT                   /codon_start=1
FT                   /gene_family="HOG000111883" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762575"
FT                   /locus_tag="AFL010C"
FT                   /orf_name="AGOS_AFL010C"
FT                   /product="AFL010Cp"
FT                   /protein_id="AAS53362.1"
FT                   /db_xref="HOGENOM:HBG059336"
FT                   /db_xref="HOGENOM:HBG204330"
FT                   /db_xref="UniParc:UPI0000253002"
FT                   /db_xref="UniProtKB/TrEMBL:Q754T1"
FT                   /transl_table=1
FT                   /translation="MDRHDEILQMFFDEEFVPQAYLDILLSSVDRPLNELQQISASLLY
FT                   RLEYYTGVLTKDLEDTIRRLQKPAELLNYSVTSDDIGNMKTTRLEYYMDTLANSVQSLE
FT                   VDVGKINTELAQLDASYETSTQSVAKITQLELVKSRLQDVLSVFQQLQIILRISVGEKE
FT                   GALQNVDVNEFTVALDTLRDTIIKKLEECLESETATEKNDELLSRIDSFTALKVVFKGF
FT                   NKFYPVYLQFANKIQKAKEHYLSQKVDENI"
FT   CDS_pept        complement(421433..422674)
FT                   /codon_start=1
FT                   /gene_family="HOG000142386" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762576"
FT                   /locus_tag="AFL009C"
FT                   /orf_name="AGOS_AFL009C"
FT                   /product="AFL009Cp"
FT                   /protein_id="AAS53363.1"
FT                   /db_xref="HOGENOM:HBG059337"
FT                   /db_xref="HOGENOM:HBG204331"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000253003"
FT                   /db_xref="UniProtKB/TrEMBL:Q754T0"
FT                   /transl_table=1
FT                   /translation="MKITTFEIQQDFGECIDDVSRGYSDHEEIYINIIPNVDTTIEKRV
FT                   TIVKHGESVEFDAGEGNTFRRVSSDIYEARFGRDNVTCRFKLPSKEYSGKVRSSLATES
FT                   RNLTALAVTQHPEAQYAIGDTEGRLTLHNAEFSDCRSLDGHSGHITSLHYFPSGKVLLS
FT                   ASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNVLSSSKDGSVRLWECGSGSM
FT                   LRAFHRRDRHSDGVNALQVLNVQSHSHNGLGNPLEFGTEDKAFIAGHASGVLTYHDVFT
FT                   KQQLAELPSEFQAACTTLATTNSYFDEASPFYIYAGYENGYVAQWDLRNPIKSVGHVII
FT                   DEGNPVNTLIHHDGKIYLSSGFDCHCELALGEGDSTTATFLVSRDSTVSQYLSDPMAGA
FT                   VWAVGSRSFCAKYS"
FT   CDS_pept        422841..424925
FT                   /codon_start=1
FT                   /gene_family="HOG000162322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762577"
FT                   /locus_tag="AFL008W"
FT                   /orf_name="AGOS_AFL008W"
FT                   /product="AFL008Wp"
FT                   /function="DNA binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53364.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG267551"
FT                   /db_xref="HOGENOM:HBG618684"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004591"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013955"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0000253004"
FT                   /db_xref="UniProtKB/TrEMBL:Q754S9"
FT                   /transl_table=1
FT                   /translation="MLYNNEKSPNAKFSQLITSVAKLALRHTPWPQAKVKKFDQLSVIR
FT                   WMVMSTMTMNTGITTGDLATIFKDRSRYENPVGGQYQCSQTKKAEQVATSKKNLILIND
FT                   GVYHMKALLRGDASQKALTHNLKRGDIFRVLTGEPAVIKEKKKFVLIIDDFEITQRDAS
FT                   VNPHTEFIDAYFAAHANEVINFDGMGTIDRDMSPSPAIASRTTSMQQQQQQQQQQQQQQ
FT                   QQQQQQQQQQQQQQQQMHSAQAQQQSNQFMGSGSQKTKPIFAIEQLSPYQNMWTIKARV
FT                   SFKGDIKTWHNQRGEGKLFNVNFLDTSGEIRATAFNDNALKYFEILQEGKVYYVSKARI
FT                   QPAKPQFSNLKHPYELQLDRDTVVEECFEAADVPKMNFSFIKLDQISSMEANSNVDILG
FT                   VIQTVNPPFEMIAKSGKKFNRRDIVIVDETGYSVNVGLWNEQAVDFNLPEGSVIAVKSV
FT                   RVTDFGGKSLSMGFSSTLHPNPDIPEAYAIKGWYSSKGTSTTFHSLKMEGGDRNSMRYV
FT                   ADRITIGKAKDDNLGRSDKGDYFNVRGAVNFLKVDNFAYPACSTEGCQKKVIEQTDGTW
FT                   RCEKCQVDHPAPKWRYMLTASILDETSQIWITLFNDQAEKLLSMDANTLTELKNTDPEK
FT                   FQKVTQSVQMNEYDFRVRAREDTYNEETRIRYTVTNLYPLRWKVEADYLAGELTKAFLS
FT                   "
FT   CDS_pept        complement(425430..427085)
FT                   /codon_start=1
FT                   /gene_family="HOG000195514" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625582"
FT                   /locus_tag="AGOS_AFL007C"
FT                   /product="AFL007Cp"
FT                   /protein_id="AAS53365.2"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001DB2AAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q754S8"
FT                   /transl_table=1
FT                   /translation="MEGTGSPFMDNTPSSSPIKKSQSANRVAKRPISGSSSASSLLSSP
FT                   VRRPRSSNTYTDRLMPNRTNMDLNTVLSIGCTSSLTYVSAATSDNQLEFQKERQAHQTF
FT                   DTILKNELFGDRLSQDADANEDNIERIHYTASRSAEGPSTPPKSNSSDHSTSSAPTTPK
FT                   RLTFAGGDGLQRPMSNNVRAASLLTYRERNGTRNSTASLIHNQFLNSVSPVRPDTQRLL
FT                   LSPGKKLREIAKVPYRVLDAPSLADDFYYDLIDWSSTDMLAVALGKTVFLTDDNSNEVV
FT                   QLCETDDEYTSLSWVNSGSHLAVGLGNGLVELHDVVKQKCIRTLSGHLDRVACLSWNQH
FT                   ILSSGSRDHKILHRDVRMPEHYFETANTHSQEVCGLKWNVDENRLASGGNDNVVYVYDG
FT                   PSKKPVLKFTEHNAAVKAMAWSPHRRATLATGGGTADRRLKIWNVNSGVRLNDVDTGSQ
FT                   VCNMVWSKNTDEIVTSHGYSKFNLTLWDCPTLEPLAVLKGHSFRVLHLTLSTDGTTIVS
FT                   GAGDETLRYWKLFGKSKFGNQSDSVLTSAFSKLR"
FT   CDS_pept        complement(427351..428652)
FT                   /codon_start=1
FT                   /gene_family="HOG000204856" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778136"
FT                   /locus_tag="AFL006C"
FT                   /orf_name="AGOS_AFL006C"
FT                   /product="AFL006Cp"
FT                   /protein_id="AAS53366.1"
FT                   /db_xref="HOGENOM:HBG059338"
FT                   /db_xref="HOGENOM:HBG595571"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000253006"
FT                   /db_xref="UniProtKB/TrEMBL:Q754S7"
FT                   /transl_table=1
FT                   /translation="MANRLLQDPFSVLKEYPETLTYTFEIPLQCDCLEFSPGGDYLAVG
FT                   CSNGSLVIYDMDTKKPISVLGNHGGGHVRAVQSVAWSQCGRYLWSSSRDWRVKMWDLAA
FT                   VGRQNQEYMFDGPVWMCRVLAGPQPRCIATVVEERWALLVDFSAGAADVREVRDPAEDA
FT                   AEDRGNTLVTCLHPRAQDVVITGTSKGWVVIYRLLADGGFHALHSEFISNCNIKNIEVA
FT                   PYGERMAINCSDRTIRQYALVLHDTSASLQLEHKYQDVINKLQWNSVAFSNHAGEYLVA
FT                   SAHGSSAHDLYVWETASGTLVRVLEGPEEELLDIDWNYYNMSIASNGLESGNVYVWSIV
FT                   IPPKWSALAPDFEEVEENIEYREKEDEFDQLDELGHQLEQDEAEEVHIDLRTRDRFDVR
FT                   GNDLAVQRFIIPTDYESILLINRMQEDHADRQST"
FT   CDS_pept        428819..429475
FT                   /codon_start=1
FT                   /gene_family="HOG000160228" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931101"
FT                   /locus_tag="AFL005W"
FT                   /orf_name="AGOS_AFL005W"
FT                   /product="AFL005Wp"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53367.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG372468"
FT                   /db_xref="HOGENOM:HBG559015"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI000018344C"
FT                   /db_xref="UniProtKB/TrEMBL:Q754S6"
FT                   /transl_table=1
FT                   /translation="MNLKTFLQVLVLGMLPLQVSGFYFYVNGGDRKCFHSELMKDAVLN
FT                   LKYNVQSYDSQSGTYRDMRDGELMMMIDIEEVFDDNHRVMHQKLPAYGTTTFNAVDSGE
FT                   HKVCVQPQFQGWMARTKTKITLDFEIGSDLLLDPKKKDKLQYLHSRVLQLGEKVKAIRN
FT                   EQRLVREREAQFRDASESANSWVVWCAVMTLFVLGGTCFWQVNHLRTFFMKQKVL"
FT   CDS_pept        join(complement(431791..431904),complement(430215..431729))
FT                   /codon_start=1
FT                   /gene_family="HOG000142055" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778137"
FT                   /locus_tag="AFL004C"
FT                   /orf_name="AGOS_AFL004C"
FT                   /product="AFL004Cp"
FT                   /protein_id="AAS53368.1"
FT                   /db_xref="HOGENOM:HBG059339"
FT                   /db_xref="HOGENOM:HBG512050"
FT                   /db_xref="UniParc:UPI0000253007"
FT                   /db_xref="UniProtKB/TrEMBL:Q754S5"
FT                   /transl_table=1
FT                   /translation="MQKMYSRKRTSSAVEHSAPYRKPVIAPSVGNASTSTQKGASLLQR
FT                   VKSFFHGDERLSHLSRSDDASSDQKLYHVPGGFYDVDARNPVVKLPSALAVGTAESSGN
FT                   FKATLSDGEEDEPNISNAKLAQFFREKGDAPLTEIEYEGVMSLIKRSQSVASTPDGKNI
FT                   LPKEVSELRVLRSTSDTTYTPLRAPSYTPKYGNIALHNTNSAGTSTPPTRRRVFDYSRL
FT                   PSPYRTTVYKYSAAKVPSQGTTTRKTSENAVSKPVKSTHAPKKLSHTASALISLLDGEG
FT                   KADISESSAYASLSNPYSSHISHMHRGRPSSAAKTIEPSTKPVNTETTPITSTALEELS
FT                   NAKQAVPPHATQPVSGFKPSRPSSLRVEVTVEKSPEKSPRQPVPQSSKFNFSFQKPKDH
FT                   NVDTLSEKPHTIPDATSTFSFQPLAKVEESNTHGATLNGPMENNISGSSLQSNGSFNFS
FT                   NGIQKVSQVHKSEDKHNTTSRTPFAFSFSKPDLPKDDSSFAENTAASAEAVPFHFDFGT
FT                   LPVSGIDPSSVDEEKVKRLKSTFTF"
FT   tRNA            join(complement(432123..432158),complement(432047..432082))
FT                   /gene_name="tRNA-Pro"
FT   CDS_pept        complement(432400..433347)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931102"
FT                   /locus_tag="AFL003C"
FT                   /orf_name="AGOS_AFL003C"
FT                   /product="AFL003Cp"
FT                   /protein_id="AAS53369.1"
FT                   /db_xref="HOGENOM:HBG059340"
FT                   /db_xref="UniParc:UPI0000253008"
FT                   /db_xref="UniProtKB/TrEMBL:Q754S4"
FT                   /transl_table=1
FT                   /translation="MRFALILFATGLVQCALGISLHWGHKDVSPDTKNYEIASVIWDRL
FT                   ERLNSSSLTKEQVLFIKTAAIVGSLSPKEISQHSFPWQTATSHNIKENSKRLKEQIGQG
FT                   LSLAYLNVKDMADIEYLKEQVYQMEMMWDELTGIIHHALKVTIRNRHKELNWLVNTYLK
FT                   FYIFSAEKINKKLAVDKGEPKKMVGSLMSIQLEAHKLMNQYIKMLQRKKTNVEEKPQWR
FT                   SFDSPQPLPESEPMQVEKLDLDHLAKDVPLDKDNTLALLLKFKVLSAYQIFPTVPFCAV
FT                   ANIIFVAGNLCGKLFAGVTSRQAEILRELSKRMA"
FT   CDS_pept        join(complement(437210..437273),complement(433755..437146))
FT                   /codon_start=1
FT                   /gene_family="HOG000142056" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762578"
FT                   /locus_tag="AGOS_AFL002C"
FT                   /product="AFL002Cp"
FT                   /protein_id="AAS53370.2"
FT                   /db_xref="HOGENOM:HBG059341"
FT                   /db_xref="InterPro:IPR007309"
FT                   /db_xref="UniParc:UPI0001DB2AAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q754S3"
FT                   /transl_table=1
FT                   /translation="MVLAPDEIVQRLCEEIAYNKGRISFKGLWELANPFVELKTERIKK
FT                   FVYDSLLASSDVVLLHNGKSVAPLTYDDAVAEEPSLELAITEDKLWTVLTGYNKKESAI
FT                   GGLAFELLMEVAKRREHGVNTMDLATITKQDPRSITGRIKKLGNLVTGVQIIYKGHVVK
FT                   LIKFYKFADEKPRRLYVNMRQYLPNIVETVKKSKNGVRQVVDLKRELKFDKDKRLNKAF
FT                   IAAIAWLDEKKYLKKVLVVSPSNPETKIRCVQYLRDYITEERDGADFENDSTDDGEEED
FT                   DDAIEGFDNGNATGLLQETNLLIQDNTISAKEFSMNRFFPLQNQTYALAEKRGTQGVST
FT                   MECVNTIVGSDYRRSFTKNSEYYLQTIGKSIPKNAHNLGFNLVRVYDFEGKKKFYRLFT
FT                   EHNFRLFSGSTDQAPTITIPHIHGQKSSLSKLSEANFMPLNATLRFTNKDDQEVFFWHG
FT                   ELDIPATSTTTARGRKRKSLQQANVRTPKKKKPSVEANLIDLESTNTTAEHAVIEEGAG
FT                   EHEKLVCIGGFTANSLKSIQRQKAILDIVRKYGGVTYVRDQLYEDVSKYLGTKMILDKK
FT                   TLRGDVELLVAANKLKVNVKPNGRRVLYLPSMDGEQIERYLNSVRDTKVAFSKDIIKNT
FT                   DIYFFDQTEHNRFHRGTKSAERVKAFQNKSKRADKKSTTGAVKNTINTKPRRVRTKKRP
FT                   ASTGPVAKNGMKPEPTEKNALPKKRSSKSTSKSAETFNVSTKEGNRVLIMAAVITKSIK
FT                   GQTLWPEIAHLFPNNSVEHLKKQCTLRRVKMGHSGWRALMEKWRKIMVNAVRNERATLE
FT                   DAEQLNLVKLVHLWMAEDDVGDRQPLKLYKDYEENHRRYTLIKNNQRASVHVSLAMSSM
FT                   IQRESYLLKKTYTYSAQKSGYYNPVEEEIRSVVRSILISNSSIETDDIGILKAFNSEQV
FT                   DKVILDMARERHISFVGSSKLQLTDVVLDLLNMKGKYWELQKAARFKNKVLQLLNSEKA
FT                   LAIGEEPSNHSMPVLLDMLECGVIDMTTVPLAVKENSMYYATRKYEVTALTPPLIFFAK
FT                   KKLVEPKLPFDAVPRGQPCSRLWVDPQGKINEQVWKQLVFMTIHEILFNPGITLATLTK
FT                   RFRKLVSHREMEDIVQWLKNLALLDETSFDGFIIKSDWYLALGS"
FT   CDS_pept        437499..438245
FT                   /codon_start=1
FT                   /gene_family="HOG000240418" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082479"
FT                   /locus_tag="AFL001W"
FT                   /orf_name="AGOS_AFL001W"
FT                   /product="AFL001Wp"
FT                   /protein_id="AAS53371.1"
FT                   /db_xref="HOGENOM:HBG138683"
FT                   /db_xref="HOGENOM:HBG381854"
FT                   /db_xref="InterPro:IPR019369"
FT                   /db_xref="UniParc:UPI000025300A"
FT                   /db_xref="UniProtKB/TrEMBL:Q754S2"
FT                   /transl_table=1
FT                   /translation="MSDSDSDLELQLSSHALAALQEFRQEEEERQKEFERMYNNADEEF
FT                   QTKKRQQGMELFKEDWQLSQFWYNEETANTLAKALLDGADEDTCIAVVSAPSVYAAILK
FT                   LNDDEIPTKHIYLLEFDKRFELLAGTDKFLFYDYSKPLDFDSKLKGKVDRLLIDPPFLN
FT                   EHCQTNSSITAKALLAPKTDTKTKCGVLKHRLISCTGERMRAIIKKNYPDTEITTFLPE
FT                   HMNGLSNEFRCYANFEWDGWSFSKKD"
FT   CDS_pept        438759..439811
FT                   /codon_start=1
FT                   /gene_family="HOG000167989" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762579"
FT                   /locus_tag="AFR001W"
FT                   /orf_name="AGOS_AFR001W"
FT                   /product="AFR001Wp"
FT                   /function="3-beta-hydroxy-delta5-steroid dehydrogenase
FT                   activity"
FT                   /function="binding"
FT                   /biological_process="steroid biosynthetic process "
FT                   /protein_id="AAS53372.1"
FT                   /db_xref="GO:0003854"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006694"
FT                   /db_xref="HOGENOM:HBG535943"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000025300B"
FT                   /db_xref="UniProtKB/TrEMBL:Q754S1"
FT                   /transl_table=1
FT                   /translation="MPALESVLLVGGSGFLGLHLIEQYWNLTPRPDIYVFDIRPLPEKI
FT                   STQFTFDPTKITCYQGDLTSAKDVEHAIKSSGVRVLVHSASPMHGNSQEIYEMVNVEGT
FT                   KNLLDVAKKCGITAFIYTSSAGVIFNGQDIHNADETWPIPDIPMDGYNETKAIAEKMVL
FT                   TANDPQNGFLTIALRPAGIFGPGDRQLVPGLRQVAKLGQSKYQLGNNNNLFDWTYAGNV
FT                   ADAHVLAAKKLLDPANASSVSGETFFITNDAPTYFWALARAVWKADGHIDDKVVVLNRP
FT                   VALVVGYLSQFFTNLLGKESGLTPFRVRVVCATRYHNISKAKKLLGYKPCVDLEEGIKR
FT                   TLLWMDEDAS"
FT   CDS_pept        complement(439929..443621)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762580"
FT                   /locus_tag="AFR002C"
FT                   /orf_name="AGOS_AFR002C"
FT                   /product="AFR002Cp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS53373.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124227"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000025300C"
FT                   /db_xref="UniProtKB/TrEMBL:Q754S0"
FT                   /transl_table=1
FT                   /translation="MGSQERTPTSFLEDSECSDKPCAPISCSPQGERSAARPYEMKMLG
FT                   QYSPFDDQKTSAVNWASLQQIYPALSFYGGPSSIFSTPLYLLVGTEKGPVLIFNHKQFL
FT                   QVTLVPQATAFQSCVSLIRISDDGTYIAVAYSSGDVFIWDLNRGPEYPSNHIISILHIN
FT                   HHQGYTINGLGFLPERHTGVVISDTRGQVWLHRGSRGKLWQLTCKSKSLLNINSMKSQL
FT                   LASEPSPRLSEYPELQLVAVLCHDSLTIISVNPILATQWFHSLRLNETVSSGFVAWSPG
FT                   ASSLAYALGSKVHTVNIEGFTRDRVIVSKEEPWSWNTTETVAMVQWLALNTLCVLSSGG
FT                   MMTVLNTTMAAPVLMSVDLSVQGFASPSQRSLTCLDKQIFFLTKYLVKHGKFLSWTDLL
FT                   LQYVQTGNYCGAHKAIGYLVTHGAGIAALVQLSDDSEERKSQLTQPFRNLSLASVKFLI
FT                   NQESVEYAKFYDLLSLIIEVGSLFEKSLTQILEDIFELLDHTHSDAFYDALSNQILEGT
FT                   PFSLPPFLLKEVLQYYAETKNLKMIELLIVTLNQSSLDIDMAVKICRKFNLYGVLMHLW
FT                   NNIFDDYLTPLVDFICKLTKQDEKCAILDKDDPNPMFDIYDYLSCILLGLQYPVRTIIS
FT                   ADTSLRAKHQIYSFLCSGTALKWPTDSKDKLFTTDNPELEPAYPYLQVLLKHDPKKCLS
FT                   MFYKVFDDPFLNEDRVEDSDAHAHHLQISRQFLVDVLLELLKTSNDVYRKVLIAVFITR
FT                   AVPKFPQFLTVSHATLDELVSIMCTSNINELKNECEQSLECLFASYKPSNMDELIIYLK
FT                   DSGYDRVLFYFYKNIPRPADYLRLRIESQDLQQSKFTILDVMSESISLTMSGTSERSDV
FT                   IKVIRENINTILILEQVDAIAEVLVSLDGGVEDIINQIISGEYKKRFLEKIFELNRTEV
FT                   MDPEFQHLYIQLCCEQCDFKALRKWLRRIDFCKLDVCGVIKILEEFRDRESIIFIYMKL
FT                   GSFVEALNVSDSAFVDAIAEHDFKQAETFVQLGIDICENSTDAATECWTKLLVSIIKNY
FT                   SFIAEGGKHTERDLLQHVILRLSLWETTNPGRNESPFGDILVNVLSKQDITGTKIHLIR
FT                   EVIIDLLKAHIVDEHIQQLIMKIVDNSAGTVINEYIEKLESGWSISNYECEVCGRRIWG
FT                   VGIATQEFLDWKSSELSRGTELERVSTATGLIIFRCRHGFHERCLRNMGQSQDSYSCLA
FT                   CYEDK"
FT   CDS_pept        join(complement(444600..444679),complement(443802..444342))
FT                   /codon_start=1
FT                   /gene_family="HOG000207273" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778138"
FT                   /locus_tag="AFR003C"
FT                   /orf_name="AGOS_AFR003C"
FT                   /product="AFR003Cp"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="eukaryotic translation elongation
FT                   factor 1 complex"
FT                   /protein_id="AAS53374.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005853"
FT                   /db_xref="HOGENOM:HBG020880"
FT                   /db_xref="HOGENOM:HBG714747"
FT                   /db_xref="HSSP:1B64"
FT                   /db_xref="InterPro:IPR001326"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR018940"
FT                   /db_xref="UniParc:UPI000025300D"
FT                   /db_xref="UniProtKB/TrEMBL:Q754R9"
FT                   /transl_table=1
FT                   /translation="MSFSNFSKIETVQELNSFLADKSYIEGTSATQADVAAFKAFQETY
FT                   PEFSRWFNHIASKQEEFESLPAASKAAAAEEEEDEDDVDLFGSDDEVDEEAEKLKAQRL
FT                   AEYNARKAAKPKPAAKSIVTMDVKPWDDETDLEEMLANVKSIEMDGLSWGAHQWIAIGF
FT                   GIKKLQINLVVEDAKVSLDDLQQLIEEDEDHVQSTDIAAMQKL"
FT   ncRNA           complement(444397..444489)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR18"
FT                   /product="AgSNR18"
FT   CDS_pept        445060..446211
FT                   /codon_start=1
FT                   /gene_family="HOG000074513" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931103"
FT                   /gene_name="SFH1"
FT                   /locus_tag="AFR004W"
FT                   /product="Chromatin structure-remodeling complex subunit
FT                   SFH1"
FT                   /biological_process="cell cycle"
FT                   /biological_process="chromatin remodeling"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nuclear chromosome"
FT                   /protein_id="AAS53375.1"
FT                   /db_xref="GO:0000228"
FT                   /db_xref="GO:0006338"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059342"
FT                   /db_xref="HOGENOM:HBG202542"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="InterPro:IPR017393"
FT                   /db_xref="UniParc:UPI000025300E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754R8"
FT                   /transl_table=1
FT                   /translation="MSQLLPQAYLTNFHNRIRNEDVPLFITAAPTRNHKRAKVVNYSEY
FT                   DNDLLLDDFIEQDQNDDDEKVHSDNGKGEGEEVGHEDAVASNNNLPDLEQQDDPTGILR
FT                   YPRIRETFLQSKIAVRYEQVLEAGVGGSGEAVGIAEDEGAGAYSSSSQPVVIPIRLNLE
FT                   HNGHKIIDFFTWNLNDHSLTLEQFAQIYCQDLDFAHNLSLQNQIVAAINDQLQEYETLA
FT                   SVVVPDLHVIINLTCNLDSKLYEDNFEWNLNDQTLSPEQFAELVVQDLGLTREFMPAIA
FT                   HALYESILKIKKDWLEGHLNPEHVANGAAFGCLSGIRLDIDTLGSNWCPKVEVLSQWEI
FT                   EKREIEKERNMRRLKRESAKVDDRLARRRGKRRMDDLETTMRI"
FT   CDS_pept        complement(446479..448620)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762581"
FT                   /locus_tag="AFR005C"
FT                   /orf_name="AGOS_AFR005C"
FT                   /product="AFR005Cp"
FT                   /protein_id="AAS53376.1"
FT                   /db_xref="HOGENOM:HBG059343"
FT                   /db_xref="UniParc:UPI000025300F"
FT                   /db_xref="UniProtKB/TrEMBL:Q754R7"
FT                   /transl_table=1
FT                   /translation="MANNSMRNGSSQLGPDTALSLSASMCPEHGSASYNQITLKEKLRE
FT                   HFRMPAGFRQTFKQTYYEKLRRAQLNLVHASESYHDACEGARFKFYRALADTRQVLHEM
FT                   RDAIDNIRVEAQLWRYDHINAPKLDSLFRYESLKSRSIIHRIGPGSGDEQRFHSGEVQK
FT                   DKSRAVCQAPHPSPKSSNRTDTSDNTISLTTDEDAFEGNDIICSAPLKLPHTDIKNVDV
FT                   LHRSASAPVELINDSDIYLSRCPTVNDSANSTYADTGLHSRVLDSETQIETVRKITDIM
FT                   IRMFDEYMNDNNLDTDQRIPSLAMHESRPVTFSSHPTDLVSSNDSNTVAMPLPRPRSSV
FT                   CNEIDRLNSMIESAISIYNRYSEEGLQSSIYNITDANDQNTNQSLRYSALENSNSGFST
FT                   EKSNSLSLRHYPNEAMGTMKDILDRVVNQLNQFEGSETSLCLPDSENSAGKAETVGSQF
FT                   LDPTLKSVLAPVVLQRVPEGVEVPLWCTVRHTKQDLLQIEEADEDQEATNSLEYNSEQS
FT                   VLFDLSDTPLICTLGKPSLEAANCGTMKTIDEDRIYDDIYAFERTMFSQMPLSLKLLFN
FT                   EYPPYIYEKRLLRPLPPSLKVLFQDPEHEYEWKNTDELLLKPHHATIDSNWEFPNMYPF
FT                   LVKGQATQPAAGLFFGKCWFCGHHIITKLHNCRRENLKKHLQHTADNVKFHLVDFCEDI
FT                   KLEIDWVLYKFKYELFAES"
FT   CDS_pept        complement(449035..449763)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625583"
FT                   /gene_name="GET1"
FT                   /locus_tag="AFR006C"
FT                   /product="Golgi to ER traffic protein 1 "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53377.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG103396"
FT                   /db_xref="HOGENOM:HBG124248"
FT                   /db_xref="InterPro:IPR007514"
FT                   /db_xref="UniParc:UPI0000253010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754R6"
FT                   /transl_table=1
FT                   /translation="MHTEVCLPSVRLKAQLRTEIRLLLRSSKTSDKACTAKMDYWILLV
FT                   LAFLVADKSWHLTGLLATKLTSPERLQQLIRERQELHQQQQSLSAQDHYAKWTKNNRRL
FT                   DVLDRDIARVRKNYLESVEATKARLAKLKLLVVTVPFTALKFYKGKLPVYALPKGMFPR
FT                   FIEGTLEHGWLYMALAPLNMKQFSEGASVAVSLGIWLFALLRVLGAIEFVLETLREQNP
FT                   QVATETAKVHARTAQAASAN"
FT   mat_peptide     complement(449149..449712)
FT                   /gene_name="GET1"
FT                   /locus_tag="AFR006C"
FT                   /product="Golgi to ER traffic protein 1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754R6 "
FT   sig_peptide     complement(449713..449763)
FT                   /gene_name="GET1"
FT                   /locus_tag="AFR006C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754R6 "
FT   CDS_pept        450058..452616
FT                   /codon_start=1
FT                   /gene_family="HOG000248489" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762582"
FT                   /gene_name="DOA4"
FT                   /gene_synonym="UBP4"
FT                   /locus_tag="AFR007W"
FT                   /product="Ubiquitin carboxyl-terminal hydrolase 4 "
FT                   /EC_number="3.4.19.12"
FT                   /function="cysteine-type peptidase activity"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="late endosome membrane"
FT                   /protein_id="AAS53378.2"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="GO:0031902"
FT                   /db_xref="HOGENOM:HBG191708"
FT                   /db_xref="HOGENOM:HBG395781"
FT                   /db_xref="HSSP:2GFO"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI0001DB2AB0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754R5"
FT                   /transl_table=1
FT                   /translation="MPHIQESRVWCRSISQLSHLAEQFVTENGTESTDMKLLLQQCVDT
FT                   LSNYQDECKKIKSVSKPVPSKELYDLYETAYVYFKIVSLIVLNKIPKLEEYARAKSDAV
FT                   DRTGKQLLEIYNMLVNRLVKDDRIAEIKRFVKENSRRDPEAKNEQIGVESGKSIPATLL
FT                   RNLLMGPSASGTVLLVDVRPRLDFMRCHIKSSSIICIEPVSFKESYTDIDLGKKSMITS
FT                   PDAEIALFQDRDKFDYIVVYTQDSEKNKHNVQQQQLLVDLLINRSFEKALDRTKVFILA
FT                   GGFSEWSNAHPDFCVSSQGDSVYLNGDTSGLSLQLMPQTTPQKQYNNMFQTMLSGPTDV
FT                   HGIIRNPHNFPTQQKSKLKRVPSFRDYFRSSSSSSNINERPGSVPPQLSNGSTIYPETP
FT                   KLMTNDEYMKSLPQLSPITARAITSPSRALSAVGVSKSSASNSISSLLANSGSASPMKP
FT                   PDTPLPFTDSIKTLGQQNLTVAVSNLNFSVGLVNCGNSCYMSCIIQCLLGTQELCTMFL
FT                   NNSYQNHINLNSRLGSKGLLARYFSQLIHQMYQYGKDIRKKMGNEKTAVIPTQFKIACG
FT                   SINSSFKDNTQQDCQEFCQFLLDGLHEDLNQCGNNPPLKELSEEAEKMREMMPMRLASA
FT                   IEWERYLTTDFSVIVDLFQGQYASQLQCKVCQRTSTTYQPFSVLSVPVPSTRTCTLTDC
FT                   FTEFTKIETLEQEEQWSCPSCKKRQPSTKKITITRLPRNLIIHLKRFDNMLNKNNVFVS
FT                   YPSVLDLTAFWANDYDKKVTNNNVELPSRGQVPPFNYQLYGIACHDGTLRAGHYTAYVN
FT                   KGAVLGWCYYDDTNWRQIRSAREYITQNAYVLFYHRIHST"
FT   CDS_pept        complement(452689..453561)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931104"
FT                   /locus_tag="AFR008C"
FT                   /orf_name="AGOS_AFR008C"
FT                   /product="AFR008Cp"
FT                   /protein_id="AAS53379.1"
FT                   /db_xref="HOGENOM:HBG059344"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="UniParc:UPI0000253012"
FT                   /db_xref="UniProtKB/TrEMBL:Q754R4"
FT                   /transl_table=1
FT                   /translation="MEFAYEEAAIAQQEQNDAANPHDERTEQVFHTLERQVEKQYQRTA
FT                   DAIKNLMNDDEYVELQLPLDANLTEKAQSVLNSLDKNLHTVEETAQSYWNQVSQKSFWS
FT                   SMTGTISGKLNNVVRFVEGGSDDVSTTNKSTARDAGSRTAAQLWQLATDQNLYLAYKDP
FT                   VPEINIEERTEEIADLLKQDEALRKLMNTIVPTRIKYATFWAIYFSKRDKLLSIEENRR
FT                   SVLEGYDMKSNLKEELTWDDDDEDYEEVVEITNTKGEVETRIGTVSRTKPLPKDNSESA
FT                   AESDDDEWE"
FT   CDS_pept        453738..454364
FT                   /codon_start=1
FT                   /gene_family="HOG000248488" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762583"
FT                   /locus_tag="AFR009W"
FT                   /orf_name="AGOS_AFR009W"
FT                   /product="AFR009Wp"
FT                   /protein_id="AAS53380.1"
FT                   /db_xref="HOGENOM:HBG253090"
FT                   /db_xref="HOGENOM:HBG527347"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="UniParc:UPI0000253013"
FT                   /db_xref="UniProtKB/TrEMBL:Q754R3"
FT                   /transl_table=1
FT                   /translation="MSDKNITSMQLVSPLNFSCVQPKLYRGSYPRPINLPFLRTLQLEY
FT                   IVSLTPEPITNDPILKNFCEAQGIEVFHIPCNIDKVSKGKPKIKRKKKQVPIEYDVVVK
FT                   CAQFLINKNHYPCYIHCSNGQLVTSLVIACLRKLSYWSTVSIFNEYLTYMSSINIHERE
FT                   FIESFNSEIEISGLDMTEKVPWILASNMKSNSENDLLPSLRFHSI"
FT   CDS_pept        complement(454393..455811)
FT                   /codon_start=1
FT                   /gene_family="HOG000234736" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762584"
FT                   /gene_name="DDI1"
FT                   /locus_tag="AFR010C"
FT                   /product="DNA damage-inducible protein 1 "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="protein transport"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53381.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG373792"
FT                   /db_xref="HOGENOM:HBG737457"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019103"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI0000253014"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754R2"
FT                   /transl_table=1
FT                   /translation="MNVTVSNEVTDELLGPFELSDDITLMDFMALIDFDENEQALWHNM
FT                   RQLKSVDREKTLMQLGIVGESLVVVKAIKKKATEGSTTRASKASAKAAKAAAKAAAVAR
FT                   DTPAEQATTVSPVAQVPVAVSPAVTAAVPTQPTSPSGGPAAANDIITPEDEYIETFRKS
FT                   LLNSPSLASNIPIPGVNQLIQDSQLFKQLIGPVLLHRRAQQQAANQMGTAQSEYVKLMS
FT                   NPDDPSNQARISELINQQEIDEQLHKAMEYTPEVFASVNMLYINMEINGHPVKAFVDSG
FT                   AQSTIMSTALAERTGLGRLVDKRFRGIARGVGKGEIIGRVHAAQVKIETQFIPCSFIVL
FT                   DTNVDLLLGLDMLRRYQACVDLKENVLKIAGIVTPFLPEAEIPKHFDMDPSAEATNLPS
FT                   TSPLGNQKAAPEARDAGVGSALLNRSTPATAERTHAEEDVRRLMDLGFSRAEVLKALDH
FT                   SQGNAEYAAAFLFQ"
FT   CDS_pept        455988..456845
FT                   /codon_start=1
FT                   /gene_family="HOG000113466" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762585"
FT                   /locus_tag="AFR011W"
FT                   /orf_name="AGOS_AFR011W"
FT                   /product="AFR011Wp"
FT                   /function="DNA binding"
FT                   /function="alkylbase DNA N-glycosylase activity "
FT                   /biological_process="base-excision repair"
FT                   /protein_id="AAS53382.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003905"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="HOGENOM:HBG059345"
FT                   /db_xref="HOGENOM:HBG203698"
FT                   /db_xref="InterPro:IPR000035"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniParc:UPI0000253015"
FT                   /db_xref="UniProtKB/TrEMBL:Q754R1"
FT                   /transl_table=1
FT                   /translation="MKRAREDVGNIPIEYLSRHSDAFEKAVQYILSVDSSLLEVIVAKE
FT                   FPQYLIATERQLTLQSHFKHLASGIITQQISGAAARSIKSRVEQLFGGTFPNYVELQSK
FT                   FAAGDSASLRKCGLSARKVSYVESLTAYFNQNEMRLKHLFNSGSDAEIVDDLVRNVKGI
FT                   GPWSAKMFLVTSLHRQDVFAADDLGIARGCSRYLTARPEVLKKLMVSRTTVKRSKIKHK
FT                   NSNWRIYDEDIVESCGQLFKPHRTLFMFILWRLSSTNIDALLNTNPQLSVKPLIESNQT
FT                   HSIH"
FT   CDS_pept        complement(457711..459162)
FT                   /codon_start=1
FT                   /gene_family="HOG000214943" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762586"
FT                   /locus_tag="AFR012C"
FT                   /orf_name="AGOS_AFR012C"
FT                   /product="AFR012Cp"
FT                   /biological_process="heme a biosynthetic process "
FT                   /biological_process="protein complex assembly"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAS53383.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006461"
FT                   /db_xref="GO:0006784"
FT                   /db_xref="HOGENOM:HBG350066"
FT                   /db_xref="HOGENOM:HBG628966"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniParc:UPI0000253016"
FT                   /db_xref="UniProtKB/TrEMBL:Q754R0"
FT                   /transl_table=1
FT                   /translation="MFRSILSRNATLHGCRFMSSSSTAGFGKYLASRGSQLPPPFRKQT
FT                   SSLNFVTGRTGLLRPYSASRILQEAASVKGPRKLLNSSKTVGYWLVGTSGLVFGIVVLG
FT                   GLTRLTESGLSITEWRPVTGTLPPMNENDWQEEFRKYQQSPEFQQLNSHISLEEFKFIY
FT                   FMEWVHRLWGRAIGAVFVLPAVYFAATRKTSPRVNRRLFLLSLVLGFQGFIGWWMVRSG
FT                   LDQGQLDERKSKPTVSQYRLTAHLGTAFVLYMGMLWTGIEILRETKWVKSPAKAMELFQ
FT                   KLDSPALAPVRRMALALTALTFLTAMSGGLVAGLDAGLIYNTFPHMGDNWLPKQRELMD
FT                   DTFARKEDKSDKFWRNMFENPTTVQLNHRIFATTTFCSVLAFHLYCNRRKALIPKSANR
FT                   TMHAMMGLVTLQFSLGVATLLYLVPVPLASAHQAGALALLTSALVFAAQLRKPRAPMRL
FT                   LVNSLHAQQKRASGQIMSEVSRLAK"
FT   CDS_pept        complement(459486..462662)
FT                   /codon_start=1
FT                   /gene_family="HOG000261409" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625584"
FT                   /gene_name="PIM1"
FT                   /locus_tag="AFR013C"
FT                   /product="Lon protease homolog, mitochondrial "
FT                   /EC_number="3.4.21.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent peptidase activity"
FT                   /function="DNA binding"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="AAS53384.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG351191"
FT                   /db_xref="HOGENOM:HBG566281"
FT                   /db_xref="InterPro:IPR001984"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001DB2AB1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754Q9"
FT                   /transl_table=1
FT                   /translation="MLTRIRNAGVGGNAARRVRLLAGYTGARMAHAAALNSTTGAGGAA
FT                   RAAGAGRRAHSDVHVWALRQQSGIHRGGQCILKQDREPDQSDDKKVPPRAEEGRDEEAV
FT                   RDEEAERQPREEQANRSSEASSSRGSGGSASSAGGGGRSNPPSEGEVPRKYEELMVLPM
FT                   SNRPLFPGYYKSVTVYDPAVIEAICGLLRRNIPYLGAFLLKDRSMDKDSIDSIEEVHRV
FT                   GVFAQITSVHHGVDVDGRKAMSMVLYPHRRVQLDELVSTPKLVAEAKEKATDDGLVQAK
FT                   KEKFRDMSEGGEEEENPTEFLLETGVTVGNFSDHLDLPVDHSSVMLNALTSETLNTFKH
FT                   LSSINATVKQQLIALSSITTSLKPNIFESPSLLADFAAAISVGDPNELQDVLETRDVEQ
FT                   RLEKALVFIKKEVYVAELQQKIEKETDAKVQKRYKDQVLTEQMRGIKKEMGVEDAKDKA
FT                   IATFRERAEKLKFPEHVKKIFDEELARLSGLESAMSEYSVTKNYLDWITSLPWGIASTD
FT                   QYSILSARKVLDNDHYGMQDVKDRILEFIAVGKLKGQIDGKIICLVGPPGVGKTSIGQS
FT                   ISRALNRTFFRFSVGGMSDVSEIKGHRRTYIGALPGRLIHALKRCQTENPLILIDEIDK
FT                   LGRTGHQGDPASALLELLDPEQNKTFLDTYLDFPVDMSKVLFVCTANTLDTIPRPLLDR
FT                   MEVIELSGYVADEKVKIAERHLIPAAKKSTGLGSANINLTSDSIVALLKNYCRESGVRS
FT                   LKKHIEKIYRKAALKIVQQLSIDDTPKSAPAETNIEPENGKPDASAKPLTNNLPAPEPL
FT                   NIPDSVKIDITPETLVEYLGPPVFTADRIYEKTPAGVVMGLAYTYLGGCTMYVESVLGQ
FT                   PLSKDSNPSLEHTGQLGDVMKESSRLAYSFSKMFMSRRFPNNRFFEKAAIHLHCPEGAT
FT                   PKDGPSAGITMASSLLSLAMNKPLDPTIAMTGELTLTGKVLRIGGIKEKTVAAKRSGAK
FT                   TIIFPKDNMADWEDLPAHVKEGLIPVAAEWYDDVFNVLFGSVTEEEGNNVWKDQFDLIE
FT                   RSKATASSSN"
FT   mat_peptide     complement(459492..462521)
FT                   /gene_name="PIM1"
FT                   /locus_tag="AFR013C"
FT                   /product="Lon protease homolog, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754Q9 "
FT   transit_peptide complement(462522..462662)
FT                   /gene_name="PIM1"
FT                   /locus_tag="AFR013C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754Q9 "
FT   CDS_pept        complement(462878..463408)
FT                   /codon_start=1
FT                   /gene_family="HOG000211832" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625585"
FT                   /locus_tag="AFR014C"
FT                   /orf_name="AGOS_AFR014C"
FT                   /product="AFR014Cp"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53385.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003956"
FT                   /db_xref="InterPro:IPR003957"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000253018"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Q8"
FT                   /transl_table=1
FT                   /translation="MDANSDQRDKHNQYIAELREQDRWLPINNVARLMKNTLPVTTKVS
FT                   KDAKECMQECVSEFISFVTSEASDRCASDKRKTINGEDVLISLHALGFENYAEVLKIYL
FT                   AKYRQQQALKNQMIFQRREDGADGLDGAADDGSDDAGEEEGEHGAGAAAGAPGAGALPE
FT                   QDQFINQDGSLYI"
FT   CDS_pept        463560..465218
FT                   /codon_start=1
FT                   /gene_family="HOG000000715" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778139"
FT                   /gene_name="RFT1"
FT                   /locus_tag="AFR015W"
FT                   /product="Oligosaccharide translocation protein RFT1 "
FT                   /function="lipid transporter activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53386.1"
FT                   /db_xref="GO:0005319"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059346"
FT                   /db_xref="HOGENOM:HBG397989"
FT                   /db_xref="InterPro:IPR007594"
FT                   /db_xref="UniParc:UPI0000253019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754Q7"
FT                   /transl_table=1
FT                   /translation="MCSTGEEILAKSTQGATFLMMGQLFGKLVTFVLHNVLVRFLSPRI
FT                   FGITSFLDFLSSTVLFFSREAIRLATLRIKTGGDGGRGGEMSAELQTAVNFANIPMCIG
FT                   APLAVVLAVWQYSNLNSYFTQLPFFSWSIYLVLLSILAELASEPLYVVNQFMLNYRKRS
FT                   QFEGAAVAASCLVNFAVIYWYENWVNGRGETVHDSYKQEGIAVLAFALGKVARAMTLLA
FT                   LYYVDYVRHLAHEKLFSLSLTKVRVPGSVYTAYFDSDVLQHFKKVYFQLCFKHLLTEGD
FT                   KLIINSLCTVEEQGIYSLLSNYGSLITRMVFAPIEESLLLFLTRLLSDKTQQNLHICMR
FT                   VLVNLVKFYLYLALVIVIFGPTNSSFLLKFLIGSKWSSTSVLETIRVYCFYLPFLSMNG
FT                   ILEAFFASVASGDEILRHSYLMMLLSGVFLLNCWVFLAHFNLSLEGLIFSNIINMTLRI
FT                   IYCSNYIRGFYKRLFADSKQTSLSSSFAGLKKILLLCIVVAYVDWSIIGYVQNIRQLLV
FT                   NILLSVTLVLAMAYNERKLLLEFIKKSKPVPVKEN"
FT   CDS_pept        465277..466953
FT                   /codon_start=1
FT                   /gene_family="HOG000246560" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778140"
FT                   /locus_tag="AFR016W"
FT                   /orf_name="AGOS_AFR016W"
FT                   /product="AFR016Wp"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS53387.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG302595"
FT                   /db_xref="HOGENOM:HBG395675"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR010666"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="UniParc:UPI000025301A"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Q6"
FT                   /transl_table=1
FT                   /translation="MSLSVVINKIWFHNEDSRKNSIHEPSSAMGIDDIDNKDTRCLRFV
FT                   TFNVNGLRTLFGHYPFSRMSNSLAQVFEYFKSDVITFQELKTDKLAIPRWGMVDGYYSF
FT                   ITIPSKKKGYSGVGCWIRIPEAADPLRLSLQVLKAEEGITGRLKIKKDGALVAYCEDPT
FT                   IGIGGYDGLPYGSDANAQELDSEGRCLLVELACKVVVISVYCPANSMNTEEGEVFRLRF
FT                   LKTLFKRVRNIENLGKRVVLMGDLNVCRDLIDHASCITRNNIKINPDCDGAVLERIYQE
FT                   EAREFIYEPLRIGRRLLNEMLIDSIIPDLAEKGVLIDSTRYAQGRKRLKMYTVWDTYRN
FT                   SRPANYGSRVDYILVSKALKEGVKKADIWAKVMGSDHCPVFTDLQIEEEDTVALEETTK
FT                   IPRFEVRFNYDLNHNIFDAFRKKSIIKCKSATKPLNQGKVQKKATKSSESQIEKKPDKL
FT                   LLGASSSNIAASGKCHEEEQGQSIECAPLELNKAPEQRPSAVEKPFFAPSNAPLCKHGD
FT                   RSVLKTSKTSTNFGKQFWTCKRPRGAPEDIKASCGFFQWKS"
FT   CDS_pept        join(complement(467407..467459),complement(466992..467346))
FT                   /codon_start=1
FT                   /gene_family="HOG000000716" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625586"
FT                   /locus_tag="AFR017C"
FT                   /orf_name="AGOS_AFR017C"
FT                   /product="AFR017Cp"
FT                   /protein_id="AAS53388.1"
FT                   /db_xref="HOGENOM:HBG059348"
FT                   /db_xref="HOGENOM:HBG204263"
FT                   /db_xref="InterPro:IPR020347"
FT                   /db_xref="UniParc:UPI000025301B"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Q5"
FT                   /transl_table=1
FT                   /translation="MTACKKLGPDWHYFALLLSSQDEKQDSELLIDEMTWRQVIINALK
FT                   RSHGIFGEGIEFDFLSVQGNRAFVKVGYEDRAQFSSALSTYISSEELIGVPLVVHILQE
FT                   CTKLERMKVGEDDELWFKRSLEEEVADSSCN"
FT   CDS_pept        complement(467650..472176)
FT                   /codon_start=1
FT                   /gene_family="HOG000169063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778141"
FT                   /locus_tag="AGOS_AFR018C"
FT                   /product="AFR018Cp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53389.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG191502"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0001DB2ACC"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Q4"
FT                   /transl_table=1
FT                   /translation="MVGMLFVWQTFLFVWACAAAVEVGEKPRPVIDIVRDVDNLGSIWQ
FT                   FKGTNTLIRHQGREILVRHGGDQWSTVKKFDQGVNTVEVDPYYPERRAFAWLENNELYK
FT                   TDDCGKTWARVMHVEAEPGENLQRYSVYSNPDNYKYLMVTSHFERKDSSPVLAESYEKQ
FT                   WVSQDGGKTIAPLGHPDPGVYRLCHFLRQARNHDVAKDSTILCIEHDAQKHTAVLYRTD
FT                   DFGKSKQALDSFDDEIVSSVGLLGKYILVTTTEDAYNKHAVQHVWVSRDGDKFQKIIFP
FT                   THIRDNFFRAVTTSTGNQIIFSIPAGKHSHSRKNALYANYISDSSGIQFHAVADSLDER
FT                   YKELGPVMALDANGTLSMVARKSSTEDQVTLLSYDYGYSWQPMHLAEGEDHKALGCSKG
FT                   GKECELPVQLSQLVSSSGLVGHGESATSGILMGIVLKKRGSRGPRKHKYLSVISRDYGL
FT                   TWSVAFEYPVLSFAGNYGNILLACPYNPGDDGDPEEEIYYSLDQGHTWEEHHIEGKYEF
FT                   VRVHSAISDGSSTAFSFLAVGDDQNTIVVDCIFTDIHNGKECTDGDMEEYKLRNGNCLN
FT                   GARYTINKRKSEAACLLKNDPSVINPLVKPCDCTNADYECSLGFLGLPDKGCTADLGML
FT                   RSAGACKDNPRELMPMHKIKGNECTKDLNIEPVKVDCSAVQNRPDIEVTAHVFKTQFET
FT                   YQYFNSAEDDSLMVLTKDKRALISHDSGKTFKMLDTLGSGAELITFNRYFGDLAYIFAS
FT                   DDVLYITDDRGYHFYAVDLPEVRHLFLPLAFHAKDNQTFIYFGGKDCEKLGPKCHSTAY
FT                   ITTDGGRNFREMLTGAVSCEFVGSIYSHPANKDMIMCEIENKKERRNILLRSTDEFRTS
FT                   DKVFDSIIGFHTTGDFTAIAVSEGRQQVSSYLTIDGVHFNESRFPPDFVAPEKQQSYSV
FT                   LSAHEGAIFLHMSKSLVKHKEYGTLVKSDSNGIDFVVLKDGVNSNAEGLVDFETPEGLD
FT                   GVILINVVENLDQVQKGKAKAKHLKTAISFNDGVDWKYLSPPGKDSSGKKYPCHGKNRA
FT                   KCSLNLHGYTERKDLRDTYSSGSAIGYMLGVGNVGEHLLPYEQCSTFLTTDGGVTWTEV
FT                   KSTPHQWEFGDRGSIIVLVPDGVKTNSITYSVDAGRSWQDFKFADEEVIIDDIITVPYD
FT                   TSMRFLLISKEHLRGKSKTYAISFAHIFKRQCEFHPGGGRHNGDFEYTSIKHPDYKCLF
FT                   GKEVEFLKRIKYDCFIGNASYTKDYRTSRICPCTRQDFECDYNYIRTSDGTCKLPSGVK
FT                   PEAPSAVCERNRDLVEYFQPTGYRKIPLSKCEGGLKLQRTDSPHPCPGKEKEFYEKYPS
FT                   STNASSVVFWWLLLTMVLLVPLWVIYDRGIRRNGGFSRFGEIRLDDDDLIEENGLDRAI
FT                   NKVVKVGAYGVAGLFGFLLLLKSKAGARIRRFRESVSSRRGPSYSSLISDQFLDDANDL
FT                   LVGHDNDANNLNAFLDEDGQHFDVDDEIEGADQASYHDDVDLGRTSE"
FT   CDS_pept        472913..473992
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931105"
FT                   /locus_tag="AFR019W"
FT                   /orf_name="AGOS_AFR019W"
FT                   /product="AFR019Wp"
FT                   /function="ATP binding"
FT                   /function="MAP kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53390.1"
FT                   /db_xref="GO:0004707"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1B38"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000025301D"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Q3"
FT                   /transl_table=1
FT                   /translation="MGKKIVFNISSEFQLKALLGEGAYGIVCSAVHKPSGEVVAIKKIE
FT                   PFERTLFSLRTLREIKILKHFQHENIISIYDIQKPASFDTFNEVYIIQELMQTDLHRVI
FT                   ATQPLSDDHIQYFIYQTLRGLKALHGSGIIHRDLKPSNLLLNANCDLKICDFGLARIEH
FT                   GGAADLEHPQAGMTEYVATRWYRAPEVMLTAAQYTKAIDIWSSGCILAELFMKRPLFAG
FT                   KDYKHQLMLIFELLGTPQGDDLAAVKSRRAREYIATLPRYRRASLRAVIPHANPLGLDL
FT                   LQRMLVFDPRRRITAADALRHPYLATYHDPRDEPDGTPIPASFFDFDHHKDKLTTRDLK
FT                   RMLWDEVFRDTHAPVRPDA"
FT   CDS_pept        474366..475937
FT                   /codon_start=1
FT                   /gene_family="HOG000172597" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762587"
FT                   /gene_name="ACH1"
FT                   /locus_tag="AFR020W"
FT                   /product="Acetyl-CoA hydrolase "
FT                   /EC_number="3.1.2.1"
FT                   /function="acetyl-CoA hydrolase activity"
FT                   /biological_process="acetyl-CoA metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53391.2"
FT                   /db_xref="GO:0003986"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006084"
FT                   /db_xref="HOGENOM:HBG001544"
FT                   /db_xref="HOGENOM:HBG289696"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="UniParc:UPI0001DB2ACD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754Q2"
FT                   /transl_table=1
FT                   /translation="MTVSQLLKQRVRYAPYLSKVRRAEELLPLFKHGQYIGWSGFTGVG
FT                   APKVIPTALADHVEKNGLQGQLAFNLFVGASAGPEENRWADLDMILRRAPHQVGKPIAR
FT                   AINDGRIKFFDKHLSMFPQDLTYGYYTRERTDGKILDYAIVEATAIKEDGSIVLGPSVG
FT                   GSPEFMSAADKLIVEVNTATPSFEGLHDIDMPVLPPHRVPYPYTRVDERSGLDAVPVDP
FT                   ARVVALVESTERDKVGPNTPSDEGSRAIAGHLVEFFENEVRHGRLPANLLPLQSGIGNI
FT                   ANAVIEGLAGASFRNLTVWTEVLQDSFLDLFENGSLEFATATSIRLTEAGFEKFFANWD
FT                   EYSSKLCLRSQVVSNSPEMIRRLGVIAMNTPVEVDIYAHANSTNVSGSRMLNGLGGSAD
FT                   FLRNAKLSIMHAPSARPSKTDPTGISTIVPMASHVDQTEHDLDVLVTDQGLADLRGLCP
FT                   RERAREIIRQCAHPDYKPILTDYLDRAEHYAQRSRSMHEPHILQQALRFHTHLAEKGTM
FT                   KVPSWD"
FT   tRNA            join(477330..477365,477406..477441)
FT                   /gene_name="tRNA-Pro"
FT   CDS_pept        477646..482655
FT                   /codon_start=1
FT                   /gene_family="HOG000033985" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931106"
FT                   /locus_tag="AFR021W"
FT                   /orf_name="AGOS_AFR021W"
FT                   /product="AFR021Wp"
FT                   /protein_id="AAS53392.1"
FT                   /db_xref="HOGENOM:HBG059349"
FT                   /db_xref="HOGENOM:HBG103863"
FT                   /db_xref="UniParc:UPI000025301F"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Q1"
FT                   /transl_table=1
FT                   /translation="MKPISQEDSHVLYHSAELGQVWLTNGREVEWYRENTCFRRFKFEE
FT                   RVLLAGFTRWESNQQSLVIVLRDYVQIYFLDDGDSHSIKLPFPVRGAHFYINGVLFEVQ
FT                   QDADHIGAETTSHKFITLSDPLMPFGSVSLASPQSDIDHYTMLHFPEQEVYGIAVLYNE
FT                   TKQVISFYSAEILNTKAMAAMPDPPIIFNKRKKSYGSLIPNDTMPMSSSAPRKRTAETH
FT                   TCSPTTSSSSATNNNNSGYGGLTSTLMRRLTMNRRTASATGSAEQANSTNTPRASTHGT
FT                   GVNAKVTHLRSSSATLDRMVISDASYNLPGQLGISSLSQDAVPQSVTSKDGLLTKITSS
FT                   PVPCAFSEKVKVVSAKMDDRVTIVIYDRDRDWGRLWIFNLNSPLVGSMKFKAFGYSPMS
FT                   LIKTVDIKQMLLLDICAYDSSYLPGVFALLLRDGITLFNPVLDAMSPTFPLGKGHNYKN
FT                   IYAISPTNLFLEKGSYNIPPMTYPRSQTVRKYFEAIRYLVPPSVFPYVLSIWQFTRMLV
FT                   KTRACKNHDILAFEYALASFLVTEDSPLYDETFRQIHSDPIFVRDSGIWEWLPKIVMCL
FT                   HLLREELQLNVLQIQNVRRLDKLLSRLVTLMGWPVMWLDYYNCEREPIKPLDFEFTHPL
FT                   DEPPSIFKSLYSVTKSSMMDVVPFITFSRLAEQETTAIDSLVTPRTHKLLKLFESLQAQ
FT                   PRVSTNILEQLNDLNIGQGEFETYPIGVYAPLRRFLHELEPTINKVDPHMNVSLITRSD
FT                   LSNCIALMRGQPPKDRRESHGLQSNLKGRFKIKDIAELTGSILELRRGTETSLSSRSLD
FT                   IFDRKENVFFDPGLFDEVLSMFTYSTPHKAYFPTLSGEYTKILKLKKHAAMISAYRAFT
FT                   SGLGKAAFFYCAEEAINSKKTQRDELNLNFKFPMDGSKLSLSKDKFPEDFLKWAEFHRG
FT                   VARGLSISKSVTNVTSSWINYNRPPWLDAQYGGFLLGLGLNGHLKVLEEWQLYNFLSPK
FT                   HTHISIGLLLGICASMKSTMDLTLTKVLSVHIVALLPPGSSNLNIHHRVQTSGLIGVGL
FT                   LYQSSQHRRMSDLLYSQITSFVTINDEQVPDEGYRLAAGIALGLVNMGTGNKGISSRDD
FT                   MEGDEQMMDYEVDDPVASIPETFNVKNASGYIDPDIVEGLLKLVTTVHDVEESWMPDNS
FT                   QLGATVSLLLMFLKSNCAVVAEKLSATGDDTKRGETWYIKPELFMYREWASNMVMWDNI
FT                   QGNINWVIAVLDDAGRAPREIDSDMLPTYYIIAGRVLSVGIKFASTNDIELRDGLFAIL
FT                   DQFLPFYQYALGNTVDEQLMYKGISMLINVLIISLSLIMCGSGDVETFKRIRYLHNIVH
FT                   GKGSYIYEIHKQNSSTGDEIDSGISAEQSGRVIDPLLQVEEITNPTNNATLDEGSESDG
FT                   ANSTHHLRDNENHYGKYMATSLSLGFLFLGLGRYAIKTTDLDSLSYLIISVLPTFMPPY
FT                   YLQETKYLWCMSVDTRVLILKNSDTEELCEDVSLEIIVKSSKKDRNSGVVVHSCVSPCL
FT                   LPPLDTIQSIKIDDPAYYPLVLSFDDECKAENYFSKECIIYVKERDEIDENVDPTTDPL
FT                   EYMNNVKKELSKNLSIRDNIDPIVNPRQEEFLAQRLLSKLGLHDMTRIEFEDTVANQTG
FT                   ASEDNNYNLDMLCTSEDTDYRLELWRRRNGL"
FT   CDS_pept        complement(482819..484363)
FT                   /codon_start=1
FT                   /gene_family="HOG000282409" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762588"
FT                   /locus_tag="AFR022C"
FT                   /orf_name="AGOS_AFR022C"
FT                   /product="AFR022Cp"
FT                   /function="phosphatidylserine decarboxylase activity "
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="AAS53393.1"
FT                   /db_xref="GO:0004609"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="HOGENOM:HBG070304"
FT                   /db_xref="HOGENOM:HBG395511"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="UniParc:UPI0000253020"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Q0"
FT                   /transl_table=1
FT                   /translation="MLGFGGNKLVHRSRGMRLNMNITSNSLLVARRGLDAGLRLKRKTN
FT                   EFIWNSKSYYSTAKEHSKQHRAGAMRFAAASGGRNFMKTKWVVMTGVTLVLGSLILSQK
FT                   RHSERDEDKQADAKQKPKIRIFNNNWFFFCYSTLPLNAMSRMWGQVNSVALPVWLRPWG
FT                   YKLYSVIFGVKLDEMDDPDLTHYQNLSQFFYRMIKPECRPIDERENVVVCPSDGTVLQL
FT                   GIIDSESGDIEQIKGLTYSVKEFLGTHSHPMITRSSSSDSLCQNEHDDTKHREFARINN
FT                   IPYSLQDIIGDTPGTQGEDAHIQLIQYESEGDKVLNNSNIPPSKVVKLLSELSTHYVGK
FT                   LAANDPSHTQLYFAVIYLSPGDYHHYHSPVNWVCKLRRHFPGELFSVAPYFQRNFPNLF
FT                   ILNERVALLGHWKHGFFSMTPVGATNVGSIKLNFDKELVTNSRSNRHLKPHTCYEATYE
FT                   TASKILGGVPLVKGEEMGGFMLGSTVVLCFEAPSNFKFDIHVGDAVKMGQSLGQIN"
FT   CDS_pept        484617..485519
FT                   /codon_start=1
FT                   /gene_family="HOG000217578" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778142"
FT                   /locus_tag="AFR023W"
FT                   /orf_name="AGOS_AFR023W"
FT                   /product="AFR023Wp"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS53394.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG059350"
FT                   /db_xref="HOGENOM:HBG330619"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI0000253021"
FT                   /db_xref="UniProtKB/TrEMBL:Q754P9"
FT                   /transl_table=1
FT                   /translation="MLVGISATYGSPWEVLLQHFEGHGFRRLRVEDFDGSWDKLEEHAT
FT                   RNYEAAHVIADVNAPGVLERLEKRPFFVHVSVDAPIDVRLAGSGDADHVTFMERAALHD
FT                   SEAVVRATRRAAVQLYVGPGGGLRGRLAEALDELLGGPLAASPLRPAWDVYFMQLARLA
FT                   ASRSNCMKRRVGCVIVRACRVIATGYNGTPRHLRNCHDGGCARCNGGGSALHTCLCLHA
FT                   EENALLEAGRERVGEGAVLYCDTCPCLTCSVKIVQTGITEVVYSQTYRMDSDSFKVLRA
FT                   GGVKVRQLQDAVPPHFLVI"
FT   CDS_pept        complement(485544..486317)
FT                   /codon_start=1
FT                   /gene_family="HOG000063753" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762589"
FT                   /locus_tag="AFR024C"
FT                   /orf_name="AGOS_AFR024C"
FT                   /product="AFR024Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS53395.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG419601"
FT                   /db_xref="HOGENOM:HBG729228"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI0000253022"
FT                   /db_xref="UniProtKB/TrEMBL:Q754P8"
FT                   /transl_table=1
FT                   /translation="MSYQYLKQVRKIVCIGRNYAAHIRELNNPLPDSLVYFLKPTSSLV
FT                   TPVDAAVPTAPEDPSHVLRADGTNPGPILVPQGVEVHHEVELALVLGKRLSNLLPSEFG
FT                   PEDVYGAISGVALALDLTGRNLQAESKRKGLPWTAGKGFDTFTPISAFVPREALPSRDL
FT                   QNSFTLRCAVNGVQRQDASTALMLTPMHQLLQQLSAVMTLEPGDIVLTGTPAGVGPIIP
FT                   GDHISASLLQDKKQLAAFAFDVRTRPGPYMYNSKL"
FT   CDS_pept        complement(486595..488061)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778143"
FT                   /locus_tag="AGOS_AFR025C"
FT                   /product="AFR025Cp"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS53396.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG059351"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR020956"
FT                   /db_xref="UniParc:UPI0001DB2ACE"
FT                   /db_xref="UniProtKB/TrEMBL:Q754P7"
FT                   /transl_table=1
FT                   /translation="MERNTVHQHVSSFDLEPNPFEQSFASTKKEVGGPGRPLLQQGPPP
FT                   GHALLGLANGGASDVSQAAAVAGPQKSPMRYHLHTHKPPMIQSPPILTPGGSHRLPAML
FT                   LSPQVLQPHNAQTESLLQAPGQAHLPALSPLLPGGPHNGQTTPSFLMGLTKTGLTPNES
FT                   SIRTGLTPGILNGGQHTSLPLPNGGQFTPGMSSMLSSMPLTNDTRTPGGGGAASHPHSL
FT                   STVLEVPTSTSNSVAEIPMGGSSNPVTGNISLELPPERVKNTLASNRKRSLSNDDAIHG
FT                   IQNTSDGSTNSNNKKKTKKSQSAPAEDPELDERDRKRKEFLERNRLAASKFRKRKKEYI
FT                   KKIETDLQFYETEYNDLTSFIDSLAGLTGSAKGMGQASSDISLLKLLKQSLMRQDIARA
FT                   MALVNQIEQHMISTKYIQRNGRNPRLEEDQSQQKQVNVVNGNAATAGVGSNVSEVRTPS
FT                   STIGTQPYNSGSTTGLTNATYASMIKHDGI"
FT   CDS_pept        complement(488510..488722)
FT                   /codon_start=1
FT                   /gene_family="HOG000191755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762590"
FT                   /locus_tag="AFR026C"
FT                   /orf_name="AGOS_AFR026C"
FT                   /product="AFR026Cp"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="AAS53397.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG072741"
FT                   /db_xref="HOGENOM:HBG735750"
FT                   /db_xref="InterPro:IPR006591"
FT                   /db_xref="UniParc:UPI0000253024"
FT                   /db_xref="UniProtKB/TrEMBL:Q754P6"
FT                   /transl_table=1
FT                   /translation="MSREGFQIPTNLDAAAAGTAQARTATLKYICAECSGKLSLSRTDP
FT                   VRCKNCGHRILLKARTKRMVQFEAR"
FT   CDS_pept        complement(488860..489780)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762591"
FT                   /locus_tag="AGOS_AFR027C"
FT                   /product="AFR027Cp"
FT                   /protein_id="AAS53398.2"
FT                   /db_xref="HOGENOM:HBG059353"
FT                   /db_xref="UniParc:UPI0001DB2ACF"
FT                   /db_xref="UniProtKB/TrEMBL:Q754P5"
FT                   /transl_table=1
FT                   /translation="MMVQEKLSVKIARLEKELEALHRGVSADLRPAEDAEESESSAGER
FT                   YSTDKSSYASSVQAVLRARTASAASADTAMSSSTAASDSAGGAKMDAADADDATRSLEL
FT                   RLAALATQDPAVDSADTASGASPASPAAPPSPPPSAATEGSDEAAAPLEVPKQRGDAGT
FT                   AAGGEPVRRRPTNPFRVISVGGSSTFKRAAGADGQASRTSSAGDKAAPVSADEQSMLKL
FT                   QRKHDYLTMKCVKLSKEIKYLTNLKKTGSLSVEDTRKMNDALDKLQEYLDRKSKEKYEI
FT                   GVLLSRRIRKHINNGSNGQFWLSGK"
FT   CDS_pept        489947..490936
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762592"
FT                   /locus_tag="AFR028W"
FT                   /orf_name="AGOS_AFR028W"
FT                   /product="AFR028Wp"
FT                   /protein_id="AAS53399.1"
FT                   /db_xref="HOGENOM:HBG059354"
FT                   /db_xref="UniParc:UPI0000253026"
FT                   /db_xref="UniProtKB/TrEMBL:Q754P4"
FT                   /transl_table=1
FT                   /translation="MARPEHPKSRDQQASRISRSETCDDKAAFHKPVDESDQQDQGAPV
FT                   AQRAVPLAELLLDYRLYAFSSEDSYQNFKKNGRDAYHSLLLASEGREILGYPLFRAESG
FT                   RTFLNFFRRDAPVLQIYKHVVLPFSAEPPGPEARLVALAGDRSLYRVPFCSVFSQQRFL
FT                   SAISEYTLVFQRGGEPTYVRMRRKWTSQIYDTVFDGMHMRWHHRRLFSLLGGLSRKLVV
FT                   LREDMPSLFAEMDDQCFSSHLSEKEISELSVLAEYTAKSARLLPSRVARVGELVVADTS
FT                   TVQPSDFNQVPWNLEVIICMNLLITFLEKQKLADSRRRARNNSIHTMF"
FT   CDS_pept        complement(491025..491501)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762593"
FT                   /locus_tag="AGOS_AFR029C"
FT                   /product="AFR029Cp"
FT                   /protein_id="AAS53400.2"
FT                   /db_xref="HOGENOM:HBG059355"
FT                   /db_xref="UniParc:UPI0001DB2AD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q754P3"
FT                   /transl_table=1
FT                   /translation="MVSISGYFGCNCSLLTLFLAALGLVLCAPAHEAFTSNGVVYRYHV
FT                   RTTTVKPPVTIVRTVFFTAWASAPPGGQDSQETHTLEGPSATTSSESSPSALATAAPPP
FT                   ADPVMPTSGPGSCVASYDDTEPFSTIYLTAGKEDVGAYTTLTRTRTVIVSVATV"
FT   CDS_pept        complement(492216..493250)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762594"
FT                   /gene_name="IBD2"
FT                   /locus_tag="AFR030C"
FT                   /product="Protein IBD2"
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spindle pole"
FT                   /protein_id="AAS53401.1"
FT                   /db_xref="GO:0000922"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG059356"
FT                   /db_xref="UniParc:UPI0000253028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754P2"
FT                   /transl_table=1
FT                   /translation="MSEPERASIEFVSESDSIDFGIMMKKGVKALTDILANHLQHDPEW
FT                   KNERSMKFVFKNQNGELQPVLNRTARLEDEGVGPSPDDGQVVDGEETASEQDKLAEANC
FT                   SDGSSTGDLQLDDPESEVLFDYSLDHLPNISYTPDPTIGKHVMEMIESLLPKGAPYREK
FT                   VLNTMKNNVQGAGMSTAGTAAVETIQHTAGSTISEPAMSYECDRDLGIAESDDWEHQQF
FT                   AQPHHGTLEADTVAEGHHRCQSRSSESQHAGHQRAGQEYLYECKPKARPDFHALTMFDP
FT                   LEQPLCMFCEYYLVFGEPPRQMIKWYNKYGSSSGGPSAGSQQGNKGWNGNKKKKKKKGK
FT                   KGKR"
FT   CDS_pept        complement(493539..496832)
FT                   /codon_start=1
FT                   /gene_family="HOG000231586" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931107"
FT                   /locus_tag="AGOS_AFR031C"
FT                   /product="AFR031Cp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="AAS53402.2"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG156268"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001DB2AD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q754P1"
FT                   /transl_table=1
FT                   /translation="MVRISSDVPKRLQRDGACVRNICILAHVDHGKTSLSDSLLASNGI
FT                   ISQRLAGKVRFLDSRPDEQLRGITMESSAISLYFRVLHKQEGSSEPLVNEHLINLIDSP
FT                   GHIDFSSEVSAASRLCDGAIVLVDVVEGVCSQTITVLRQCWTEKLRPILVLNKIDRLIT
FT                   ELQLTPQEAYVHLSKTIEQVNSVLGSFFAGERLLDDLSWREKLEQDAQAEYVERDDADI
FT                   YFDPSRNNVIFASAADGWGFNVSLFAKFYEQKLGAKRENLQKVLWGDYYMDPKTKKIIN
FT                   QKALKGRNLKPLFVSLILDNIWKIYENVLTTHDSAILEKITKTLDIKVLARDLRSKDYK
FT                   NLLRVIMGQWMPVSTAVLLTAVTELPSPKASQDQKIASILATAPGGEDIDPALSSTLKK
FT                   CDSSGPVCAYVSKMLSIPKDELPQLSDEASGAAAVIAQSKRIREEAQRAAELAESMAKL
FT                   KTKTEDDLYVRANDTVFTPVVDDIDALPKPKKKLAINDNIQVVNELAPALNFDIGYVSD
FT                   NASVSDHEDAGHGMGTFVPTDIDPNDPLASMFEYEDEDPFAVPGEEPLPVSVGEEVEEE
FT                   EEDEVLIGFSRIYSGTLKVGQEVSVVNPNYDPAEPDNNITTTTITSLYLFMGKELVPLE
FT                   ECPAGNIVGIGGLAGKLLKNGTLLEKGTQGINLANSTTHSTPIVRVALEPTDPTHMHQL
FT                   VRGLNLLNQADPCVETYVEESGEHILCTAGELHLERCLKDLRERFAGIEITASEPVIPY
FT                   RETFLRTQEMNPPKKPTLGRGRIELLLGTLKLQFRAFPLPTEVIEFLSTHEDLMSGNSS
FT                   RGSASLTPKALLEHLAKIIPEGPENAELRGLVEQTCAFGPKRCGPNILFSNNGLLSTYG
FT                   EPEDGSFIYGESVINGFQLAMSGGPLAGEPVQGMAVILEDAGELTEAECEAIDDPAYVR
FT                   DLPDLAGRLITTARDTIHQACLDWSPRLMWAVYTCEIQTSIDVLGKVYAVVLQRRGRII
FT                   SEELKEGTPFFHVVARIPVVEAFGFSEDIRKKTSGAAQPQLVFSGYEAIDMDPFWVPTT
FT                   EEELEELGDIADRENIARRYMNNIRRRKGLFVHEKIVEKAEKQRTLKRN"
FT   CDS_pept        497157..497390
FT                   /codon_start=1
FT                   /gene_family="HOG000141920" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931108"
FT                   /locus_tag="AFR032W"
FT                   /orf_name="AGOS_AFR032W"
FT                   /product="AFR032Wp"
FT                   /protein_id="AAS53403.1"
FT                   /db_xref="HOGENOM:HBG191751"
FT                   /db_xref="HOGENOM:HBG202663"
FT                   /db_xref="UniParc:UPI000025302A"
FT                   /db_xref="UniProtKB/TrEMBL:Q754P0"
FT                   /transl_table=1
FT                   /translation="MSKSVARCPQCHTELRKCLIQQNYSIVICPNEQCMYPFNEAEVIQ
FT                   HLVQTSDKEILEAAKVRLKNDNITGSGGALME"
FT   CDS_pept        complement(497463..498482)
FT                   /codon_start=1
FT                   /gene_family="HOG000217049" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762595"
FT                   /gene_name="CHS7"
FT                   /locus_tag="AFR033C"
FT                   /product="Chitin synthase export chaperone "
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="protein transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53404.1"
FT                   /db_xref="EMBL:AAF34904.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG050905"
FT                   /db_xref="HOGENOM:HBG333395"
FT                   /db_xref="InterPro:IPR022057"
FT                   /db_xref="UniParc:UPI000025302B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754N9"
FT                   /transl_table=1
FT                   /translation="MSSKEAPMRAWLKMAGLAMSNKSWLSLGDFAGICAKTPLPMCFVV
FT                   QTSSLPGGSVGATHYDRTHMNIGMVPRCYSRTVDIANTAIFQLGNAFVNILALCVILII
FT                   SYNIRFKYTAIGRSEYGYFFQLCFMLICMTLVVDCGVSPPGTLAYPYLAALQIGLAGAC
FT                   SWALAVMGFLGFRLWEDGTRKSMLIVRGVSMVGFLLGSLVSAITFTNWIQHHPDMKTNT
FT                   TALFVVMYGLNGLALLMYSVCQLVVSIFVLSNFWMTGSTILGVIFITTGQVLMYTISYE
FT                   ICEGVKHYLDGLFIGSICNVFALMMIYKTWDISTDEDLEFSVSISVDGDIMYNSNLKL"
FT   CDS_pept        join(499125..499128,499262..499578)
FT                   /codon_start=1
FT                   /gene_family="HOG000224989" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931109"
FT                   /gene_name="RPL44"
FT                   /locus_tag="AFR034W"
FT                   /product="60S ribosomal protein L44 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS53405.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG049202"
FT                   /db_xref="HOGENOM:HBG496807"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI000025302C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754N8"
FT                   /transl_table=1
FT                   /translation="MVNVPKTRKTYCKGKACRKHTQHKVTQYKAGKASLFAQGKRRYDR
FT                   KQSGFGGQTKQIFRKKAKTTKKVVLRLECLSCKTKAQLPLKRCKHFELGGEKKQKGQAL
FT                   QF"
FT   mat_peptide     join(499128..499128,499262..499575)
FT                   /gene_name="RPL44"
FT                   /locus_tag="AFR034W"
FT                   /product="60S ribosomal protein L44 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754N8 "
FT   CDS_pept        499953..502112
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082480"
FT                   /gene_name="CBK1"
FT                   /locus_tag="AFR035W"
FT                   /product="Serine/threonine-protein kinase CBK1 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53406.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI00001516C2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754N7"
FT                   /transl_table=1
FT                   /translation="MFGQGYYQGNRDQDSPLQRPPAAQFSSAYMEQQGSHQSLQEHLAY
FT                   EQLQLQQQQQQQQQHAAAPHANGDGYGAGFTDIPTMLGSVGAPSPAFQPPMVVGMQQQP
FT                   INTPPPTATSIYSQNNNSFTNVNDTTLAPGHSSPGHYSNSSDYSGQQPASSAYKQFGGS
FT                   ESPLQPAALPGLLDGSLGDQTLVGNQSSQGAMLSRQSLQCSSVPQSPNGGQRQTSGVGN
FT                   YMYFERRPELLSKSTQEKAAAVKLKVENFYQSSVNHAIERNQRRVELESQLLSHGWSEE
FT                   RKNRQLSSLGKKESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKT
FT                   LLKSEMYKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTML
FT                   IRWQIFTEDVTRFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGF
FT                   HKTHDSNYYKKLLQEDEQQQNGGNMGKYPASGGGGNGGGNRNTMLVDAIHLTMTNRQQM
FT                   QTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETP
FT                   QETYRKIMNFEQTLVFPDDIHISYEAEDLIRRLLSHADERLGRHGANEIKNHPFFRGVD
FT                   WETIRQVGAPYIPKLSSVTDTRFFPTDELENVPDSPAMAQAAKQREQMLKQGGSAANTA
FT                   QAKEDLPFIGYTYSRFDYLTRKNAL"
FT   ncRNA           complement(502175..502283)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR32"
FT                   /product="AgSNR32"
FT   CDS_pept        complement(502516..503190)
FT                   /codon_start=1
FT                   /gene_family="HOG000248478" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625587"
FT                   /locus_tag="AFR036C"
FT                   /orf_name="AGOS_AFR036C"
FT                   /product="AFR036Cp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53407.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059357"
FT                   /db_xref="HOGENOM:HBG203789"
FT                   /db_xref="InterPro:IPR006838"
FT                   /db_xref="UniParc:UPI000025302D"
FT                   /db_xref="UniProtKB/TrEMBL:Q754N6"
FT                   /transl_table=1
FT                   /translation="MSVLSLIINSASLVLTSWGVSNAVKLTLPPNLQLAGQKQFLTILG
FT                   ASLTIVTNVIGIGYSLLGGDGGLRYVSREVFLPAALVLESVVALVYWPLRVFFVNMIYH
FT                   GLPEGASPEITVPVDLCIHLVPVAGLLLDYFLVQQGPFQMGRLPFWLLVTAMGVGYNRW
FT                   LGHIIHADLDQSYPYPFLDVAEPYRTLIFGVITTIAWGFYVLYQTLHGPAAGGGVGKQK
FT                   LS"
FT   CDS_pept        503607..505019
FT                   /codon_start=1
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762596"
FT                   /locus_tag="AGOS_AFR037W"
FT                   /product="AFR037Wp"
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53408.2"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG380231"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="UniParc:UPI0001DB2AD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q754N5"
FT                   /transl_table=1
FT                   /translation="MPGNQVGTDGAGAVDVAALANAAWVGASSVLIWMMVPGAGLLYAG
FT                   LSRRRHALAMLWASIMAVTVVSLQWFAWGYTLAFAPATRGNGFLGTLHYAGMYHVLDAA
FT                   PKRALPTAADVLFQGMFAMVAGTLMIGGSGGHARLLPMLVFLFWWVTLVYCPVACWTWN
FT                   ADGWLARMGVLDYAGGGPVHLTSGHAALVYALILDSRRGRRARRPRKFRPHSVTMVVLG
FT                   TVFMWFGWFGFNGGTAGSPTALAFYGCVSSNLAAGCGAIVWLFLDYFRYGKKWTVVGLC
FT                   SGAISGLVAITPAAGYVPAWASVAIGAFAGFSCNFAVAIKIVLGIDDGLDVYAIHGVGG
FT                   AVGSAMTGLFACKYVNASGAPYVRPIEGGWLERNWAQLGYQVVAILSISAWSAIVTALL
FT                   LLLLDRIPYLRLRPAADEQEDVDIHGINLFDNDVHDRVAEKIGVTSHAASTSRDQEAAK
FT                   PRETPELDAVVS"
FT   CDS_pept        join(505224..505272,505323..505564)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762597"
FT                   /locus_tag="AFR038W"
FT                   /orf_name="AGOS_AFR038W"
FT                   /product="AFR038Wp"
FT                   /protein_id="AAS53409.1"
FT                   /db_xref="HOGENOM:HBG059359"
FT                   /db_xref="UniParc:UPI000025302F"
FT                   /db_xref="UniProtKB/TrEMBL:Q754N4"
FT                   /transl_table=1
FT                   /translation="MKLVSLLLLLPLAAAASSRYMIFFPNQDVPVKAYAGLQNSVLLAG
FT                   GRITAVLPLIAGFVAEIPKEEVPGLVSANEKSSYKAVFEEDGEIHTARPAQ"
FT   CDS_pept        join(complement(506034..506042),complement(505605..505985))
FT                   /codon_start=1
FT                   /gene_family="HOG000204477" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762598"
FT                   /locus_tag="AGOS_AFR039C"
FT                   /product="AFR039Cp"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="AAS53410.2"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG329661"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR016661"
FT                   /db_xref="UniParc:UPI0001DB2AD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q754N3"
FT                   /transl_table=1
FT                   /translation="MELLPQGKQNTVQVLYEDQQRINEFSKLVMRKDALEAELRSQRQE
FT                   KEYVDDAALEIELVDEDAALQYKIGDVFVLMRQEEVAAQLERDQAAADARIRQLEEEEE
FT                   HVDARMRALKQVLYAKFGDSINLER"
FT   CDS_pept        507026..508669
FT                   /codon_start=1
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762599"
FT                   /locus_tag="AFR040W"
FT                   /orf_name="AGOS_AFR040W"
FT                   /product="AFR040Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53411.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000253031"
FT                   /db_xref="UniProtKB/TrEMBL:Q754N2"
FT                   /transl_table=1
FT                   /translation="MNTSGAVAAASTALAVNNMANTKMNAASAAQQQASLSQSHTFSQQ
FT                   AGVAGSNVSTVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT
FT                   EAPQLKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVK
FT                   TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPK
FT                   TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP
FT                   NNKQKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKLLLSTLE
FT                   ELGLEYDGEYDWMKLNGGRGWDLTINKKPNLHGYGHPNPPNEKGRRHRSKYPQPSAPQQ
FT                   MSSPQDPRYGSSQLQLQQRLDPTSYEAYQQQTQQRYAQQQLKLQHHQPRLNYQAQPLQQ
FT                   SSQQPQAQQQNQQTQNQQTQQQQTQYRTQQQAQYPFPSHSSQPGMHQKQGLLQGQNGSV
FT                   TAGTTTANGKQQDVGSVSSGKGFFSKMGCC"
FT   CDS_pept        complement(509669..510442)
FT                   /codon_start=1
FT                   /gene_family="HOG000248569" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762600"
FT                   /locus_tag="AFR041C"
FT                   /orf_name="AGOS_AFR041C"
FT                   /product="AFR041Cp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS53412.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059360"
FT                   /db_xref="HOGENOM:HBG396034"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="UniParc:UPI0000253032"
FT                   /db_xref="UniProtKB/TrEMBL:Q754N1"
FT                   /transl_table=1
FT                   /translation="MPERETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEAH
FT                   HCKALLAPGAATPASRSRSSSQAKGEREVYFKALLPDKAAVRVKQETSEKPAQGTSIKD
FT                   RLVQRNSTNALDKLKRFFAKYSSKRKNMNLSASNKVIQVAKIKRTAKGDDKIPHPNRVY
FT                   IWCYYIDESNPKEHDIFINRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGEKLYLYKRVK
FT                   ENEWKMLDPSGRVNGNIEEGDALYLIRGNDMCLLK"
FT   CDS_pept        511017..511244
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059040"
FT                   /locus_tag="AGOS_AFR041WA"
FT                   /product="AFR041W-Ap"
FT                   /protein_id="ADJ41788.1"
FT                   /db_xref="UniParc:UPI0001DB2AD4"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGF8"
FT                   /transl_table=1
FT                   /translation="MASVTFKDNAEVIMIGEQDRRREQGMARPWITGFIDADIMWQKDG
FT                   PQLIVDIAKENFEQLILTFVLLLYIVVAKI"
FT   CDS_pept        complement(511575..512249)
FT                   /codon_start=1
FT                   /gene_family="HOG000093863" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082481"
FT                   /locus_tag="AGOS_AFR042C"
FT                   /product="AFR042Cp"
FT                   /protein_id="AAS53413.2"
FT                   /db_xref="HOGENOM:HBG253312"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniParc:UPI0001DB2AD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q754N0"
FT                   /transl_table=1
FT                   /translation="MARPREVNPHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREEG
FT                   FRVGQLAEFYPRERRLLGLNVNQGARILLRLREPGDEQQFLSRETILAVMLHELTHNVF
FT                   GPHDARFRRKLDELVGRQWVLDQRGIVDSFLGRGRRLGGRGRRLEGRGRRLGGRSAGVA
FT                   ARELAGLAAARRMAAIAATAQCCGQGGGTAPPRDGDLDVVVIDEEPCVVRTPVVIDLTN
FT                   ED"
FT   CDS_pept        512442..513257
FT                   /codon_start=1
FT                   /gene_family="HOG000113862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762601"
FT                   /locus_tag="AFR043W"
FT                   /orf_name="AGOS_AFR043W"
FT                   /product="AFR043Wp"
FT                   /protein_id="AAS53414.1"
FT                   /db_xref="HOGENOM:HBG123629"
FT                   /db_xref="HOGENOM:HBG203786"
FT                   /db_xref="UniParc:UPI0000253034"
FT                   /db_xref="UniProtKB/TrEMBL:Q754M9"
FT                   /transl_table=1
FT                   /translation="MSKKKHEEECGERAGGKVGSPIVVAASTDSMSMLTKPQLFGIYDE
FT                   EIVESEDTEIYEEAKKSAGRMLDDMGSVGARSRVRTRSQKYMHLVSSLVILGISGIAYH
FT                   QLSRNLHDNDLLHEDFTSRPLVLGVKLCQQLSFGMLPTWAGYAVEGILFGSLLPAVDYW
FT                   RRISVGKVNLSGVLRSINAMLGVSFGIRRVEWSSSLQASGAWFLLDGILWLFFDGSFSV
FT                   FLLGFAVGLVTAVTCYEEITDFSQLLYFIDFYFLGLLFFGRLGRYLYQR"
FT   CDS_pept        complement(513422..513802)
FT                   /codon_start=1
FT                   /gene_family="HOG000208857" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762602"
FT                   /locus_tag="AFR044C"
FT                   /orf_name="AGOS_AFR044C"
FT                   /product="AFR044Cp"
FT                   /protein_id="AAS53415.1"
FT                   /db_xref="HOGENOM:HBG059361"
FT                   /db_xref="HOGENOM:HBG203785"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniParc:UPI0000253035"
FT                   /db_xref="UniProtKB/TrEMBL:Q754M8"
FT                   /transl_table=1
FT                   /translation="MSKSPSPTNSTLADTGDVDLSALTPQELKLYKLYGKLPGKKDLFK
FT                   HKLHERKYFDSGDYALSKAGVKSEDLGSAAVGSSHLPVTNPSGLRESIIRRRMSSSAGG
FT                   LDSQNLNRQSSISSGPPRSPNK"
FT   CDS_pept        514164..515468
FT                   /codon_start=1
FT                   /gene_family="HOG000214206" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625588"
FT                   /locus_tag="AFR045W"
FT                   /orf_name="AGOS_AFR045W"
FT                   /product="AFR045Wp"
FT                   /function="metallocarboxypeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS53416.1"
FT                   /db_xref="GO:0004181"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG207283"
FT                   /db_xref="HOGENOM:HBG396635"
FT                   /db_xref="HSSP:1AYE"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniParc:UPI0000253036"
FT                   /db_xref="UniProtKB/TrEMBL:Q754M7"
FT                   /transl_table=1
FT                   /translation="MGGCFAWLRLPMAVLGLAASAAGLQAYPETQVCRLTDVSVEWVHG
FT                   TMKRQGVTEYDIWGHSRGHVDVQVPRSVAEVLEGCEVMVEDVDALLQEQAARPGAAGRD
FT                   GAAQVPLGYAGTVGDVFFDDFQDLETIYMWLDMLEQTYPGLVTVERVGQTYEGREMRAV
FT                   HISAGNEQRNPDKKTVVITGGVHAREWIGVSTACFVVERLLSRYGRAPKETRYLDALDF
FT                   LVIPVFNPDGYAYTWTHDRLWRKNRQPTYMPGCDGVDIDHSFDYHWTGQHAYPCSGDYS
FT                   GQQPFEAVEARSWNDYVNKTKAELDIYAYLDLHSYSEEILYPYAYSCDALPRDLENLLE
FT                   LAHGLARAIRRKSGRNYDVLASCKDRGSDLSPGMGSGSALDYMYHHRARWAFQFKLRDT
FT                   GSRGFLLPAAHIKPVGRELYAALMYFCDFILNPEL"
FT   CDS_pept        complement(515478..516107)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778144"
FT                   /locus_tag="AFR046C"
FT                   /orf_name="AGOS_AFR046C"
FT                   /product="AFR046Cp"
FT                   /protein_id="AAS53417.1"
FT                   /db_xref="HOGENOM:HBG059362"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniParc:UPI0000253037"
FT                   /db_xref="UniProtKB/TrEMBL:Q754M6"
FT                   /transl_table=1
FT                   /translation="MAAAGHPSKMRRSQAGSSYVWWRYAIALVALCRVCLANTETFNIY
FT                   IPGDFPVSTVGAQQDGGIESGLPRMVLHNINYKMQRFDVVPGEMFYVQVDELRQNENYQ
FT                   VRISWTAADGVGVADMGHVVVPHGAAFRGTVDERARVAVHFRVEAEAYPALAAARVPVN
FT                   VAVVNIKMGIPVDLYSIALYVLAVVGAAAYVVCRWDPYRALKAEVL"
FT   CDS_pept        516226..517002
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778145"
FT                   /locus_tag="AFR047W"
FT                   /orf_name="AGOS_AFR047W"
FT                   /product="AFR047Wp"
FT                   /protein_id="AAS53418.1"
FT                   /db_xref="HOGENOM:HBG059363"
FT                   /db_xref="UniParc:UPI0000253038"
FT                   /db_xref="UniProtKB/TrEMBL:Q754M5"
FT                   /transl_table=1
FT                   /translation="MEPEAGAAETSRETVPEAGREPGASEIEEVELYQLFMEQSQRAAR
FT                   GLGDPPSLELQLLLLEALQRDQELGERLGERVLRAHTDWRPFGRPRPHLRTFLRNQIVL
FT                   DHILIALLFPFSLFNILRALFSEFTFSEYDFYIDILQYLRRISVVDHSGRSLLLYTDSL
FT                   GLLVKFHNVVVFYTRNVYYVLNAALGNLRITAHVYALFVRVNAISLYLAYGLIASSYLC
FT                   LAAFFFTLCFGMTVIKRYKGVEMILNEMYQNTECLL"
FT   CDS_pept        517129..518292
FT                   /codon_start=1
FT                   /gene_family="HOG000204320" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082482"
FT                   /locus_tag="AGOS_AFR048W"
FT                   /product="AFR048Wp"
FT                   /function="agmatinase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="polyamine biosynthetic process "
FT                   /protein_id="AAS53419.2"
FT                   /db_xref="GO:0006596"
FT                   /db_xref="GO:0008783"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG311682"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="UniParc:UPI0001DB2AE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q754M4"
FT                   /transl_table=1
FT                   /translation="MVHYRLAAAMLGAAACAQAAQPSPEELWGFDVGTAGIQTFAHLPH
FT                   ERCLLQPDLEFDIGILGMPFDMSVTYRPGARFGPEAIRRGSQRQIRAHAYSPYRALNPY
FT                   DDWAHIVDCGDVPVVLTDNRIARDMMHRAYADVLRRSSKSDPRVPPRIIMLGGDHSVLL
FT                   PALRALHDVYGPISVVHFDSHIDTWQPANTSVWDTAHVPLNHGTMLWEAFQHGLLSDHN
FT                   VHVGLRSNLAHPDDFHRDDAAGFYRIHADEILDIGPQGVVDRILRVIPRGVPVYVSVDI
FT                   DVLDPSAAPATGTVEPGGWLPRELLRVLRGLQPLTLVGADIVEVAPAYDRADITAITAA
FT                   QLVYELAASMVASGPVAHTLLDTRADSAAVPAQVRFRARGPSRSATA"
FT   CDS_pept        518736..520889
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931110"
FT                   /locus_tag="AFR049W"
FT                   /orf_name="AGOS_AFR049W"
FT                   /product="AFR049Wp"
FT                   /protein_id="AAS53420.1"
FT                   /db_xref="HOGENOM:HBG059364"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000025303A"
FT                   /db_xref="UniProtKB/TrEMBL:Q754M3"
FT                   /transl_table=1
FT                   /translation="MSQPEVYARLYEARGLGFKEAALPSSVSTSSVDGVTTLSYDSRSH
FT                   GSLPQSGEVESGELHADVLAVLQPQPARPPPYYAVNPNRRIRYPIYEREETNELPAYAP
FT                   AVHELALVSVKQEWASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGRAADST
FT                   LGVACAQAVSSLSFGQVKAGTLLALGRDERQLSPAHQQHVCARAQRDPERHLCAERLYK
FT                   SYSLQYATFGVPMDYTKRSFVLRLRCETEQFLVCFGTVDMLISWSVSLSVGIGVSLDLD
FT                   HRKMPAYRTVPRRRRRRTRHKRTDNRGRNTALLFSNKLSRRGTVLGLISPSVDRRTLLK
FT                   YDQPAMGAGGFSNAFIAMATRAPENREMPCDDAASLGQSSAAGELQAGFASRLRTMFWS
FT                   KKASRGEVQRSRTVHSDTKGLNSSVAESLLGPSASLGARGSEALRCRLSERCVYQSASS
FT                   SLLQVSEQRAAAHEDQMGSDSSSLESHRQPTPNRSLGSVCEQSRSPTPSGIEHSPVESE
FT                   EFDFVETGASSESELLPSDHLETSIYEDEGIYHSDDDDDDDDDDDDDDDGAGSAAADTA
FT                   TQDYAARSRALDMEFRQRAHSAASSLSFAPYGYSFSREKWVPPVKESTRRRFVRDSIRC
FT                   IRPLCDDDTWLGALVVSPSAGPGSSSSGFPFDLGLGSKRLGSRRSLKRGSQSLSGTRAA
FT                   RFMKAYIVGPVGLVASVNDEFNA"
FT   CDS_pept        522259..524079
FT                   /codon_start=1
FT                   /gene_family="HOG000260888" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762603"
FT                   /locus_tag="AFR050W"
FT                   /orf_name="AGOS_AFR050W"
FT                   /product="AFR050Wp"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS53421.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG270065"
FT                   /db_xref="HOGENOM:HBG525581"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR018553"
FT                   /db_xref="UniParc:UPI000025303B"
FT                   /db_xref="UniProtKB/TrEMBL:Q754M2"
FT                   /transl_table=1
FT                   /translation="MDKILLKRTLKEILDPDRVEEDIGSGGEDSAPSDSEQAPNDEEED
FT                   GSMCVECQDMPVEVLCRDCEEQFCTVCFEMLHRSGRRRRHEFARKDDGTAAGAEAAAGA
FT                   AAEESGADEEAAEAAEAAGAAAKPEETRADGRLLQLLQEHARYVPMRLTHEERHLLRLL
FT                   EAALQVSEYTDRVDILSYKSRARRIVEQLKEMCSVLCGLVIASDLKAGQRLVEMKEFSE
FT                   YAEWFQEVFEIGRRYKVMNPERMRDTFGKLCYMVMDSRLPQIQEHLEFHLYKPIRTVHA
FT                   FLGDPRDGGKALRMLQDPLVLYATAHISPVGKTRAEINRLIRQKEHAIEQLAAKYSGDV
FT                   YSKEDVRQALYSFGDYNAYVNMNRKPVMRMLERLELFRQPEVAKRFPLAIRQGRDGARL
FT                   THDHDKQWHYAQQSLSLWSVIQREMIRLWYVADQDLFDGAPYKLVSTGQGLNRVKASPS
FT                   VYKAMMNILHECRTKCKGWVGSSVVHLGDDAVPNALFFLDKYTQVPNILIPFDQVLMHI
FT                   KDLVRDDPAMLEYITTQYGSVEELQLVILQDAFAHMFDGSGADNFYMSGSCIDGRLTSA
FT                   WNHTNEIAKKRYYNIFLMTGFIGFNGGEGF"
FT   CDS_pept        524254..525471
FT                   /codon_start=1
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762604"
FT                   /locus_tag="AGOS_AFR051W"
FT                   /product="AFR051Wp"
FT                   /protein_id="AAS53422.2"
FT                   /db_xref="HOGENOM:HBG345785"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniParc:UPI0001DB2AE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q754M1"
FT                   /transl_table=1
FT                   /translation="MEKRAPSALLHHAHQIPPRTVDPQRRMSSQETLYNQPVVLDNGSG
FT                   IIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGLLKLRYPLQHG
FT                   IVTNWADMEQVWGYVFNKSLQLQNVEDHPILVTEAPLNPHKNREKMCELLFESFNVPAL
FT                   YVSVQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQL
FT                   LLRKTTGVSLLSSSEREIVRTIKEKACFVTKDPKLEEQNFPMNPSFSKFKLPDGKTIEL
FT                   GQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLPGF
FT                   GDRLLKELKSLSGSRTKIKIFAPPERKYSTWIGGSILSGLSTFKKLWVTKSEWEEFPDC
FT                   IHSRFM"
FT   CDS_pept        complement(525568..526266)
FT                   /codon_start=1
FT                   /gene_family="HOG000262755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762605"
FT                   /locus_tag="AFR052C"
FT                   /orf_name="AGOS_AFR052C"
FT                   /product="AFR052Cp"
FT                   /protein_id="AAS53423.1"
FT                   /db_xref="HOGENOM:HBG020849"
FT                   /db_xref="HOGENOM:HBG326432"
FT                   /db_xref="HSSP:1BD3"
FT                   /db_xref="UniParc:UPI000025303D"
FT                   /db_xref="UniProtKB/TrEMBL:Q754M0"
FT                   /transl_table=1
FT                   /translation="MKSFSARPAPRAAQHQMSATPSNNVHLLPQTNQLLGLYTIIRDRR
FT                   TKRPDFIFYADRIIRLLVEEGLNQLPVMPATVETHTAQKYDGVSFLGKICGVSIIRAGE
FT                   SMEQGLRDCCRSVRIGKILIQRDEETALPKLFYEKLPEDIADRYVFLLDPMLATGGSAI
FT                   MATEVLIKRGVRPERISFLNLICCQEGIDAYRARFPDIKIITGAIDKGLDEQKYLVPGL
FT                   GDFGDRYYCI"
FT   CDS_pept        join(complement(526799..526810),complement(526403..526738))
FT                   /codon_start=1
FT                   /gene_family="HOG000223548" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778407"
FT                   /locus_tag="AGOS_AFR053C"
FT                   /product="AFR053Cp"
FT                   /protein_id="AAS53424.2"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017132"
FT                   /db_xref="UniParc:UPI0001DB2AEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q754L9"
FT                   /transl_table=1
FT                   /translation="MNDSEKPRHDQHGQQPKRKFEGPKREAILDLAKYQDTQVRVKLMG
FT                   GRLVTGVLKGYDQLMNLVLDETVEYLRDEEDASVVTQRTRPLGLIVIRGTILLSLSPAA
FT                   GGAVVPGPAAE"
FT   CDS_pept        526957..527703
FT                   /codon_start=1
FT                   /gene_family="HOG000209180" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763638"
FT                   /locus_tag="AGOS_AFR054W"
FT                   /product="AFR054Wp"
FT                   /protein_id="AAS53425.2"
FT                   /db_xref="HOGENOM:HBG059365"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="UniParc:UPI0001DB2AEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q754L8"
FT                   /transl_table=1
FT                   /translation="MVELEIESELCALRREVALGVGWAQFAEKLHEWTGVDPRDMRLVV
FT                   TTADGKEQEVDGDVRQRAGTVEQAFPGGVRRVQVQDTNEGSVVHALRREMEGDGGEEAA
FT                   FRLSDEAYAGRADSVLAWKREQQLGAFDPEVRTRLAQERETQALAAAALPVGARCAVRT
FT                   RGAPERRGWLRYVGPVDELGAENTWCGVEFDEPVGRNDGTFNGRAYFGPVHSNHGAFVK
FT                   PTAVAVGPQFAPLADDELRLSDDDEL"
FT   CDS_pept        527800..528174
FT                   /codon_start=1
FT                   /gene_family="HOG000000854" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082757"
FT                   /locus_tag="AFR055W"
FT                   /orf_name="AGOS_AFR055W"
FT                   /product="AFR055Wp"
FT                   /protein_id="AAS53426.1"
FT                   /db_xref="HOGENOM:HBG059366"
FT                   /db_xref="HOGENOM:HBG397901"
FT                   /db_xref="InterPro:IPR011431"
FT                   /db_xref="InterPro:IPR016809"
FT                   /db_xref="UniParc:UPI0000253040"
FT                   /db_xref="UniProtKB/TrEMBL:Q754L7"
FT                   /transl_table=1
FT                   /translation="MEYIENFKYNLKESFHLDLHQGFRLLIIVAGYMLLRTQLQKILAN
FT                   RELKRKLAQDQAEEKRKRERLVEDPNQAPEAESTPFGWGEKARLRARRQEQLLQERAEQ
FT                   LQHEQAGADEDKDIEDLLEE"
FT   CDS_pept        528349..529053
FT                   /codon_start=1
FT                   /gene_family="HOG000247872" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931390"
FT                   /locus_tag="AFR056W"
FT                   /orf_name="AGOS_AFR056W"
FT                   /product="AFR056Wp"
FT                   /protein_id="AAS53427.1"
FT                   /db_xref="HOGENOM:HBG059367"
FT                   /db_xref="HOGENOM:HBG397902"
FT                   /db_xref="InterPro:IPR016264"
FT                   /db_xref="UniParc:UPI0000253041"
FT                   /db_xref="UniProtKB/TrEMBL:Q754L6"
FT                   /transl_table=1
FT                   /translation="MSFRRGGKTSTFSNLPFGLSYSAVGNNESTEKPTIPLPVNNPING
FT                   SERGIAIKYINFLESVRDGPFYTGSMSLSMDETEDSKKRKVKTLVDGGGINDGIERYSD
FT                   RYVKKRRIGTSVDEHPFSLEFFPKELYQVMGINKRKLLALSKFNKVDDIFTGTEQDDAS
FT                   VIPLMEKLKELAENEDEGDEFKDKNANEFEEELDDDFDDDDDDDYNAEKYFDDGDDDYG
FT                   GGDDDYGDEPAF"
FT   CDS_pept        complement(529456..530610)
FT                   /codon_start=1
FT                   /gene_family="HOG000142049" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778408"
FT                   /locus_tag="AGOS_AFR057C"
FT                   /product="AFR057Cp"
FT                   /protein_id="AAS53428.2"
FT                   /db_xref="HOGENOM:HBG059368"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI0001DB2AEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q754L5"
FT                   /transl_table=1
FT                   /translation="MYMDDRIIGGPEGYLEVFVRKAKDLPNMRKMDKQDPFVRLRIAHL
FT                   TEVSGTVFRGGQRPVFDFHTVFELTPAMKHLMYVELFDDQKSAPRIIGRCEVDLKPALY
FT                   SDHEDGYDRWYQLSLGPDDAGKIYIELTFKQHTIRRKSQIQPEPSPPPMTKTLKTKRSP
FT                   PLPSEIPYVPFPKDQLQGSISQSGFTYTHGGGMSQPLPALRRSPDTLQYIPRNPALPQV
FT                   EQLKLPEFVLSVDTLENFDAHTSQQSEGTGITAKLKQLKEKWNNFKQGSPEQNDAARAN
FT                   VDLEELQKVVGVKPDFPKQHGRMRSRHSISSGLQPALPPLPQPSDERTKLPGRRPSPHP
FT                   DFVPRSPSPGGQMRQSRNLVPLPPLPHEMRNTRSLSPVRRPPVF"
FT   CDS_pept        complement(530829..535610)
FT                   /codon_start=1
FT                   /gene_family="HOG000142048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778409"
FT                   /locus_tag="AGOS_AFR058C"
FT                   /product="AFR058Cp"
FT                   /protein_id="AAS53429.2"
FT                   /db_xref="HOGENOM:HBG059369"
FT                   /db_xref="InterPro:IPR021418"
FT                   /db_xref="InterPro:IPR021726"
FT                   /db_xref="UniParc:UPI0001DB2AED"
FT                   /db_xref="UniProtKB/TrEMBL:Q754L4"
FT                   /transl_table=1
FT                   /translation="MLAVDELNALAREHVPHAREVFTDEFLKDWATNADRLIAEYRTLA
FT                   KASEQVDFVYRVFAEGLLFTQGALRGLVGDYGPLASLLAALCENSSANARILANLINCF
FT                   PRHGGDEANMVELLQQLTGMDFEFSASLVEKLLLHRWAKEQTSLYKRSLISEKYHLKKY
FT                   NLLFESPLGFSQICMLLHVAYADKDRFQSADYYWRQIQFVAGKYTLDPIRVLDVILRVS
FT                   SVHVHHHHEFLVLLLQRSDYWPLQRSDPFAWETLNVGGSAVAAQLIAHKLKNEKFDHRY
FT                   MDMVCVLIREGFVSYLSIFDSLGPDDETLAKYVDEYYADLCKQSQEGSLNPLAMAAALP
FT                   DEDDGPPGATDSKGEDKAAQAALSEQKERDEQKQERERKNRQYKVKRTGKWRLVTSCLN
FT                   HGLLIPALYSIRTNEKTALSIDILVESVLRLFEHMIRPLHEKAINAPSYQPTPRVKMKM
FT                   THSGLPSKQGRLIYECLSPNVKEKYLLNTRYVFYYSCWADRLPVIGDVDGLFYHSHEIL
FT                   GLVGSKLSASPTLISMLSSIGVHDILSSENSELVTEKWINYFRKFIFPALGGLEEDFIA
FT                   NINAYNLLKLFPFEKRYFLYHEMYSKISDSDIFVRLTFNKVQRKVRGLLKSLSIDHIDD
FT                   KVNEVSRLVSSNPLAALEPIVNQIENYDKVSELVVIAAKGFPDFAYDVLQYVLLLKLTS
FT                   GRDILQIDGINQHTWIQRLSVFIAGLANSCPKMDLTNILIFTVKNLHKDYNASLPVLKE
FT                   LVSKVGGIQSLNHISWKQLQMLNSGPSLQKTARSRILDTRQENFEAARSITQTFIKIGA
FT                   ISELLVMLCNLNVVSQSPDIHYKILSTKCDDSNSLLWTLIEMFKFTLTREEFLHNVLPF
FT                   DELVNDYNVPTEWSFFIWRDYIDEMRHEGDSSIKQIDYILEKTEFRHVSFEHLDKPLFT
FT                   SFWKLTLYDVNFNKELYDETTKALNTKLDRTKLQRDKNAILNEVQEVMSNCLAHQKAFK
FT                   NVQEMFQDKRSVWFPELTPERVQAYIQFCILPRTLFSSSDATYSALFTIALLGVHDSIA
FT                   VFEKMVESHVLGGLLFSCTVSESTNVGFFYGMIIRTFEQARSEEAFDNSKLSRLHHLYS
FT                   VLLYDLRLLLSETNYMSIRNTIEFLNQISPIFPVVDEQIREACRSLESKLSDETREDIK
FT                   LPCNALIGHLKSRMKTACKKQDFYELPKEEQIEIDNFEKEQAKINEYEVAVAKETERKK
FT                   LEEVKPRKEAAKAVSSTSEKKGTSYSSSSDSKEYEKSQTSEDVRPISYQGTQILENIDS
FT                   ICKLLNSEGVDDLPQYIRVLYFKDEMRKELSNYKGNLDVFRKKLAAILTDYFYSMVKWP
FT                   NSNPLFAQKAAELEASCMQCGPPTSKATKMKVMADDLYGDDIPFNTSNTKTAKPQRESR
FT                   FSDVKVPAAAASEAKPADSKPQLDRFNKNSVKENPRAQSRFKESAPKQPSPAPKKDEKP
FT                   SGSRFHNSKPAAPKIPPPKPEPKSVNLRDRVGSRFEGRQDPASRFSGAHSESTRYPQSS
FT                   ARQLEPSPESRFRNVAKDSPRKRPTTDYRYNVDTKRPRKEDEHRRKPNSDRRPDAQPVL
FT                   PTGPKGSGTFSRFR"
FT   CDS_pept        join(535802..535804,535854..536105)
FT                   /codon_start=1
FT                   /gene_family="HOG000210519" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625865"
FT                   /locus_tag="AFR059W"
FT                   /orf_name="AGOS_AFR059W"
FT                   /product="AFR059Wp"
FT                   /protein_id="AAS53430.1"
FT                   /db_xref="HOGENOM:HBG028785"
FT                   /db_xref="HOGENOM:HBG395617"
FT                   /db_xref="InterPro:IPR009846"
FT                   /db_xref="InterPro:IPR017089"
FT                   /db_xref="UniParc:UPI0000253044"
FT                   /db_xref="UniProtKB/TrEMBL:Q754L3"
FT                   /transl_table=1
FT                   /translation="MSDKIREERLFQAMKQKHIGLGTDDTSRDEWLTQVHRDTYNSLLG
FT                   HSALLQYAALSGPTRNKAETRLAMVSRMCGGPATRRAPA"
FT   CDS_pept        complement(536123..536731)
FT                   /codon_start=1
FT                   /gene_family="HOG000142045" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763639"
FT                   /locus_tag="AFR060C"
FT                   /orf_name="AGOS_AFR060C"
FT                   /product="AFR060Cp"
FT                   /protein_id="AAS53431.1"
FT                   /db_xref="HOGENOM:HBG059370"
FT                   /db_xref="UniParc:UPI0000253045"
FT                   /db_xref="UniProtKB/TrEMBL:Q754L2"
FT                   /transl_table=1
FT                   /translation="MVDTHRNLARKRARGGAAEAGGAAGGSLFGRVGQQQRSAGPVGAA
FT                   GLRVINGKLVRADDVGAQLREFNRAHAGTGRRARRARRVPRETRAVFSSSNYDDGAGRR
FT                   RLVVSLRSGAQFLTIRNLPIGSRPERLKQVIEAQGLGRVAHLQTLDLASGSAVAEVHVA
FT                   GADGVRTLQQLVQRFHGAEIDGRRVTAEISSISELQPQP"
FT   CDS_pept        536984..538495
FT                   /codon_start=1
FT                   /gene_family="HOG000206192" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082758"
FT                   /locus_tag="AGOS_AFR061W"
FT                   /product="AFR061Wp"
FT                   /function="actin binding"
FT                   /biological_process="cytoskeleton organization "
FT                   /protein_id="AAS53432.2"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0007010"
FT                   /db_xref="HOGENOM:HBG028695"
FT                   /db_xref="InterPro:IPR001837"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR013912"
FT                   /db_xref="InterPro:IPR013992"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="InterPro:IPR018106"
FT                   /db_xref="UniParc:UPI0001DB2AEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q754L1"
FT                   /transl_table=1
FT                   /translation="MLEANFSIQGYNLVKLLKRLEDATARLEDVTIYQEGYVQSKMGSA
FT                   AGQTSMGSQVSAEGGAAAEAPAHMQEYEQLVDEWVRPLVGAGQQIDAAVGEASQQLLEG
FT                   FAAQGTLLRAAALARKPEMGSEGFMRALGPLNERIMTLGALKDAQRQSPYFAYLSAVAE
FT                   GAPAFGWIASETPVSLIGDFKDAAQFWTNRVLKEFREKDANAAEWVRLFLGTFDALRGY
FT                   VKAHHATGPTYKSDGVDFMEAFEQVSGVVAAEPAAAAGAPPPPPPPPASVFQAPADGGS
FT                   QGINAVFAELNQGENITRSLRKVDRSQQTHKNPELRAASSVPSSAGSRTPPPKPRKPTT
FT                   LKTRKPPRKELVGSKWFVENYDGEADPIIIETNKDESVFIGRCNNIFIQLKGKVNAVTI
FT                   SESQHCNLLLDSSISGVDVIKSERFAIQVAQQIPQITIDKSDTGVIYLSKDSLQTELFT
FT                   SSSTSINVNIPTGDDGDFEEHPIPEQLKHTFSNGRLNSAIFEHVA"
FT   CDS_pept        complement(538633..540054)
FT                   /codon_start=1
FT                   /gene_family="HOG000209594" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778410"
FT                   /locus_tag="AFR062C"
FT                   /orf_name="AGOS_AFR062C"
FT                   /product="AFR062Cp"
FT                   /function="rRNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS53433.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG051720"
FT                   /db_xref="HOGENOM:HBG397980"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI0000253047"
FT                   /db_xref="UniProtKB/TrEMBL:Q754L0"
FT                   /transl_table=1
FT                   /translation="MPRKALLLKSLSRGKVRASFNKYNLFNLYKKSQIDLRTKTLYQQK
FT                   WSSKQETRAYHGEHLTESRWQSTFSPRLTSVAQLDASLKGGDVAPTPILMQTYAVLEKR
FT                   LEFALFRAMFASSVRQARQFILHGNVYVNGVTMKHPGYPLKAGDMFSVRPDKVLEALGA
FT                   RKPSLEQALAIDKQQIRMWNKYVTEARNNPREAWQGKIKQLQSMQASHPERQVFVELIN
FT                   HNNKQLDEKKLAVLKSTDKESLLCKVLAAAREHDGEKSISAATFRTASYGDAELAKALF
FT                   EIYKTLEKSEALKILQDKTAEEQAKIILDSAAPEVSDAMKKKLRTTTSELGALMQQHDA
FT                   AIRAFYDGKKGDPATLEMPYDSEWVESLRLHPQLKTKELLEDPAAAQKAVNLPWQKWPY
FT                   GRQNPNKPYFTPWKPRPFLAPFAILPHHIEVSFKACHAIYLRDPVARPGHSEVISPFPL
FT                   PVHERAYMYYLRKGQ"
FT   CDS_pept        540312..541013
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763640"
FT                   /locus_tag="AFR063W"
FT                   /orf_name="AGOS_AFR063W"
FT                   /product="AFR063Wp"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="H4/H2A histone acetyltransferase
FT                   complex"
FT                   /protein_id="AAS53434.1"
FT                   /db_xref="GO:0043189"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059371"
FT                   /db_xref="InterPro:IPR012423"
FT                   /db_xref="UniParc:UPI0000253048"
FT                   /db_xref="UniProtKB/TrEMBL:Q754K9"
FT                   /transl_table=1
FT                   /translation="MGVKWSTVDEIRLFKWVAQFKPAGIHKHFHMRCILERLNNPDDYP
FT                   VTLLQSDEPRKTFSAQDVWEKLAEYYDLQQADLVEGMQVGEDAADDGAPPGGFSLPWGE
FT                   YGELMLHNARADGAGDDEAEPDAGAARDDADERPRSSAGSTGARTRRQTRQTRSQQAGS
FT                   DDEKPSAPPSAPDDAPDDEPDEDGDLPPSKKPRTRAHDDAPGSSASDSPAARTRRKAVN
FT                   PPVQRRLRTRR"
FT   CDS_pept        complement(541054..541398)
FT                   /codon_start=1
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778411"
FT                   /gene_name="FPR1"
FT                   /locus_tag="AFR064C"
FT                   /product="FK506-binding protein 1 "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53435.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG430304"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI0000253049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754K8"
FT                   /transl_table=1
FT                   /translation="MSEVIEGNVKIDRLSPGDGKTFPKTGDLVTIHYTGTLENEQKFDS
FT                   SVDRGSPFQCNIGVGQVIKGWDVAIPKLSVGEKARLTIPGAYAYGPRGFPGLIPPNATL
FT                   IFEVELLKVN"
FT   CDS_pept        542050..542541
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082759"
FT                   /locus_tag="AGOS_AFR065W"
FT                   /product="AFR065Wp"
FT                   /protein_id="AAS53436.2"
FT                   /db_xref="HOGENOM:HBG059372"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniParc:UPI0001DB2AEF"
FT                   /db_xref="UniProtKB/TrEMBL:Q754K7"
FT                   /transl_table=1
FT                   /translation="MKFASTVAVFAAASVVYAQHPISQIGDGQIQANTDTAPPTKVPPT
FT                   TAAPPPASSAPPAAPPAAPPAAPPAPPAQPPKQEPPKSEPPKASSSAPPASSSAPPKPS
FT                   SSAPPKASSSAPPKVTSAPPAPTTSAPPAIETQSTNAAGNLAASGFFAAGVMAAGALLI
FT                   "
FT   CDS_pept        complement(542945..544057)
FT                   /codon_start=1
FT                   /gene_family="HOG000294684" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625866"
FT                   /locus_tag="AGOS_AFR066C"
FT                   /product="AFR066Cp"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS53437.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001DB2AF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q754K6"
FT                   /transl_table=1
FT                   /translation="MSIPATMKAVVIHSDQCIVKDDLPVPKLGMNMALIKTKAVAGNPT
FT                   DWKHIEFKLGPQGSVLGCDVAGEIVQLGPNSDSKWAVGDTLFTVVHGASVRNPENGAFA
FT                   EYVRVDLPVCIKLPLGPADKEVLQEGRVETFEGAATMPVTLLTAAQVLCLNFGNKLDWE
FT                   PAHVQHDHPILIWGGATGCGQYLIQLCRKLNAYSRVIVVASKKHEARLRKFGADEIYDY
FT                   HDEDVVAQIARDHPNLYHLVDAVSVPETLRLVYKLAPTSAPVKLVQLTHMSAKGTIPED
FT                   ELKSNVEVGNTMLYQISGEDATIGKITHPASPAYRKQAISFVDFITPKIADGSILHIPV
FT                   KVSQGLESVPSIIRDIKQGKTDGHKLVAKL"
FT   tRNA            join(complement(544647..544684),complement(544573..544616))
FT                   /gene_name="tRNA-Leu"
FT   CDS_pept        544975..546621
FT                   /codon_start=1
FT                   /gene_family="HOG000226730" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763641"
FT                   /locus_tag="AFR067W"
FT                   /orf_name="AGOS_AFR067W"
FT                   /product="AFR067Wp"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53438.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="HSSP:1A6D"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012720"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000025304C"
FT                   /db_xref="UniProtKB/TrEMBL:Q754K5"
FT                   /transl_table=1
FT                   /translation="MNFGNQAPTIVVLKEGTDASQGRGQIISNINACLAIQDTLKPTLG
FT                   PLGSDILIVSSDGRTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVTII
FT                   AGELMKEAKPFLEEGISSHTIMKGYRKAVQLAVKRIKELAVDISGDKVSRDLLERCART
FT                   AMSSKLIHQNADFFVKMCVDAVLSLDQEDLDEKLIGIKKIPGGAMDDSVFVNGVAFQKT
FT                   FSYAGFEQQPKRFQDPKILCLNIELELKAEKDNAEVRVEHVDDYQSVVDAEWQIILDKL
FT                   KQIEDTGANIVLSRLPIGDLATQYFADRDIFCAGRVSTEDLNRVIQATGGAIQSTTSDI
FT                   RVEHLGTCATFEEMQIGSERYNLFQGCPEAKTCTLLLRGGAEQVIAEVERSLHDAIMIV
FT                   KRALQNKLVVAGGGAIEMEISKYLRDYSKTIAGKQQLIINAFAKALEVIPRQLCENAGF
FT                   DAIEILNRLRLAHSKDEKWYGVDFETENIGDNFAKFVWEPALVKINALSSAAEAANLIL
FT                   SVDETIKNKESEGANAGMTGPGARGRGIPMH"
FT   CDS_pept        complement(546698..547312)
FT                   /codon_start=1
FT                   /gene_family="HOG000241980" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625867"
FT                   /locus_tag="AFR068C"
FT                   /orf_name="AGOS_AFR068C"
FT                   /product="AFR068Cp"
FT                   /biological_process="protein transport"
FT                   /protein_id="AAS53439.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG202451"
FT                   /db_xref="HOGENOM:HBG379179"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI000025304D"
FT                   /db_xref="UniProtKB/TrEMBL:Q754K4"
FT                   /transl_table=1
FT                   /translation="MARNPAAGLENTLFQLKFTAKQLTRQAAKAAKEEKQETNKLKKII
FT                   GESEEIARLYASNAIRKRNERVQLLKLASRVDAVVSKVQTAVTMRQVSGSMAQVCKGMD
FT                   RALQSMNLQQITMIMDKFEQQFEDLDTSVNVYEEMGQNVDAVVVDNDKVDELISQAADE
FT                   KGLELKQSAQLGELPRVQNAPAEVTEDKEDKLAQRLRMLRG"
FT   CDS_pept        complement(547567..548493)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778412"
FT                   /locus_tag="AGOS_AFR069C"
FT                   /product="AFR069Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS53440.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG059374"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI0001DB2AF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q754K3"
FT                   /transl_table=1
FT                   /translation="MLSTSASGGAGGEVITGGAEVRDGDAESRGDGRGAGAGCPVCQNC
FT                   HTSTTPLWRRDEHGAVLCNACGLFLKLHGRPRPISLKTDVIKSRNRKAGHEEKRRREGG
FT                   EGSGPAERKRGRAEPGALPQLAQLLNGVPEAEPPTDARPGSALHGPGPARGPAYKSPIN
FT                   MLLNDKPQDAGFQPAASPAASVLRAPSLTPVPAAPAYHAFSPRSQPPSQDHTAYLHAGL
FT                   LHPQGLRDGAPFAPADIASYSSSAQIIKPAPDTATPLSQVLHSQEEVIRLKTRINELEL
FT                   INDLYKRHIFELNDRCKMLEMKHQLQK"
FT   CDS_pept        548779..549189
FT                   /codon_start=1
FT                   /gene_family="HOG000220249" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763642"
FT                   /locus_tag="AFR070W"
FT                   /orf_name="AGOS_AFR070W"
FT                   /product="AFR070Wp"
FT                   /protein_id="AAS53441.1"
FT                   /db_xref="HOGENOM:HBG059375"
FT                   /db_xref="HOGENOM:HBG701191"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="UniParc:UPI000025304F"
FT                   /db_xref="UniProtKB/TrEMBL:Q754K2"
FT                   /transl_table=1
FT                   /translation="MTDTRDRAPFPYGIKSFDFHTYIPLADPAPALRFRDAVCSEFQDA
FT                   LRSGAANAYEPHMGSIGPHVEAGLGMFEFDVCDADVFTRMLHFFQLNHGPLSVLIHPRT
FT                   ERGELWDHTEGALWLGAQVALDLGALADEAHL"
FT   CDS_pept        549254..553987
FT                   /codon_start=1
FT                   /gene_family="HOG000193520" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625868"
FT                   /locus_tag="AGOS_AFR071W"
FT                   /product="AFR071Wp"
FT                   /function="catalytic activity"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="AAS53442.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG059376"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR016555"
FT                   /db_xref="UniParc:UPI0001DB2AF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q754K1"
FT                   /transl_table=1
FT                   /translation="MGSDDGESAHSVQYFGSATQLAGERPTQKASVIPGIYAEAEELGG
FT                   EGGGEDVGEAEHECPLLGARGEEVEDQEAEYKNLVFQGVPNSTITTMERGFTRRGSAGK
FT                   RRSGSVGENTPTWLAKMNPQDSFTGWKKEFGQAFKKISKLTSRRSASRGAGRAKTDHES
FT                   VASAGITEEEMIIQNMASDLIATLLAGCPGALFAGSGFLRDEHGVRRAPLLLAMLSVRV
FT                   SPVTNSDTLLSLQRVSSATTSTTNASSVSHVEKQDGGIAIVDQGYHTKYKLELEYGVGD
FT                   NRLKWIILRSYKDLASLHGKLKLVSFQQNTLNKLYIDHNRYQRIHLPHFPRFDDYMKKA
FT                   KKGPASVPSPQDHPRTSESSSNTPRSSLNFEAKRFHMKHIQDLIDETDDVKKPMHKRIE
FT                   KYLRLLNLSLSLRPQANRLFQFYELSPISNLLSYESGFQGKQGYLIIRSSAKAQGWRVS
FT                   HFRFNDWRAMIERHTNKWFLVRHSYIMYVSDMCSTTPLDVFLVDSKFKVTCSGNFLEDN
FT                   NLYEEDPLEDKQKKISTKLLITLENSERKLQMIAKSEYMLKIWVSSIIQMQKNTIWANH
FT                   QRFGSFAPVRRNCFCHFLVDGRDYFWALSEALTMARDVIFIHDWWLSPELYMRRPVQSN
FT                   QQYRIDRVLKERAEAGVKIFIVVYRNVGSTVGTDSLWTKHSMLSLHPNIHLIRSPNQWL
FT                   QNTYFWAHHEKMCVIDHTIAFMGGIDLCYGRYDSPEHVLRDDASDLQQQNFPGKDYSNA
FT                   RICDFHDLDKPFESMYDREVIPRMPWHDVHMMTVGEAARDMSRHFVQRWNYLLRQKRPS
FT                   RPTPLLTPPSDFTPEELENSEFFRNLNSRSTCEVQILRSAGNWSLGLQETEKSIQAAYL
FT                   KLIETSKHYIYLENQFFVTASNWDGVFIENKVGDAIVDRIIKANSEGKLWKAFILIPLM
FT                   PGFDSEVDQPEGSSIRVIMQCQYQSIARGETSIFAKLRRLNIDPLQYIQFYSLRKWSTL
FT                   GQYDKLVTEQLYVHAKVMIVDDRSCIIGSANVNERSMLGNRDSEVAAIIRDTELVKSKM
FT                   NGEDYYAGRFALELRQRLMREHLGCDVDLVEIIERKFSRLEHVALANVETLNLLSREGA
FT                   AHSNKELKIQSAMLEIGFREVMNEQCSDMWLEKYGSGQVKNFGIEVDHNIYMDSDNVPE
FT                   QFLYNNSNHKKTPLPSKKGRQHGRRRYNSKPKYHSFNNRAGEANVGIRDKKPISTDSRL
FT                   VGNETHMKDVEGLGPDGWKNVTRKFKENVTQQLMDWATEVMNIQSIDGKKENQNNTNIS
FT                   FLPDKEDVMQYLQDSGIPDINKWNMLKRICYLQHLSYKKETKLTEHKKLSKDTADTIQR
FT                   TLDFLGEEEMDDDAVDIMLAQMVPPIGGENKQPFANLHFMDPYAFEDPIVDSFYEDMWF
FT                   AVALRNTLIYRMVFHCQPDNSVQTWRDYKDFQKLSQGFDELQRKMIEMEYGEKVTILDD
FT                   ISENMSNISLEKGTKIKSVPPDIADSLSMDADLPPHHQQAVKTGAVRAPTHTKMKLSSS
FT                   LLYGINQKIFDRHTARRLLERINGHLVIFPTDWLAKEVESKNWFYNADRLPPIDIYD"
FT   CDS_pept        554618..556216
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778413"
FT                   /locus_tag="AGOS_AFR072W"
FT                   /product="AFR072Wp"
FT                   /protein_id="AAS53443.2"
FT                   /db_xref="HOGENOM:HBG059377"
FT                   /db_xref="UniParc:UPI0001DB2AF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q754K0"
FT                   /transl_table=1
FT                   /translation="MQNRPSIVVCEHHRSTRGERTGSHGRPGINRVNSSAPPSKLRGNG
FT                   EVTGTVELYPVLENQEESATTRSSACTGPTPRKQVKEFRIPNKLNAERIVNGKLLQKRL
FT                   KPSLLDTETRRGYSAFEHTNPRGMHAPLNIYFNGHGKATPATNAAMYREQPRAGTWKYR
FT                   PGYLGPPSAARALPTDRKNFFRIGIDTSPLTERNGHYSSVLPGGASTDVECDDDVPAAC
FT                   KIELTINDDIQSPGVLDENEIGTNTRDSSTAHMSQLNRTPDSPSSQVDPHLENKPILDY
FT                   FSGMIATFRDGSLQAKNKANALKSRFASYTEAAKLSQTVLPDKLNSTDFTKSPSPEGDA
FT                   AGQSPLQRSDFMASTPRTLQKLYVEFENLNSKRDDLADGPIELKFWLKQDFSTRLLQDQ
FT                   LNNELRMIQRFSSSGQTIMVNQVTSFLKRQGSRDITDDEYQSLTIQSSPKVSKEGSNCS
FT                   PSYNFEDLISGKKWPPERPGKSSVFHQIKDDRLRYNLEETYAIAENLWKKAEIGQLEMV
FT                   SNKVHLSRHTGCVSR"
FT   CDS_pept        complement(556329..557063)
FT                   /codon_start=1
FT                   /gene_family="HOG000193563" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763643"
FT                   /locus_tag="AFR073C"
FT                   /orf_name="AGOS_AFR073C"
FT                   /product="AFR073Cp"
FT                   /protein_id="AAS53444.1"
FT                   /db_xref="HOGENOM:HBG011740"
FT                   /db_xref="HOGENOM:HBG395669"
FT                   /db_xref="InterPro:IPR007881"
FT                   /db_xref="UniParc:UPI0000253052"
FT                   /db_xref="UniProtKB/TrEMBL:Q754J9"
FT                   /transl_table=1
FT                   /translation="MSSLPRSMQDLREVQSKPRVPLVIRRLFKSPRNLDFEAAMWEMVH
FT                   LIFKPRKAFRSAYYQRQIKHRLSRDDPSFFILQVILLIATSLTWSIGYGHTFSGFLKMM
FT                   INMILVDFFLLGFTMATFFWVLLNRPQLKFRSAQDSTVEWAYCFDIHCDAFLIIWVLLY
FT                   FLQFLLLPVINLHRWIGLFVGNTLYCAAIGYYFVLTFYGYSQLSFLKNVNFILLPSLFC
FT                   VILYLVSLFGIDLSNYLSFSRY"
FT   CDS_pept        complement(557299..562623)
FT                   /codon_start=1
FT                   /gene_family="HOG000093519" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931391"
FT                   /gene_name="UTP10"
FT                   /locus_tag="AFR074C"
FT                   /product="U3 small nucleolar RNA-associated protein 10 "
FT                   /function="binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="AAS53445.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG059378"
FT                   /db_xref="HOGENOM:HBG395739"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012954"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR022125"
FT                   /db_xref="UniParc:UPI0000253053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754J8"
FT                   /transl_table=1
FT                   /translation="MSSLKEQLAQVAASNATVALDRKRRQKLHSASLIYNPKTAATQDY
FT                   DFIFDNATSALEELVEIDVRFKVFSRSLFSASSVNIDRNTQTKEQVRTLDQAVNAYLML
FT                   ASAWWHLTPTLHATEWLVRRFQIHVHNAEMLLLSTLNYYQSPVFKRILNIVKLPPLFSS
FT                   LANFAKAESVPSNLTIVKLFNDMDFLTLYTSYVGKVVKQKVTYTNQLLFNSCAFINLVA
FT                   FNSNSEEKLERLVPILLEVCAKLLASPSDDCQMAAHTVLVVLVTALPLKKQILLAATET
FT                   ILANLADSASTKRCAFVTVCKLFQTLKGHGNVDQLPANIYTLFDSKISNDCLIDFLSKK
FT                   ETPADKFVTSYVRSIARYDHGKLNSIVSILKQVKLEKFEVRLIITDLIHLSELLEDKSQ
FT                   LIQLFEFFISIDEDMVLRCLHSLNLTGELFEIRLTTSLFSAERIEPVNGEDVVKGLEAS
FT                   KVAGLAGGAQPFTEFLNKNSAYICTKNISLLVEDDEQASKLLSLFVESVGKKYQPGLFL
FT                   SSFFTTLESRITFLLRIIVSPGAPVALRLISVSNLSKLIHTIGNDTNVFTLVPVLIVAL
FT                   TDISKNVRAAVKKVLHQISKRPFTKRYFLNDKIYGEGQSVPMLNPKESESWLKTFLDGY
FT                   LVENYDISQLLIPKKNEKMYLLFWANQALYMPLPQPKLVLMRFLARHESFSSTYSQLWE
FT                   NFLSSYLEQRPQWELKCSKNKTNFCEFESVLVLLLSKKEKNPAAIEFLLGALKSPFEQL
FT                   ASIMAKRLIEIYPTLKQPVQCQIVQDIIESTASADLSYDSIETLQSLALSADVVVSVIK
FT                   QNMINVDETSNIIKKRRRRSSASNKAALQKEEVSRIAEIHLRKLTILLEALDKIKVQGS
FT                   EALLTSLFDILADLDTLDNDGGLPVLYAQETLASCMLHTIDSLRATGATPKLRSVRTDI
FT                   LVAAIRASSSPQVQNKLLLVISALALLNPELVLHSIMPIFTFMGAHSLRQDDEFSTMVV
FT                   EKTVKTVVPALLESGSSSMTDEIEFLLMSFSTAFSHVPKHRRVRLFTTLIKTLQPSSSI
FT                   APFLFLLSQQFSAKVENFEIAESKSILEFSRSFMSKFAVLDQLTGIAGLFELVKLLSEP
FT                   DLKDKTSPRTLLSNGILNYTPSEMFNYKRNTFDFMDKILAEDNQGGNKGENNLKLKLLS
FT                   ALLDPQTEEQVKSDVKDQFAKVLQHNLVFINNVEELCSTQDLTEQGKSDGDESGSEPDN
FT                   DNPVADMTEILFSLLGHILDLLPISTFVESILPLLGKDTEDIIRKHLTLVIGTKFESEP
FT                   NSSATYANMTASSLLAIVTDEAEAPGVVQAALNTTSTLVSKFGDRLDASTLTECLKIGV
FT                   QKLNSSSTDIVVSALAVLTNTVHVLGVKSIGFYAKIVPRALAIFDSVQDTKSDLRKEVQ
FT                   LSVVLLFAAMMKRIPSFLQSNLKDVMRAIFFADEVQNSISLYVISLLVQQLDLKEVLKT
FT                   LYRIWTTDISKTGNSVAVSLFLTTLESTVEAIDKKSATSQSPTFFKLLLAMFEYRSVST
FT                   FDNNTISRIEASVHQIANIYVLKLNDKIFRPLFALTVRWAFDGESVSNLQITKVERLTA
FT                   FFKFFNKLQESLKSIITSYFTYLLEPTNALLNDFHSGAVSDTNLRRLTLTALTASFKYD
FT                   RDEYWKSTARFELLAESLVNQLANIEDSIGKYLVKAIAALASNNAGVDEHSKLLHRALV
FT                   EHMKASCATSQKLWAVKATKLIYAKVGEHWLVLLPQLVPVIAELLEDDDEEVEQEVRTG
FT                   LVKVVETVLGEPFDRYLT"
FT   CDS_pept        complement(562944..565166)
FT                   /codon_start=1
FT                   /gene_family="HOG000171322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763644"
FT                   /locus_tag="AFR075C"
FT                   /orf_name="AGOS_AFR075C"
FT                   /product="AFR075Cp"
FT                   /protein_id="AAS53446.1"
FT                   /db_xref="HOGENOM:HBG124694"
FT                   /db_xref="HOGENOM:HBG397693"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniParc:UPI0000253054"
FT                   /db_xref="UniProtKB/TrEMBL:Q754J7"
FT                   /transl_table=1
FT                   /translation="MGKNKKQAAEGEEARRGSESSGSSAEPSGAVAELPSFKKTAGGAR
FT                   SGLIEQDAVDTIREQTAVKFADEDEVVEQDEAAQKTEAVASESSSLADKEECDESKLDH
FT                   FRKFFRRTSSRSSDEGEGGGMMERFINMTGGGMVPVVTEAPEEDEEAGPDPTAEAEAAA
FT                   REIMKAHHLSSGQSVDMMSMSSSGESGFFMPVAEHYDDEYNPEQEEEQRDDMSEATYVP
FT                   PPQHVRGGVLGSLLRLYQNQPGGQAPQRPGLRKSAQTLSSETLPTGESYEMPKFKAKRP
FT                   RGSKIPNPIKLKRKSAMSEARITVHIADLLQRHRFILRLCKAFMMYGAPTHRLEEYMVM
FT                   TSRVLEIDSQFLYLPGCMVVSFGDTITRTSEVQLVRCSQGLNLWKLHQVHSIYKQVVHD
FT                   IISVEDASRTIETIMAEKNLYPAWMCVLLYGFCASMVTPFAFGGDWINLVVSFGIGCCV
FT                   GLLQFIVAQRSHVYSNVFEITASIVVSFCARALGSIPNSNICFGSTVQGSLALILPGYI
FT                   ILCGSLELQSRSLVAGSVRMFYAIIYSLFLGFGITLGAALFGWIYRDATNETVCEKELS
FT                   PWFRFIFVPGFALGLSLINQARWSQIPVMVCIACSGYVVTYWSGQHFTASTEFTASIGA
FT                   FVIGIMGNLYSRIWKGLAMTAMLPGIFVQVPSGIASKSTLLSSVQSANNMVSNGTNAAV
FT                   NSVDGRTSISFGITMIQVCIGISVGLFASTLVVYPFGKKRTGLFTL"
FT   CDS_pept        565674..568136
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763645"
FT                   /locus_tag="AFR076W"
FT                   /orf_name="AGOS_AFR076W"
FT                   /product="AFR076Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53447.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG059379"
FT                   /db_xref="HSSP:1B38"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000253055"
FT                   /db_xref="UniProtKB/TrEMBL:Q754J6"
FT                   /transl_table=1
FT                   /translation="MKYYSKKGHREQAEAMGVPPDVNNPPFYIPLKPVEGRYKLIQELG
FT                   NGSFGSVTLAKAQFEISQINGKEGTLMDQSIIPTIREENWNNKNKGLVAIKTMMTRLPT
FT                   LNDYTRVREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMKCRKRRV
FT                   FSLPTLRSILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHYPDNYV
FT                   VKIADYGLARHVTNKSPYTAYVSTRWYRSPEILLRQGSYSRPLDIWAFGCVAVEVATFK
FT                   PLFPGADEMDQIWKILELLGTPHPCHESKISGYVPHGGAWLQAEHLASRLNLKFPYVEG
FT                   KDISWVMCNPQLESLCDVVRACLVWNPDDRATVEDLSQMPYFAGTIVQETKQPPLSTAQ
FT                   SALMFAGLLPSSGLQHRRLIFNDNANNHNSNNSNGSNNATTTTTTTMTTNMTAATTKKT
FT                   TRTGGPVNRKRETNDENDVESLAHPIPIKRTLANLLSFNKEEPQLSFREFLKETSADKA
FT                   KPNASNSNSGNCAANQLGHSNHNINNYLNRNNNSGTQHGPSYNNYGQNLNQQSGSSNHS
FT                   GNGRNPTNNTHAVNTAITQTNTNKTNPTNNNTNNNNNTPTPTTTTTTTTTTPTPATTTT
FT                   TITNHNGQHDDNDNDKSNFRNVGDGRAASDSTLSGPEELTKEISANIELYQEPPPLAEE
FT                   QPLYDDIFGTTENIELDEDGDDDDPEDEDVSFILMYKNAVNQGGAGATQRENIEPLARN
FT                   YIHESTHQNCHAIDEMSIDDASTDSHSQIPRDFIMEPTTIPQHDILPPAQVRHEPTPNH
FT                   SFEDGLSF"
FT   CDS_pept        568932..571310
FT                   /codon_start=1
FT                   /gene_family="HOG000141785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763646"
FT                   /locus_tag="AGOS_AFR077W"
FT                   /product="AFR077Wp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS53448.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059380"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI0001DB2B03"
FT                   /db_xref="UniProtKB/TrEMBL:Q754J5"
FT                   /transl_table=1
FT                   /translation="MRPSTNSDSAAYHPEEQSLLEDASTLLMFSKSNHGGGRATRAAGA
FT                   EQQRQAAGSTREGSGEPPASADAPLKSPGPALVALLEPEPASAAGDSSRRHSRTSSTSS
FT                   SASNKGKVAAAALAAAAEVPFPVKRTRDEAQRPDRQRQSSLSSVKPESRGSWSAREEWP
FT                   VSDSYIVDPDEGIITCVCGYNDDDGFTIQCDHCYRWQHATCYGIEDESAAPDDFLCKVC
FT                   SPRNIDVKAAKRKQQERIKNNRRRRRGASAEDKPVKEHSAGAIDTPASEGNDVSNTTPV
FT                   SHSPSVAAAELSNKQPFMNAKEAYPAVYLPLDTYDIKDKYVVMFLDRHSDDDWVTPYNK
FT                   RTFKPLPLEIRAYSEPSHSRVFHGFPKLGVYSQQPCAKDTLIAEFLGEVDFQRKYLEDP
FT                   RNNYRLLGIPNPKVLFHPHWPIYIDARLCGNLTRYLRRSCYPNVELVTIKMPADDRQAS
FT                   DVKTNKSVKFVLKALRDLERGEELHIKWDWDLRHPIWRVINGAAVESIAEPEKYLLIHS
FT                   VDTVLSICDCACGSNNRDCHLLKVKKFSQTLYRSVKSKMNNRYKLNEILQKGKVQNRRQ
FT                   TPILSSLAHEAITNSARAHEVLVKLNATKLNFLSSRGKGERNTSFMVTKPPSSLKPETV
FT                   DSGHKPLNGNAKDAQPYKWRLLGKYLEQRASSVLSGSPIKLLSSPANYSETNITDLQAL
FT                   AIPVEVQISASAPKPAPSVDLPRPSSERSDTPVANVPTSVEATAHHVPVSVSPLAEAVS
FT                   VGAVVNAVAGPAAANAGSGVQNSKKKLSFADYKKKVKPT"
FT   CDS_pept        571599..572009
FT                   /codon_start=1
FT                   /gene_family="HOG000180095" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763647"
FT                   /gene_name="PAM16"
FT                   /gene_synonym="TIM16"
FT                   /locus_tag="AFR078W"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM16"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS53449.2"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG435009"
FT                   /db_xref="HOGENOM:HBG734654"
FT                   /db_xref="InterPro:IPR005341"
FT                   /db_xref="UniParc:UPI0001DB2B04"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754J4"
FT                   /transl_table=1
FT                   /translation="MAHRVLVQVIFTGARVFGRAFTEAYKQTAAQMAKQGTSSAARSQG
FT                   GMTNEYGGITLDESCKILNIEENGPEMNLDKVEQRFKYLFDINDKEKGGSFYLQSKIYR
FT                   AAERLKWELAQREQADKGASAHPQDQQPGPQN"
FT   ncRNA           complement(572250..572490)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR37"
FT                   /product="AgSNR37"
FT   CDS_pept        complement(572660..574009)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763648"
FT                   /locus_tag="AFR079C"
FT                   /orf_name="AGOS_AFR079C"
FT                   /product="AFR079Cp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS53450.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059381"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI0000253058"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Y6"
FT                   /transl_table=1
FT                   /translation="MQAEAGDLLEDLIEYAKQVSYYVENHADMVPRQTPSPNLECDRSR
FT                   KGPATPNAHQQPKVDEDRDLQLAKCSLVTSPGEIGDPEWPRHNWEHLQKHPENDLCVIA
FT                   SPGGAKRVFSIEHSGLILRPVSGSRSELSDFRRPGALSEILFQQWKLWEGRLTHYAQAE
FT                   PLAPTIAWNGLAYRWQDGSYTATGVPDSYKAYYAQYCKYYSRLGYCSNKPCRYVHDRRN
FT                   RGLCRSVAAGHTCATGRQCPLLHEPNEYIAEDCPAFHAGSCPHTHGAVDTFDRQRANPL
FT                   LRAGLCHRVHRAPPAAADHLCRPFAYTSFCFRGLQCPFLHLKLCPDFYSTGTCFILGCQ
FT                   LYHELPEPYCRPASLAALEPAMYLLPPWGQSATTPLPSVWYGLRSLQQSLDEAGAAQAL
FT                   ARLGAVALQASGNSHREEACSTDVSTDYSSADSLHINSDVECNNEDFVRL"
FT   CDS_pept        574181..575698
FT                   /codon_start=1
FT                   /gene_family="HOG000141760" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763649"
FT                   /locus_tag="AFR080W"
FT                   /orf_name="AGOS_AFR080W"
FT                   /product="AFR080Wp"
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53451.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG059382"
FT                   /db_xref="HOGENOM:HBG397930"
FT                   /db_xref="InterPro:IPR009349"
FT                   /db_xref="UniParc:UPI0000253059"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Y5"
FT                   /transl_table=1
FT                   /translation="MNEAAATRYAVERIPMLVPLDEVSIKELCSSILTRANGNLEIVAE
FT                   ELLEILGHTSEAYEFVFRFNEALSGATGSTAGQSEADEKANRNASGRKLPIIMLNDTDI
FT                   TEDVVPDCPPEYDQEEAAEIAVSERLASHKTQGSKLHTLQEIDEALKALELRGSGSDGN
FT                   ASYKCNCQATMHPLFELAPNCLNCGKIICCREGLHMDSCSYCGTLLIPKQQQRDIEKVL
FT                   QRERELVKAKRQETGSTGKKKEKVFKISNAKGRNMFSEQERLFDKLDRQREREMKRNQV
FT                   LGAEDMSQEEDSILKAEEVDPELRAAQARLENLLHFQDTSEERTKIIDTASDYSMSNDA
FT                   GIWGSAYEKAMALKRQQHNLRQWEKSERERNGRRDKIKLDLVLEKDGKVRFEESRVPGT
FT                   RRGLTEDDIDELSDPDEREELQDIKELRKRINAEKQAEKESLLGNTWDFEKDKSRFRKP
FT                   VYVGPGPADDDDSKQDLDSEETLQQHSRVQLDSADDKSVEESILAFL"
FT   CDS_pept        complement(575785..577233)
FT                   /codon_start=1
FT                   /gene_family="HOG000141759" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625869"
FT                   /locus_tag="AFR081C"
FT                   /orf_name="AGOS_AFR081C"
FT                   /product="AFR081Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="signal transducer activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53452.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123892"
FT                   /db_xref="HOGENOM:HBG202175"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000025305A"
FT                   /db_xref="UniProtKB/TrEMBL:Q754J3"
FT                   /transl_table=1
FT                   /translation="MTKRISAEEKLNRKPISRACVFCHEKHLQCDVGRPCQNCEKRNIG
FT                   ESCRDNVRKVRKTRGRTPRSGVMNLRRARREHEDELAIATKSRGAGEPGSTGLPQVPSL
FT                   STLFDANVDPVIDEELLPATYVDPLGPSDVELPTSGAESFGSVWASSEYTKLNEILGSP
FT                   GIERPRKHVPSKYEPFAVPATAEHSPSPSTPIELLQDHAGLLFRNTLRRHISLDTAQSS
FT                   YQASTQDTQASTVASSVSCEGAQFPASEAEYTSPYSFRQLVRSPEDLYRHQNSIFPHNY
FT                   RQAYLELLNILRARFLSAQDEIAREEGPKQLHSIAQSIKTYYAPIFVTLTSNLIESDLK
FT                   MHELILQRTLLEYENMSKMVNCIPMCIWRRSGEICYVSNEFISLTGFSRRELLMRRRFI
FT                   MEFFDNHGIVDYFKLFNEYLAFSSKEGFSSTSDGQAVFSECNLLMANNSFLKCACIWTV
FT                   KRDSFNIPMLVMGQFLPIFDMDHT"
FT   CDS_pept        complement(577594..579726)
FT                   /codon_start=1
FT                   /gene_family="HOG000268799" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763650"
FT                   /gene_name="DBP7"
FT                   /locus_tag="AFR082C"
FT                   /product="ATP-dependent RNA helicase DBP7 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS53453.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000025305B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754J2"
FT                   /transl_table=1
FT                   /translation="MSDNDGLMLMNFTTESGPDNASSHRRVKVTGGKWKERRKLKMKLE
FT                   GRPLRPKRPAAAVEEAPAAAVPEGSAIEPAAKRPRGRNERAPKDVPPQPANAQVVSSLF
FT                   TSTRAITTSVNDHERASNDVAPSNAPLLQDTFEALGVRGTLLEHLTGKMKIQKPTKIQK
FT                   MAIPEVLNGKADLFLHAQTGSGKTLAFLLPVLQTLLSLEQRIDRHSGCFAMIVTPTREL
FT                   AAQIYGVISTLAQCCHYLVPCLLVGGERKKSEKARLRKGANFIVGTPGRMLDHLQNTKV
FT                   AREQLPHSLRYLILDEGDKLMELGFEETLKSILEIVHSVACDNTRFPRLPQRIVHVLCS
FT                   ATRQGTVSKLGDIALTDPKVIAASDSTTDVSTVPDQLLQKIAIVPPKLRLVTLCAAISE
FT                   LSRKAPTETTTRTIVFISCADSVDFHYDVFSGLGGSHRDLVPGTVRELAAGSRALPCFS
FT                   ADSPPNTVFYKLHGSLPQAVRVATLRHFSSDAAATRGKHLVLFCTDVASRGLDLPRVST
FT                   VIEMDPPFAVEDHLHRIGRTARAGVAGESLLFLLPGEEEGYMEHIRAHHPRGWELLRYD
FT                   RDLLAPAFAAPVARSDRPTTATDAAWDSNATTWHLNVERRVLEDPSAKDLAIKGYTSHI
FT                   RAYATHISQEKRFFNVRCLHLGHLAKAFGLRERPKGMAAHRGKPATPKPKQDDARTKML
FT                   RMARQAVAQSNSEFNY"
FT   CDS_pept        579951..580724
FT                   /codon_start=1
FT                   /gene_family="HOG000074717" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763651"
FT                   /locus_tag="AFR083W"
FT                   /orf_name="AGOS_AFR083W"
FT                   /product="AFR083Wp"
FT                   /protein_id="AAS53454.1"
FT                   /db_xref="HOGENOM:HBG059383"
FT                   /db_xref="HOGENOM:HBG202368"
FT                   /db_xref="InterPro:IPR006886"
FT                   /db_xref="UniParc:UPI000025305C"
FT                   /db_xref="UniProtKB/TrEMBL:Q754J1"
FT                   /transl_table=1
FT                   /translation="MEKNLFVIEDEGDALLDDAPLTQVKEELVEVPSAKQDEEDPIVQE
FT                   IPINLTRGPCPIYILQYLNKSQKLGKRIEDHPSVAEVRYREKSNVLELDMPLNTDVFFN
FT                   QDRAKEQWDGVQVQTLRGVGVENAGQYVGLMHDGQMYLMPVERVAQLKPYFKYIDQEQQ
FT                   KQRKQDDAITQGGGAGSNPRAQVVTMSAKSSSEANQNRLGGSLLAHKIAEEEPIRTLAW
FT                   KEDTFENFLAEVTSDEARETLVSEEDAATYLAKLL"
FT   CDS_pept        complement(580770..581684)
FT                   /codon_start=1
FT                   /gene_family="HOG000175731" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931392"
FT                   /locus_tag="AGOS_AFR084C"
FT                   /product="AFR084Cp"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="AAS53455.2"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="HOGENOM:HBG455568"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="UniParc:UPI0001DB2B05"
FT                   /db_xref="UniProtKB/TrEMBL:Q754J0"
FT                   /transl_table=1
FT                   /translation="MTAEFNITKTYLKFLDDDNEMTMPIAAIEALVTMLKVKNPSTSAE
FT                   MINAVKSSTLELTTSIPNSISLQAGCDIFMRFVLRNTHLYGDWESCKQHLVENGQLFVS
FT                   RAKRSRDKIAKIGVDFITDDDIILVHGFSRAVFSLLSYTAEKLIRFRCVVTEARPSGQG
FT                   KQLYDLLHAKGIPVTMIVDSAVGSIIHKIDKVLVGAEGVAESGGIINLVGTYTVGVLAK
FT                   NARKPFYVVSESHKFVRMFPLSPDDLPMERDPLDFSRSDESEQLLSPSIDYTSHEHITA
FT                   LITDLGVLTPSAVSEELIKMWYD"
FT   CDS_pept        581737..584244
FT                   /codon_start=1
FT                   /gene_family="HOG000231585" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082760"
FT                   /gene_name="MEF2"
FT                   /locus_tag="AFR085W"
FT                   /product="Ribosome-releasing factor 2, mitochondrial "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS53456.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG156268"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="HSSP:1FNM"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="UniParc:UPI000025305E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754I9"
FT                   /transl_table=1
FT                   /translation="MPWCNTRLRTCGASPKIFLRRVRCPVLLHNWTIGRVSSVSKMILR
FT                   FLRSYSKRVDITRVRNIGIIAHIDAGKTTTTERMLYYSGKIKRIGDVDHGDTITDFLPQ
FT                   ERSRGITIQSAAISFNWRDNYTVNLIDTPGHADFTFEVIRSLRVLDGCVTILDAVAGVE
FT                   AQTEKVWKQAAEIPKVCFINKMDRVGAGYSRAVKELIVKLKTRVLLLNTPLFAARDSSA
FT                   DPVFVGVLDAVNGQLLEWDPEDPDKISAKAVDKECAHYEELVSAREALVETLSEVDEKL
FT                   VEYFLGEADGDYMKVPVEVLNESIRRATLSQYAVPVLCGASFKNIGVQPLLDAVVDYLP
FT                   SPAEARLPELSNKDLPVQHHLKNGLLVNKNANLCLALAFKVTTDPIRGAMVFIRVYSGV
FT                   LNSGHTVYNSSTGVKFKLGKLIKMHANVAEDIKSLHPGDIGVLAGANVADHVRTGDTIV
FT                   AHCTSKDGIRSFKKAELALRIHPIDIPPPVFSAAVEPRTLGNKKAMDESLTQLTREDPS
FT                   LVIVRDEETGQTVMNGMGELHLEIAADRLLNEFKAPVRVGKVAVSYKETINTATETKHS
FT                   ETDDGYSFELEVRQYNEEDKVLFSNGWYPLGSDNNYLVIDPNPRFNEDNWPFPLKYEAF
FT                   VNSIISCCIVALQRGGKTAGFPLHSCVIHVKRWRLPLDCAAAASILLTVRPLIISALTS
FT                   LPTSAFSILEPIMNVEVTVQQQDLGSVVQDLTGARKANILSIDDEHHWADAAVTDKDVH
FT                   LFHDIAEKQYLPPDSTVFQAKLNKEGQTGKIVKAHVPLKEMVSYMNKLRMLTKGRGSFH
FT                   MSYLGMERASSDRVDGILEDADL"
FT   CDS_pept        complement(584485..586470)
FT                   /codon_start=1
FT                   /gene_family="HOG000199354" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763652"
FT                   /locus_tag="AFR086C"
FT                   /orf_name="AGOS_AFR086C"
FT                   /product="AFR086Cp"
FT                   /function="glutamate-cysteine ligase activity"
FT                   /biological_process="glutathione biosynthetic process "
FT                   /protein_id="AAS53457.1"
FT                   /db_xref="GO:0004357"
FT                   /db_xref="GO:0006750"
FT                   /db_xref="HOGENOM:HBG028435"
FT                   /db_xref="HOGENOM:HBG331200"
FT                   /db_xref="InterPro:IPR004308"
FT                   /db_xref="UniParc:UPI000025305F"
FT                   /db_xref="UniProtKB/TrEMBL:Q754I8"
FT                   /transl_table=1
FT                   /translation="MGLLTVGTPLPWEDSRPHIEHVKRNGVEQLLHVLRAAYERNGDPL
FT                   MWGDEIEYMLYRFRKAQNDVVLSVEHDGVIEELEEKYGATCAECNVSFHPEYGRYMVEA
FT                   TPRRPYRGLAVAEVERNMAARRHLLGMALAQTEVVPLSTTVFARMGCEDFVDLPEPWAH
FT                   KNSVSRSLYLPDEIINRHTRFPTLTANIRLRRGEKVCINVPMFKDEHTPAHDDTVYERA
FT                   WFSQEDRESLPASRPGHIYMDSMGFGMGCSCLQLTFSAPNVTMARYIYDSMVPLSPIML
FT                   ALSAASPFFKGWLAEHDVRWNVIAGAVDDRTPYERNAVPLLPDGSLYGGIESGKTSETQ
FT                   RLIKSRYSVVDLYLGGNKFFSPELNNVPVAINNTVYNRLLENEIFPVDENLARHFAHLF
FT                   VRDPLVIFNESLDQYNDSDMGHFENIQSTNWQTVRFKPPTQDATPGNMSVPGWRVEFRP
FT                   MEVQLNDFENAAFANFVYLLVECMVEFKDDINAYVPMNLVWENMDIAHQRDSVNRRLFY
FT                   WKNGFSSDIEYDTELYTMDEIFHNKENGLFPQFIDRILRRKGYVKKHWNELINSSGDLP
FT                   DRRRLYYYLKLVSDRAKGELPTSASYLRHFVVTHPEYARDSRISKRIAHDLMQSSLRIT
FT                   NLDNSADDIIRYFGLEIGSYLLENGL"
FT   CDS_pept        587028..588668
FT                   /codon_start=1
FT                   /gene_family="HOG000165420" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931393"
FT                   /locus_tag="AGOS_AFR087W"
FT                   /product="AFR087Wp"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="AAS53458.2"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG122621"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="UniParc:UPI0001DB2B06"
FT                   /db_xref="UniProtKB/TrEMBL:Q754I7"
FT                   /transl_table=1
FT                   /translation="METAQADHLGVRNGLVTECSYDWLRFQDEEQERLVSAQARSRQPS
FT                   FLSMDTWSRKSLIGRLWNDGMGLLHGARERATPRYEIEYSVFQPASAGAAAEGADEACG
FT                   LEHFRCVVSECVEAIKDAGIDLQRIASGSSGSYFAYGTDGSVLGVFKPKDEEPYGPLSP
FT                   KWTKWLHRTFFPCFFGRSCLIPNLGYLCEAAASLLDRRLRTNLVPWTDTVVLESMNFYD
FT                   SRDKWFCGWNRRAQRKIGSFQLFLDGYVGADVFLQRYPLPGTYTYSLSAARSGADGGGF
FT                   SWTDSTLHQLRVQLEKLIILDYIMRNTDRGLDNWMIKVCEVDGAWQLRLAAIDNGLSFP
FT                   WKHPDEWRSYPYGWLYLPLDIINQPFTRETREHFLPILRSVGWWETSYLEFHGLFSRDT
FT                   EFKERMWKKQWAVLKGQAFNVLETLKHPGQGPLELVRRTRCLVFDDILHVPAQNPPLNI
FT                   IRSAINDELPVASSPMILSSVPEGSILVDFAQFPDRKAQDDHERQSIQEDPSQVLLPDM
FT                   PSSRYIATKQVIVERLQLCNSKPPTFTWC"
FT   CDS_pept        588861..591029
FT                   /codon_start=1
FT                   /gene_family="HOG000095187" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763653"
FT                   /locus_tag="AFR088W"
FT                   /orf_name="AGOS_AFR088W"
FT                   /product="AFR088Wp"
FT                   /function="binding"
FT                   /protein_id="AAS53459.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059384"
FT                   /db_xref="HOGENOM:HBG202369"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniParc:UPI0000253061"
FT                   /db_xref="UniProtKB/TrEMBL:Q754I6"
FT                   /transl_table=1
FT                   /translation="MSIWQWRSTSAHSASMGSQVSLHDSSVDRSHSGTPEAGRRYNTLE
FT                   HPRIIERHFGEAVRARWKLLRKLSGSGQLDVGPPDLVHVTGYDRYHQVQIGEHHYITGL
FT                   DVSSEAMPIAYMNTLRLGRKHTEDEDDLVCTFCTVNLFSKVDVRIRFESERAFQVYAVD
FT                   CGSDEQVQMSDGLWEETFVSGCIRSMVINSDRRRKVPGLIEYPIGAENGRSYSENVVFL
FT                   LCKYLPRAKDTGVDLTVHTSVTSLQNYLADALLKFLSINPGLFTYAIECLQQLIEGDPA
FT                   NDFIYRLMQAKVAICSNSNELKAVQFLNSTVTRFLPNIAALHNRDLQNAIDLLNVQVGF
FT                   LLQKEDYEFALPLAQKATSLVHDNFLSWEQLATCYIGLGQYDEALLAINCMPRLAQGTP
FT                   GYAASMIDLIDSNYYKRPMSLGPTSDLYSVETNYISHSVPHSNHLALQTMIYGRTVMSR
FT                   PSTAAGCIEEIWNGPCMKLGPIYGPDSFNLLAFVSPSENNAIKDRGVLQRNSSSTRLSG
FT                   GDERVYSLLMDIVARIGWNRFLDIRARIFVMRSEHSTSPTVVPELKQKRLCEKWLDELF
FT                   LNLYEDLRVSANSPLHTQDLQNSGLEWQLLGLTLLRTRYMDEAVACLRTSILVRFDVIS
FT                   AHKLLHLFLDGSLTTLDTDVILRLVVANAAYAARFYDWCQTLTILVLRRFCEVHPKDVI
FT                   RSRIHGLYPPDTGILPLIDRFLDRLDFI"
FT   CDS_pept        591557..594652
FT                   /codon_start=1
FT                   /gene_family="HOG000248046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763654"
FT                   /locus_tag="AGOS_AFR089W"
FT                   /product="AFR089Wp"
FT                   /protein_id="AAS53460.2"
FT                   /db_xref="HOGENOM:HBG190574"
FT                   /db_xref="InterPro:IPR007587"
FT                   /db_xref="UniParc:UPI0001DB2B07"
FT                   /db_xref="UniProtKB/TrEMBL:Q754I5"
FT                   /transl_table=1
FT                   /translation="MSGSFWKFSQEYSTESSLTKLLNRAFIRVEERSRAETEQENEAKR
FT                   SKEEKRFDVIESEHEEEEEGEEGEQRGSRAQRPLEGGELPETESEYKNYRPNLEVLNEL
FT                   LDDEELYTELMCSNFKLMIFFKYPAVLDVLVDYVTNERILEETLDLSEEEDNDDEHVDL
FT                   EPLLESTEDKEAEQLHGGEVAELGHDESDSSNTGTQPQETDEQVQSRRARMAAEILSAD
FT                   VWPISSAFIEHDELLYKLWSILDHPAPLSIVASTYFMKINERLLDMDIASMIRFILNQD
FT                   NLVDRYLTHIDNPPLMDFLLKVISTDKPDTPTHVIGLLKYQKLISKLLDHLSPEWSSSV
FT                   QSAAGDFLKALITISANSNNEIASAIGPNELTRELVSPAMASKLGDIMLNGGTSLSNGV
FT                   GIVIELIRKNNSDYDFFQVMYTTLKTHPPNDRDPVYLGHLVKSFANKLPEFNAMLLDTK
FT                   LPPLETPFGTIEPLGFERFKICELIAELLHCSNMGLLNEPKGEEIVNERDIDRECVLRL
FT                   EGYGIPKNCHDEERSVSVSPIEEEDLAKKIRDLQLVTDKRPSSDNSVESLNSDSQQATT
FT                   PIHQLGTEIHSEDSSDAELSEQALREKPVVGDQLKIALQDNKIITTILGMFFKYPWNNF
FT                   LHNVVFDIVQQIFNGPLKTGYNRFLLADLFASAHITEAIIEGDRKCHEYERETGLRLGY
FT                   MGHLTLVAEEVAKFASYIDEMKISFSNPVISESLNDQRWREYTELVLAETRGKYSTVLG
FT                   DLAEEEGRNVGKGANEEDNARYYNSDEIYHGSYAEHDDENYAEYSDVDGNRYYEYEDGS
FT                   GHTTRIHLNQLDNDNIDDIEEASNADTDNKFRNYMSHQLANDYNTTSFSPDNEDEGQWA
FT                   SVSGSNRPGEASSNYQSEIQIESSAMSKQSIFHHQQFDLQDHEDGDDYMDPNDDGQSYA
FT                   KPNHPLYSNMLPSQPENVYRKTSEVAEEGDSDESDEEMIVVEGTPGFDESTELDQSGTE
FT                   YALCRTSSKDEKMWTSPEQHSTRIIGMNNNMFNRSKDLHKDE"
FT   CDS_pept        594940..595593
FT                   /codon_start=1
FT                   /gene_family="HOG000190538" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763655"
FT                   /locus_tag="AFR090W"
FT                   /orf_name="AGOS_AFR090W"
FT                   /product="AFR090Wp"
FT                   /protein_id="AAS53461.1"
FT                   /db_xref="HOGENOM:HBG353172"
FT                   /db_xref="HOGENOM:HBG736553"
FT                   /db_xref="InterPro:IPR007482"
FT                   /db_xref="UniParc:UPI0000253063"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Y4"
FT                   /transl_table=1
FT                   /translation="MATKTSFGTLALYNLFSALSWAYVLANVALVYPRIGQPRFYAATR
FT                   GLVTVVQCGMLIEVFNAATGIVKTPVSTTVAQVLSRVLVVVCIFRYIPEAPNASDWPYI
FT                   TLLLAWSITEIVRYSYYFCNLVRSAGTPKWLTILRYNLFWVLYPLGVMSELLIIYSALP
FT                   HAEARYGAWARLALVAAMLVYIPGFPMLYLHVIAQRRKVMKALRSTAAGAKKTT"
FT   CDS_pept        595762..596241
FT                   /codon_start=1
FT                   /gene_family="HOG000066083" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763656"
FT                   /locus_tag="AFR091W"
FT                   /orf_name="AGOS_AFR091W"
FT                   /product="AFR091Wp"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS53462.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059385"
FT                   /db_xref="HOGENOM:HBG397742"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR015934"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="UniParc:UPI0000253064"
FT                   /db_xref="UniProtKB/TrEMBL:Q754Y7"
FT                   /transl_table=1
FT                   /translation="MLPVLRQTLLRAAAPRWPLAGPAAACRLFSLGPVLHQQAAPADLG
FT                   PLRLANDLYAVFRIHNRPYLVTKGDQVILPFKLKQADVGDVLHLNDVTTIGSRNYKLVD
FT                   HPIDPSLYSLQATVIEKTKRPLRVREVTKRRNRRVRHALNKADLTILRISELRLN"
FT   CDS_pept        596512..600783
FT                   /codon_start=1
FT                   /gene_family="HOG000095188" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763657"
FT                   /locus_tag="AFR092W"
FT                   /orf_name="AGOS_AFR092W"
FT                   /product="AFR092Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53463.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG059386"
FT                   /db_xref="HOGENOM:HBG202176"
FT                   /db_xref="HSSP:1B38"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR015748"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000253065"
FT                   /db_xref="UniProtKB/TrEMBL:Q754I4"
FT                   /transl_table=1
FT                   /translation="MAFLKRLNVSSHSRSSSGSSGRTPQNTSGGSKATAVKPLPQIPVE
FT                   MGGIESEVIKNGEGGQSVVILCDDVGSGSYTSVLLSPSDPHMFSADGQRLSVEEQAEKT
FT                   LYSWDVTDPEQWTMQRVMSWFKAHDFDEQWILFFKRNHISGKKFLQLLAHDNFNKYESF
FT                   LSATKNSSYNRFQHLLKRTLEENVSNSHRRQRSNKSNDSKGSADCSLRYRRRRSVASEQ
FT                   RTLTAAEGVTPRKTVEVADDRAGSSKNHRKAKSASVLYRRSFISLRSSSSSNIKNDVDD
FT                   DCKTLPAMKISIPPRPFSSIERSTSSSPASTLKSQSSPLSPGNHNMFRKDHKSSSSDSS
FT                   LFNNLFGSADEITKAVGGTAPQGEQIAVKKYNDTLPSPMRVSPRHIDDKSTIWDKLKKR
FT                   ALPSTEQYTPSRIKQLTSGRNSSYIQTLQESPDECSANNEDPPATATLEAPIIDDLVLE
FT                   EKHYPSQKQDSSAQYVLVTKDNRIFLPLNIAPYKTTQELKDGMTAFLGISSKAYTIHLT
FT                   DLGCDPGVSLSDDVIAAIGQRKLNTRHLKFYVKDATRMHLRLKNDSFTSDHNITTEMSR
FT                   SKGSLRSAASSFISSNDDTNSFSDITSIDEHGNITGRRVYPQTPSHYYDQSAATHSPEV
FT                   DYWNIKERLSEGTSPMNISLLRSTTKAASLPSSIDEIKKSSFKVIRKASVTDIDFNKGR
FT                   ESPYIRPKLAPKREAPRPPRTSSQVSLASSSSIQSSLVEQKSISNSPTKPQRQHAGTYV
FT                   KNKTRPPPPPSIGSTMTVDTKVMTSVSDSPVSNEPPNRPYGPFSTQKLVPQGFKGVGVH
FT                   PGTRKVEEQMHTNPVTQYIQKQRSRNSISKMGNNPSLYSPPRLKKRISTRRMVSSTSAA
FT                   DIFDENEISFADAPDLSDYDSENSESSDDIIWSTTNTTSLDASKISVSDSTTGDDSNFS
FT                   VASSVELQSSIKNDAKTSEDSIVDSIKEEGDSVCNLVGRKMTLRPTTEVVYQNLEMFFP
FT                   GTDLDKPILEGLTPPASPDSEANKMPDQDLTPLSKVSTISSESSMRQSTPRLLITKKSD
FT                   SPQPMPVRNLKPPKRTKTIRSIAREASEARKKSLYNNLKRQNTKMWGTRVVEVTDKRMV
FT                   SINKSKNSKGEYREFAWIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDET
FT                   TVNNAEALISEVSTLKDLDHLNIVQYLGFENKNCIYSLFLEYVAGGSVGSLIRLYGHFD
FT                   EQLIRFLTTQVLEGLAYLHLRGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNS
FT                   EMTMRGTVFWMAPEMVDTTQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGK
FT                   SKSAPPIPEDTLPHISQDGRAFLDDCFMIDPEERPTADTLLSHPFCQVPKEFNFRDTDL
FT                   YNFIKQNDKLNNSKLTRNSQR"
FT   CDS_pept        601121..604516
FT                   /codon_start=1
FT                   /gene_family="HOG000141756" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082761"
FT                   /locus_tag="AGOS_AFR093W"
FT                   /product="AFR093Wp"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="AAS53464.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG190151"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="UniParc:UPI0001DB2B22"
FT                   /db_xref="UniProtKB/TrEMBL:Q754I3"
FT                   /transl_table=1
FT                   /translation="MEFELFNGLNQRQYEAVTFDPTKALQIVAGPGTGKTKVLTTRYAY
FT                   LVAIKKINPLSIIMTTFTKKAADEIKARVEPILQRCGFDTSKLLIGTFHSICANLLHQH
FT                   GELIGLPSSWRVFSPAETDPIIKKLVADCPDQIRDYALSYRANKVNLCLPNRNGEWALA
FT                   DKAIRKNISRLKAEALSPEAYKELDTHDEALYHFYRSYQEELLRQGGLDYDDLLFYSFK
FT                   LLSTNRCWSHIKHVMVDEFQDTNSIQLELMYLLSRGRHQSCEGVTVVGDPDQSIYAFRS
FT                   ALARNFEEMIQKCPIEYGHVVLEENYRSTQNILDTSEHVIKQQSDGRTFRLPLKAQFSY
FT                   DLKPVYMKFPDRFLEGPTICKEILYLKAIPGLFSYDDFAILVRQRRQIEPLERALIDHR
FT                   IPYKIVKSVSFWERKETKAILDLIKIVCSDVDRYAIIRSLKYPSKGLGDVAISQFEKAF
FT                   DEEPNRPPLEILRLFSNTAKGDKLSSKGRLAVRQFIALMDKAREICDENPTLSTREQLF
FT                   DYLYDASGLKNEFLFEDDKGDRKTKGLGDSDPNNENKRHRNIQLVRSHFLAFIPEDMDP
FT                   KYTIHLNPKTHEPCAVDTPVIKKDHKTQWATNARASSCENTNSNSEKDKEDNKSLPEDT
FT                   KIDIYNLLRRFINFINLYTTTEAIDPKGLTKAQQQANELRAKNGVVTITTIHGSKGLEW
FT                   PIVFIPGCVEGIIPCVYANSKDEESDDDDENGEGHETEEIPNNDANSPKKNKSKANEGL
FT                   DEERRMFFVALTRAKYLLYISATENTERYPIVPSQFLTPEVLVTLTSAQQLFDNVGFID
FT                   AFYKALNRTRPNTLTFKLEKLLDDYRTFVTGNREFLIWKNERVMHVSNVDFTENVGKAA
FT                   LPLGFTTASMHLHSLDYKNNVVNSAKSANRNLAPRPQPTNNATGRKFAPSKVPSAKGNA
FT                   PAVKQFAPKSGERVSLSPTRTASKAPKPHENISLSPTRRPLNAPKSEFDQPMSIPQSPK
FT                   RETAIKQEESEAPEARSIKERTRSLAVVPTNNQHRIIAHAIKLEDFSDDEETTKVKIKC
FT                   DDEITAAQLLHNPDDLRVDNRPILTNAKVLADASRDEAAKRAGSRRKVKKGTDECQPGE
FT                   DILSRLKRARKSSPSINDEVIVLD"
FT   CDS_pept        complement(604539..605981)
FT                   /codon_start=1
FT                   /gene_family="HOG000204712" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763658"
FT                   /gene_name="GWT1"
FT                   /locus_tag="AFR094C"
FT                   /product="GPI-anchored wall transfer protein 1 "
FT                   /EC_number="2.3.-.-"
FT                   /function="acyltransferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53465.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG204869"
FT                   /db_xref="HOGENOM:HBG617473"
FT                   /db_xref="InterPro:IPR009447"
FT                   /db_xref="UniParc:UPI0000253067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754I2"
FT                   /transl_table=1
FT                   /translation="MNALKERKEAFVSGLEGGSIAEINLVTTVALTAYFGWQLLNRRLD
FT                   SVPLVVDFLLNWAGLLLSITVYANDPVLLNLLIAVPCIVQLQILGRSSQRKTQPQKGKE
FT                   SARLGLDRKPFITAYRGGMLIITCLAILAVDFPVFPRRFAKVETWGTSLMDLGVGSFVF
FT                   SNGLVAASALLKQEISGQRPPLWSRLVSSVRSAGILLALGVARLVSVKGLEYQEHVTEY
FT                   GTSWNFFFTLALVPLAMILVDPICTYVPRVFIALLLSVFSEYLLQKEGFLQFMIMSKRD
FT                   NFFNSNREGILSFLGYCAIFLLGQNTGFYVLGNRPTVNNLYRPSGQSWQQNRRQRLSAW
FT                   DKWTSVTPLAGLLAWFFITVALFQLTMAYHPYTVSRRFANLPYVLWVAAYNLGFLSMYC
FT                   MVDSLFNLSQHSNNVPVTLDAVNSNGLFVFLLANCLTGLINMNMNTLDSTLTVQIAALF
FT                   GYATVIASVAIIMYKCRIFIKL"
FT   CDS_pept        complement(606107..608119)
FT                   /codon_start=1
FT                   /gene_family="HOG000112252" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763659"
FT                   /locus_tag="AGOS_AFR095C"
FT                   /product="AFR095Cp"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS53466.2"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG059387"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniParc:UPI0001DB2B23"
FT                   /db_xref="UniProtKB/TrEMBL:Q754I1"
FT                   /transl_table=1
FT                   /translation="MSKPFQGITFCPTGVADSELAELHRRVVQLGGAFSRDLTAEVHVL
FT                   VVGNQQSAKYRYVVRQRADVVLVEPQGVEEVYARWLAGEEALGPEGEGGREQALRALRR
FT                   RFQPGPFGGFYVFIGRVAGGRVSAAELQQLCESGGARRVVTSHFVRDTASSARSVFVTD
FT                   CAEGARAAAAREQGVAVVHPKWVTDCVRRGAVVEMEEYELARWAGAAWEEVGRDACACW
FT                   AALEAAAARSAEREARPARLSGRMRRSGTELWARRVEGGGSARPAAADAPAAAREAGAT
FT                   ARGLFGGYGFSLFGFSARQRAVLERVLGLHDGASCEYPGVCEGARAVYLCPSELAVDRL
FT                   PAGVEWTTEFYVERCLHYRELLPADPWARPFYTAFRAQPAAALLRGHAQLTVHMTGFQG
FT                   VELLHMNKLLGHLERMGVQNTPTLTPKTDVLLVNLAQLNSIPEEHTLRQNKYAAMFAMR
FT                   REHNQVFRDVMKRKIEFANRHSIPLVTPGFLLELFGRAARAKRDRTSGKLYLNDSNWCI
FT                   VSPRGAREDYLITLDVSEPALPSPSRAHVDVAAIKLLKGDGKTPAKESGRKAMRQATAR
FT                   PRLAPPSPTPAETHPAKRQKLADLEPLKRSASWGSIMAADSAEPERSASSPERASATDD
FT                   EENYTQVTYGTSDTKSEHEKPAGRRKTRQSYKDLL"
FT   CDS_pept        608413..610971
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778414"
FT                   /locus_tag="AGOS_AFR096W"
FT                   /product="AFR096Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53467.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059388"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001DB2B24"
FT                   /db_xref="UniProtKB/TrEMBL:Q754H2"
FT                   /transl_table=1
FT                   /translation="MGKRKYGSLSAHDGQTIELSNMKRSSQACDRCRLKKIKCDGLRPS
FT                   CTSCKKIGYQCKTSDKLTRRGFPRGYTEMLEREVIKLQRLHGGEGMAPAPAQTSPLPFI
FT                   NDSFHYYVNYTDGETYLGNATWQAVLNGGLEAAVVPSDDASLAQYLDRTFQIDGTGLPA
FT                   VLARLHGNDIAAARAAARARVSAFVKEHVLVPLLHGNNWKARLKGALAAGRGREEDPTA
FT                   ILAAMYVLQWNYSLFSPEALFNVTKVVVVLSRDGLSALQMLLLATYYFMSLPKQLTTRQ
FT                   TPATAWTIQLVHLAFSQVTAQGLFINYKKLLPVGAADEKGAAARDSAELYETRLLTFWS
FT                   FQLLSALWSLLQGLPKTNFLADEFHPPSVSSLNIPSLRPFEILLEHILQLDGCNVLQVM
FT                   QAQNPRYTYVVESFRHTLNHWKLYHNLQDHDLNEITVNNNDRIEIQLTLSYLLPRWLTE
FT                   QDSPDSHHLSWEILSLYYLLIANEQGSAATASQPPVLKLIHFLPWDNWNLISACFQNLT
FT                   KAPQDIDRYTYEKYRDLVTNWTHLWYEDDFAYKNAMERFDVKDSERFGKPVNLPQLIRS
FT                   MRSGPAQNTSNRPLLRPLRSSSNLSTEDPFNMFSSVPPVENLPSQWFLMSPGIDVVSNY
FT                   TSSANTNAVSVGQTNNSYAAVPPYNYGTVAAVGLNSLITTETFPSLAEDEDGYVEDDEN
FT                   EDDDEGGPITFGMHRRSNPHTLQQAENQALFSHSIPTRKVVARDQVLIGGKAHLGRKNI
FT                   STDRVSACSPAKDSKLSHARYGLVPDSLGSEATSQGNQLDNPRIQKKTPPNTAPHVNSP
FT                   STATPRSLVDLLILPMTTEKTSGDGITTPKEEDTVVRSKA"
FT   CDS_pept        611340..612173
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931394"
FT                   /locus_tag="AFR097W"
FT                   /orf_name="AGOS_AFR097W"
FT                   /product="AFR097Wp"
FT                   /protein_id="AAS53468.1"
FT                   /db_xref="HOGENOM:HBG059389"
FT                   /db_xref="UniParc:UPI000025306A"
FT                   /db_xref="UniProtKB/TrEMBL:Q754H1"
FT                   /transl_table=1
FT                   /translation="MLDAEEDDGDEETAVLDTRLRTRKIKPLRLNPLPAAQESDSDAGE
FT                   SAGYADLLQAPGRSPKAVPQALRTMNLEDLSDDDDDDAYPVFSKQEILDIKKLRAERQQ
FT                   EAAAGSAVDQQFSEKSYVRMLDREDKEDLQELLGRPLHKGLSEDEGPQEAEPEMISDGR
FT                   LALSKSELSAEALRRKISIEDALNADLGGGVWESTQLNKHSRTAETRFYKPILSSAVSK
FT                   YDDLSSAQLAVNLLGDGKTSQKMSLLHKQLAMVHSEISALTERQNKLLEEARSLL"
FT   CDS_pept        612461..613510
FT                   /codon_start=1
FT                   /gene_family="HOG000022686" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082762"
FT                   /locus_tag="AFR098W"
FT                   /orf_name="AGOS_AFR098W"
FT                   /product="AFR098Wp"
FT                   /function="amino acid binding"
FT                   /function="ornithine carbamoyltransferase activity "
FT                   /cellular_component="ornithine carbamoyltransferase complex"
FT                   /protein_id="AAS53469.1"
FT                   /db_xref="GO:0004585"
FT                   /db_xref="GO:0009348"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="HOGENOM:HBG258034"
FT                   /db_xref="HOGENOM:HBG579429"
FT                   /db_xref="HSSP:1A1S"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="UniParc:UPI000025306B"
FT                   /db_xref="UniProtKB/TrEMBL:Q754H4"
FT                   /transl_table=1
FT                   /translation="MWFSLEQGSRILKHHTSFQYRRMTATPGSPKHLVSIKDLADHEFA
FT                   ELVSRAEYFKGLFKAQDKAECQKSHQELMGKTIALIFSKRSTRTRISTEGAAAFFGAQP
FT                   MFLGKDDIQLGVNESLYDTIKVISSMVACIFARVGKHSEIQEFVKHSKVPVINSLCDKF
FT                   HPLQAICDMLTIKEHFNYQEKKLKLAWIGDANNVINDMAIAALKLGIDVVVATPQGIEL
FT                   DADIVDAAKEVCKRTGTTIQLTHDSVAAAKDAHVLVTDTFVSMGEEYMYEAKMRQFKGF
FT                   QINAELCKHAAPDYKFMHCLPRHQEEVTDDIFYGDHSIVFQEAENRLYAAMAAIDIFVN
FT                   KNGDFSGLN"
FT   CDS_pept        complement(613546..616008)
FT                   /codon_start=1
FT                   /gene_family="HOG000208273" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931395"
FT                   /locus_tag="AGOS_AFR099C"
FT                   /product="AFR099Cp"
FT                   /function="ATP binding"
FT                   /function="RNA ligase (ATP) activity"
FT                   /biological_process="tRNA splicing, via endonucleolytic
FT                   cleavage and ligation"
FT                   /protein_id="AAS53470.2"
FT                   /db_xref="GO:0003972"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006388"
FT                   /db_xref="HOGENOM:HBG051833"
FT                   /db_xref="InterPro:IPR012387"
FT                   /db_xref="InterPro:IPR015965"
FT                   /db_xref="InterPro:IPR015966"
FT                   /db_xref="InterPro:IPR019039"
FT                   /db_xref="UniParc:UPI0001DB2B25"
FT                   /db_xref="UniProtKB/TrEMBL:Q754H3"
FT                   /transl_table=1
FT                   /translation="MEGPLAENMTVNDVKQLVTELETASQLTKRGKASKVLCTLKYSGI
FT                   KVNSWRFNEWDYGKNNISMPCNARGLFIIDDPEKPEIVARGYDKFFNVEEIAATAWKEL
FT                   ERTTEGPYEVSLKENGCIIFIAGRPDGELVVCSKHSTGPRDDTDRNHAEAGEQFLRKLL
FT                   EEAGASVETLARELYAMNCTAVAEYCDDAFEEHIIPYARDRAGLYLHGLNKNTREFQTL
FT                   PMPEVKSFAEKYHLKIVDYFVKPDIETLRSFLQQCSIKGSYNDQEVEGFVIRCRKRDGH
FT                   AFLFKYKFEEPYLLYRQWREATKDYINSRMRTYNFKKHRFITNKYLDFVIPLLDQDPDL
FT                   CKEYIQGKGIIKLRKMFLEDFGMSGLDIMNSKTIKELEEQYASELDKVDENTKFIFIPV
FT                   ATVGCGKTTVALALKNIFGESWGHIQNDNIVTKDKSKLMRDALEFLQKDTSRAVIVDRN
FT                   NHMPFERKQLFEWLEKMKENYIPYNSAVKVVCLSFLTYKDVESVREITKSRVAERGDNH
FT                   QSIKALSEPEKAIMILDGFLKRFRAVNDQRSPDNMFDKIIQLKVLEENSSLTNIRTILE
FT                   ELHASYPTLVPELPSDSVIEESFKNTLSYKPTFTKIIKSSPRNTKYKPTYWGAELSDPK
FT                   LFINQVSDLIVRKRPEYLRGVLDIVEEAMIQKSFHVTLIHCSAKRGNKEEKDMWAEYNK
FT                   RYANHLVKPEKAPCQPPKYIETTDFIKFSIDKLLWDDKIMTATVSTDKLIYDSTGEAVP
FT                   ILRLLNTYAHITVGTRKAGVQAVYSNELCRRFHEKHGEEEGSFSEGMNCIRFPEPVQVV
FT                   AAVRINIY"
FT   CDS_pept        616219..618063
FT                   /codon_start=1
FT                   /gene_family="HOG000000807" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625870"
FT                   /gene_name="EXO70"
FT                   /locus_tag="AFR100W"
FT                   /product="Exocyst complex protein EXO70 "
FT                   /biological_process="exocytosis"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cellular bud neck"
FT                   /cellular_component="exocyst"
FT                   /protein_id="AAS53471.1"
FT                   /db_xref="GO:0000145"
FT                   /db_xref="GO:0005935"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG059390"
FT                   /db_xref="HOGENOM:HBG202183"
FT                   /db_xref="InterPro:IPR004140"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniParc:UPI000025306D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754H0"
FT                   /transl_table=1
FT                   /translation="MPSIDVDEADILILSDGLKQVNELTREITGSLSKITSTTSKSSKL
FT                   FAPIIETNTRLNVLKRNIESSFDSVSSIKDLASDASKYEIILEQEITQVGLRKFIKTLH
FT                   KVDDIMDDLREKSKSTADFRGIVTHLEELTMIGEKNLQIYFANKLNQIQPFDPQVYMNK
FT                   KQNFPYYYDEDLNDIAAILDYFGDTEQNPVTEIFMKQQGQLVLNSLAFLEPFTKQITSE
FT                   SNVPYQRGSSGFNSYTEAFITFVSGVSVLIDDVFVKLPDRRPAVFCKIVAPILHNYTKI
FT                   LRYNIDLVKDDINNYGLFSFELSENINRVHQLFKGKPLQNNEQLLECEAELKSISESLF
FT                   KDLIQYIGQKTASLAQLPTDNGVTEATVDVMSRLRKFSEYKSGCLATIQSMTRESWLPN
FT                   ESKNVWTISMTPKNAQQLLSCFFSDAIDYLTISLERKAQKILNPNLEPEVGAPHKRIPQ
FT                   MQRIGFFVLTNITLIEQIVQRSEINTVLEDIGAARLVKLNARYVNYFASDWRDLASNLL
FT                   DQVFVDSSGKISSKDKDQVKEKFRKFNEGFEQLVSNYKTCRITDPAMKKLLKQEIFALV
FT                   APMYERFHNRYKDSFKNPRKHIKYTPNELMNILNSLGR"
FT   CDS_pept        complement(618283..621201)
FT                   /codon_start=1
FT                   /gene_family="HOG000141755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778415"
FT                   /locus_tag="AGOS_AFR101C"
FT                   /product="AFR101Cp"
FT                   /protein_id="AAS53472.2"
FT                   /db_xref="HOGENOM:HBG189670"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="UniParc:UPI0001DB2B26"
FT                   /db_xref="UniProtKB/TrEMBL:Q754G9"
FT                   /transl_table=1
FT                   /translation="MVALRERAASAPVFPLEKQLELPRNATPLAHVGSVQVFVQLAEPV
FT                   IFLQGYDTHQWHERAPSILRGSLVVRILKPTKLKSISLMFKGVCRTEWPEGIPPKKQEV
FT                   VEVTDLLNHTWLFYHVDSHDKVAAQSEDLLARSDASLYRPLPAATQSNKGSSVSLQTLL
FT                   SQEGGELHGLTPADEACGRRSTSTTRSLSSGKLLRRKGSPDPPRVRSGTNLFTELLSAT
FT                   LSNGSEGSVRSRSSHTGHAPAENFVFQPGDYIYSFEHPIPVSTQETILATFGTVNYLLD
FT                   VTIERIGAFKSNVHARVPIKLIRTLSPNSVEDTEPIVISRDWEKELSYEIVIASKDIVL
FT                   DAFLPISLSLNPRANLVLHRVRIFLTETLEYYCKGRKVHRVEPTKKFLLVEHKAPPLKG
FT                   IHEGASLSRAKNLGNLLDDGAGGASKRQFTYQVFVPERLNYQQCIHPNTASPHIKSNHW
FT                   LQICLRLSRKVNGSRKHYEISIDTPIHVLHRLCSHAHTLLPSYESQAVLTSGSTASSSL
FT                   LANQYHSSNMYFPKEALQAAKITPPAGSVENLSSYIDSPAPVHNNKNHQYLAAHRNSAK
FT                   ENDGNGAVKFHGVAWNIYHPAYLPFNFISPQALPISPILPLFQTRFGHMGDNLNAFVHV
FT                   GDIDRTELSNVGHRDNDHMPDHPPSYEEALEAVELINMCKHNGMGLTECSPTEEASHDV
FT                   NHFDGPDHEDMGDSSSIRSAVRRSGPPSFTSNISALSALAINQRITQERSERGVSASVF
FT                   NQPEKLKNEIPSAPRNSQDVQNCTFSDAASSTNSDHQLYRTTTSKVLLDLLSKDDTAQS
FT                   TSAGLEMPKYSDGCDTIPPSTGTEADDTSVDISTLYSHKSAQYWSPIQCELSRLSNGTH
FT                   RNPDIYDNGCLTPAEFGASDNRCHERSTDVVDEPNGLSGIEDASSSHTQLMQRDCLKSM
FT                   GTPPPDASDLYDSTPTQFSVKVDDLTVQDTEVNPQQAERKYE"
FT   CDS_pept        complement(621310..621726)
FT                   /codon_start=1
FT                   /gene_family="HOG000001092" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763660"
FT                   /locus_tag="AFR102C"
FT                   /orf_name="AGOS_AFR102C"
FT                   /product="AFR102Cp"
FT                   /protein_id="AAS53473.1"
FT                   /db_xref="HOGENOM:HBG059391"
FT                   /db_xref="InterPro:IPR014812"
FT                   /db_xref="UniParc:UPI000025306F"
FT                   /db_xref="UniProtKB/TrEMBL:Q754G8"
FT                   /transl_table=1
FT                   /translation="MAEQITHKKGLKRLDKDKRLLLKQYYQLDDATKQTAEQSTPTSSS
FT                   ETKDAGEAEGGAGDMAVEVPEKLAESTLDQLLQAHNLLLGRETAANNSIKNTIYDNYYD
FT                   LVKVNQLLREMGESTLETRVGQLADNLRRLRKDR"
FT   CDS_pept        621925..624159
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763661"
FT                   /gene_name="IRS4"
FT                   /locus_tag="AFR103W"
FT                   /product="Increased rDNA silencing protein 4 "
FT                   /function="calcium ion binding"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="AAS53474.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG059392"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniParc:UPI0000253070"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754G7"
FT                   /transl_table=1
FT                   /translation="MRFRSERQSKILSASNGEAGEVHKASLKAAQATFKKHADGARVNP
FT                   RVPSAPGNSKGSMDGLVDPIAGLQLDVSGRRSKRGLVGRSLPPGGSANNINPRRISSGV
FT                   SCGEYDYKVAAAAAARAARNENESIWPPTNAQHASPLLALPPLKLAGTHTRSSSNISMS
FT                   TLTSGNGSHLSLDEIIATIKVNDPNSQISLKPPTSRRSTQTGAYLSSRESPRGGVDNST
FT                   ESLPAGGSQYSPGRLHIPPIVINPALLGKDSQAILACSESQASPSHCSETTSPPPNTDG
FT                   PVLPVRPPAVSSPIQSTYSFRSFSSNRMPRRIPPPCDPLSQLTKNEQKAVPQAAPLLES
FT                   SEYSGGDSDYDGKQYSKACISETDSALEDDDDFGSGYENFSNAEDYLSSQDDFRERNDN
FT                   NDNDDDDELDDDNLVESENDATMEQDSQSDDDTESAKEFTVANVSYSTLNKIPMNMTYR
FT                   GTLPDLIPNYQRKQSKWMKLFKRHGQTGLGPSKNHPPTSHIYTQNDNALVQSKLHVRLK
FT                   TTMRGILNDSSSSEPHQLSDDSEDSEEDYGSDRNSRSRSPGRRSGKKREKIRQNLRYRN
FT                   SFNEDKPWKSHLDVGYVTERERKRYEGMWVSNRDTYLDLLPWWNNGNYDETREVPEDGL
FT                   MLNLVVTDIWSRSNLPQDTLAQIYDMVDTRRDGTLDRNSFVVGMWLVDQSLYGRKLPRE
FT                   LDRRVWDSVDKYVINVNGSNKNPKHHHRTRKKLLKKELKLIKKESKSHNV"
FT   CDS_pept        624840..626471
FT                   /codon_start=1
FT                   /gene_family="HOG000001091" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778416"
FT                   /locus_tag="AFR104W"
FT                   /orf_name="AGOS_AFR104W"
FT                   /product="AFR104Wp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS53475.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG202362"
FT                   /db_xref="HOGENOM:HBG348725"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI0000253071"
FT                   /db_xref="UniProtKB/TrEMBL:Q754G6"
FT                   /transl_table=1
FT                   /translation="MLESDLDDDTYELSYEYDDIDEFSLASDDGQGGITSGTSTTLVND
FT                   GGYEPRRLSPGACVISCNDVWPSMGMKHQASTYNATATLEYTSLTTSDISQMMIERVSH
FT                   LAPILGIAETDIILLLQDYKWNEAQFIEAYMEDPAKVFESAGLRSPFEEEKDSRAYLHT
FT                   QADFTCQICYTYYEVSETFSLPCCHEYCIGCYRRYVTDKLNHGCVVQCMGCDIAMTNED
FT                   IGMIVGKKASELLLLSSIKIFIQKHKHRYKWCPFSDCDYVIHVTDPHWLVELESSNSSP
FT                   YVTCKNGHSFCFNCVTDMHAPCDCVLASSWLEKSQQESKALNWILQHTKECPKCETSII
FT                   RDGGCNHMKCGTCHHEFCWICEADWRLHTKDYFECNASLREMKLDKFGNGDEKLLLQQY
FT                   GQYCKHFNMHEESARLDVALGKKVKTKLRTLQDKLGVSSVEAQFIFGAIEKLRDGRTAL
FT                   KWSFAMAYFANRSHNLYTIFRQTQVELSRAVEDLSELLQLEDPKLIMKRKQLFYNKADY
FT                   VQNRKNALFRCGEELLAKNICKDSSA"
FT   CDS_pept        complement(626522..627961)
FT                   /codon_start=1
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763662"
FT                   /gene_name="ARP4"
FT                   /locus_tag="AFR105C"
FT                   /product="Actin-related protein 4 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53476.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG345785"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniParc:UPI0000253072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754G5"
FT                   /transl_table=1
FT                   /translation="MSNSALQVYGGDEITAVVIDPGSFTTNIGYSGTDCPQAILPSCYG
FT                   KYTEGEKDELFSEQSIGLPRKDYEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFETNSG
FT                   MPALLTEPIWNSEENRKKSLEVLLESMDFSACYLVPTATAVSFAMGRPTCLVVDIGHDV
FT                   TSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDY
FT                   EIHPSLQKFVNERQFFQEFKETMLQVAPTSISKFKSEIETTSKRSIEAPWGEELVYDSL
FT                   QRLEFAEQLFTPDLSQFPEDWPISKDGVVETWHNDYVPLKRNKPGTNVKDKEGTLDATP
FT                   VPDENSVTSADQPNDNGKRNLEETTPDQKNEVSGLADLIYSSIMSTDVDLRTTLSHNVV
FT                   ITGGTSSLPGLMDRISAELNRSLPALKFRMLTSGQLRERQYQGWLGGSILASLGTFHQL
FT                   WVGKQEYAEVGADRLLKDRFR"
FT   CDS_pept        complement(628193..629683)
FT                   /codon_start=1
FT                   /gene_family="HOG000111161" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082763"
FT                   /locus_tag="AGOS_AFR106C"
FT                   /product="AFR106Cp"
FT                   /cellular_component="integral to mitochondrial inner
FT                   membrane"
FT                   /protein_id="AAS53477.2"
FT                   /db_xref="GO:0031305"
FT                   /db_xref="HOGENOM:HBG059393"
FT                   /db_xref="InterPro:IPR019133"
FT                   /db_xref="UniParc:UPI0001DB2B27"
FT                   /db_xref="UniProtKB/TrEMBL:Q754G4"
FT                   /transl_table=1
FT                   /translation="MLSSRAAAFTGRRLASTLPPVPRKKSHGVRRLLAKAVVATSLFYA
FT                   GGLTLSAYNDKANELFVEHVPFGEELVERWEDWTSLRRPGRRMIDARRVDEISRDFRAA
FT                   ATPEATPVVVRPLVQLQLPELQMQGSSPVLEALVNNVNDVVVALNARALELPEDTASAL
FT                   SSVYGEIVHSIQALNASLDQEFATEVESRTGKAISSVQEQLEVEYKQRELALAEQYIQN
FT                   FEVFKSQLQKATAEQLETELKAHEQALLARHRNEVAQLSIRQVEEFNKIIEKKLDQERN
FT                   GRLAKLSELNSAVESLAPVLDRLELRAVKNECVTQLSTLISDIQGKLSRGGDEPLDLSS
FT                   DLQRLTLLADILPRPKRCCSEGPALLDVAMAELQAKAQAPVASNEQLYNRWQLLQPELK
FT                   TTSLLPPNAGFLGHLTAKLFSMLLFTKEGFSTTQDMDAVTARIAENLRLNKLDCALEEA
FT                   VNMKGWSRKSADAWVDLARRRLEVLTLLDVIEAEVKTL"
FT   CDS_pept        630322..631512
FT                   /codon_start=1
FT                   /gene_family="HOG000113864" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763663"
FT                   /locus_tag="AFR107W"
FT                   /orf_name="AGOS_AFR107W"
FT                   /product="AFR107Wp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS53478.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000253074"
FT                   /db_xref="UniProtKB/TrEMBL:Q754G3"
FT                   /transl_table=1
FT                   /translation="MAKATSAKKVSKKEMKKKEEAAAAAAAASSSSSSSSSESESGSSD
FT                   ESSDESSDSSSDNSSSSNSSSDSSSSDSSDSESSSSSDSDSSDSEEETKNSTSSSSSSD
FT                   SEAEEKEKSASSKSSSSSSSESSSDSESSASDNEGSKEESKKRSAESEDDAVAKKQKTD
FT                   GQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSYAE
FT                   KAVKEMHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADR
FT                   DALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVR
FT                   IDFSSPRPPQQGGATRGRGGFRGGRGGGRTGSGANNAPLGKPRQSAAFKGTKKTFD"
FT   CDS_pept        632538..634184
FT                   /codon_start=1
FT                   /gene_family="HOG000115430" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625871"
FT                   /gene_name="RIM8"
FT                   /locus_tag="AFR108W"
FT                   /product="pH-response regulator protein palF/RIM8 "
FT                   /protein_id="AAS53479.1"
FT                   /db_xref="HOGENOM:HBG059395"
FT                   /db_xref="HOGENOM:HBG204313"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI0000253075"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754G2"
FT                   /transl_table=1
FT                   /translation="MHMRLFSKFKLHGSSAASEEVFGGKFSYTSAVADFYIELGDAHKI
FT                   WKPRDVVTGEVVLTLRKPLRGVSLRMSLEGNLRVQTGSGATSRLKFQRTLFSKSSMIYG
FT                   VEQPEDAEQEGHGLTRGDHRFPFRMRVPSKNIYTSIAFEKGSISYAVGCVLETRSGAQR
FT                   LSSCSRQISVLVPVDVSLLPKLRPKTVVLQSPQLLRSAKANYPEHDTASSLTKRTTASA
FT                   NSNSSVTTVCSSKTVTISVDLPESGYVIGDTIRIKVHIQHYKEYRNSAGLIATLVRICR
FT                   VHSTGTDDPMETFRKDICQCVAPLYVEPETHTCSVGMNLNVPLDAFPTLVVPNQGFTFQ
FT                   YYIEVLANLSSKNIVYTESNRVIGGSGMADIPMPGSKLHPVKKISMLPLKLQGPLGKQD
FT                   TNIDESLIFFQDMVNVDKLKRLRNVTGTSIEVVIGTHRNNSVQQARQSCPGSPVGGSDS
FT                   TMMSEQSAAGTSLPSSVLDIYDQLANRLSSSVGDQLLRYGMSPDSGPHSANDELPRYTP
FT                   NVDYMVTEDKRELEQRKLKELESEPSVEEEQ"
FT   CDS_pept        634390..635103
FT                   /codon_start=1
FT                   /gene_family="HOG000113690" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082764"
FT                   /locus_tag="AFR109W"
FT                   /orf_name="AGOS_AFR109W"
FT                   /product="AFR109Wp"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="AAS53480.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG204404"
FT                   /db_xref="HOGENOM:HBG339832"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0000253076"
FT                   /db_xref="UniProtKB/TrEMBL:Q754G1"
FT                   /transl_table=1
FT                   /translation="MNGQDRRRILGPSNSKALKFGDLVPAQDSKAGTGEVSGDSEASMF
FT                   IQDGMIVNANGSSYLEVKAETHNTLLVTTAYGPRPIRGSFTSRAAISVHFKEVTLERWD
FT                   SGEVTEMCNFLNTVFSAAINVERYPKSGIDIFLNLIQHSNVRDDKTLNLAEVLPDCISG
FT                   ITLALMDAGIELKDVVAAGRHGCNVVAFVNNAETILGFWQEDDSDVMEIVDECKKGYFR
FT                   QRDAIIEHVVSKNKS"
FT   CDS_pept        complement(635233..637764)
FT                   /codon_start=1
FT                   /gene_family="HOG000247858" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625872"
FT                   /locus_tag="AFR110C"
FT                   /orf_name="AGOS_AFR110C"
FT                   /product="AFR110Cp"
FT                   /function="phosphatidylethanolamine N-methyltransferase
FT                   activity"
FT                   /biological_process="phospholipid metabolic process "
FT                   /protein_id="AAS53481.1"
FT                   /db_xref="GO:0004608"
FT                   /db_xref="GO:0006644"
FT                   /db_xref="HOGENOM:HBG059396"
FT                   /db_xref="HOGENOM:HBG738799"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="InterPro:IPR016219"
FT                   /db_xref="UniParc:UPI0000253077"
FT                   /db_xref="UniProtKB/TrEMBL:Q754G0"
FT                   /transl_table=1
FT                   /translation="MTETKSGKAVAPAAQDSVAGTLAVCRSSGEEFRVPKTHDMLRSLF
FT                   DPRLRKSFLELCITLSLVANCAFCYWSWRVMGGEWAMRMYLAQYLAWRLTYNLGIGLIL
FT                   HYQSHYEFLTEFAKRNGLFASGAASKSWLASFCQFEIASKMPREYDMAQYPTEFNVWLL
FT                   FRQFVDLVLMQDFTTYVLYVLLSFSKSQVTWSLLQHLNWTSCRVYVGTLMLLLNVWVKM
FT                   DAHRVVKDYAWYWGDFFFLLKDSNLIFDGVFNISPHPMYSIGYMGYYGVSLITGDYRVL
FT                   LVSILGHFLQFLFLKYVETPHIERIYGPDQPSSIERVDDQIIKNNRNYTRPLMMTYFWF
FT                   KNFDPLRPTDYFTVGTAAASISAILLNPKKETVFAITLFVKLVTSMVNFFILRRQSTDK
FT                   WFTKLFLRNGYTQLYSYQMWQFIYNFNLMLSYVTLALQTWIQFQALSQHDYTNVIFGFI
FT                   LVALHIWADGEILNALTEFGWFYGDFFLTNYIQRPKLASHGIYRYLKNPECVLGVAGAW
FT                   GTVLITDFSVENIILATIWTLSNHIMVTFVESPHVAKVYGNEMLARQSGVGKTLLGFTP
FT                   IKHFSDWLDKFSGSLIDMLNVSTEGRDQLEDVIAAALQATTRKLSPDSEFEINRDSENN
FT                   SDGDFSFTIGDSIEISWKLPRELYHDEDWIGLYRVLETGEDRYRTLVSSRDHWCATNTM
FT                   GYPKSVKAIGAVKEFTKGDTCVQGRVVFDHNLLYFEKGVYEFRYHSTSGHKVLMISPPF
FT                   KITVPQLDLDTPEALYQSTVKLLEKCHCLNENGRFEHSKNKYLSERTLQKLFRNSTGAD
FT                   ISSDYMKRVNYEIREITERIYEMKKILDSLR"
FT   CDS_pept        complement(638384..639904)
FT                   /codon_start=1
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763664"
FT                   /locus_tag="AGOS_AFR111C"
FT                   /product="AFR111Cp"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="AAS53482.2"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="HOGENOM:HBG490088"
FT                   /db_xref="HOGENOM:HBG715249"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI00015192F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q754F9"
FT                   /transl_table=1
FT                   /translation="MLPTGSQEDSANTNSATTAGGVTTSTGGALMSNGTASAKDTSSDM
FT                   NVKEEEMGLDLPDDKENVATALGGELAAGQVLPDQPDLRIIHRKISGYVGFANLPKQWH
FT                   RKSIRRGFNLNLLCVGAKGLGKSTLINTLFNKELYTAKDDTPEQFNALKLEDGEDGDES
FT                   RAKDGENKVKIETVTTEIEENGVVLKLTVVDTPGFGDAIDNTDSWKPIVDEMNSRFDQY
FT                   LDAENKINRTTIDDNRIHACLYFIEPTGHCLKPLDLEFCRQVHDKCNLIPVIAKSDILT
FT                   DEEIEHFKWTIKKQLDDAKVHLFQPPQYLLDDEETQRATRQLFSKVPFAVVGSTHEVAT
FT                   SDGRTVRGRSYPWGIIEVDNEKHSDFVYLRDLLIRQYLEELRERTNNELYEKYRSEKLI
FT                   RMGIKQDNSVFKEFDPELRQQEEKHLHEAKLAKLEAEMKAVFQQKVSEKEKKLQKSEAE
FT                   LFARHKEMKEKLMKQLKALEEKKHQLEMSLANQSSQSPAQPKKKGFLR"
FT   CDS_pept        640372..641127
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082765"
FT                   /locus_tag="AGOS_AFR112W"
FT                   /product="AFR112Wp"
FT                   /function="binding"
FT                   /protein_id="AAS53483.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG190038"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019544"
FT                   /db_xref="UniParc:UPI0001DB2B28"
FT                   /db_xref="UniProtKB/TrEMBL:Q754F8"
FT                   /transl_table=1
FT                   /translation="MADDGEIQGLLAQAAKAYASENFEAAAELYAAVNEAAEAAGHVEP
FT                   DFLFLYGRALWRAAAAAGDVLGGAEDEEQSDLEAAWEVLELARTLYEEALSASGDAVVQ
FT                   QKLAETYDVLGEVSLEAENFGQAAEDLRSCLALRERSGAAERLLVEAHYKLALALEYVP
FT                   GGAAECCAQLQRCVDMLGARVAAGTGAPDDGELLAELQQKLADVAAQPPAAEVAPDALA
FT                   GLREQLASAAVNDLTSRVRRRGGAPDGGQ"
FT   CDS_pept        641164..642126
FT                   /codon_start=1
FT                   /gene_family="HOG000142357" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763665"
FT                   /locus_tag="AFR113W"
FT                   /orf_name="AGOS_AFR113W"
FT                   /product="AFR113Wp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53484.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG252832"
FT                   /db_xref="InterPro:IPR005344"
FT                   /db_xref="UniParc:UPI000025307A"
FT                   /db_xref="UniProtKB/TrEMBL:Q754F7"
FT                   /transl_table=1
FT                   /translation="MLRERLAASRRIFRQTPVVYFSHPTQGANQYHMTSEARRNRSGAS
FT                   HTSAGEVGGPLQRFAGLVKTLQFAWFAGHVVVLLTASMYLLGVRGSSDFHQVVYSLLYL
FT                   GVLESFGIIVYQQHFNLAGKQGRGRSLQEFVHDENFLYCMLAAMWLLTPRFAATVPPFA
FT                   IFSSFHALTYLKGVLLPVVFRAEENNSYMRLISGFLRDNHDKSLSWSCNSELACFLVVF
FT                   LRALACRRRSWIVLALYSLFIKARYEKSANMRAVVRKWEVRADGVVSHPRIPAQLKRAY
FT                   AKSKMQINRLGSFSVFAPFQKPSVAAGKKPMGSPASKHE"
FT   CDS_pept        642461..644386
FT                   /codon_start=1
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082766"
FT                   /locus_tag="AFR114W"
FT                   /orf_name="AGOS_AFR114W"
FT                   /product="AFR114Wp"
FT                   /function="ATP binding"
FT                   /protein_id="AAS53485.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="HSSP:1ATR"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI000025307B"
FT                   /db_xref="UniProtKB/TrEMBL:Q754F6"
FT                   /transl_table=1
FT                   /translation="MSKSVGIDLGTTYSCVAHFSNDRVEILANDQGNRTTPSFVAFTDS
FT                   ERLIGDAAKNQAAMNPANTVFDAKRLIGRNFADAEVQGDMKHFPFKVIDVSGKPQIQVE
FT                   YKGETKVFTPEEISSMVLTKMKETAESYLGCKVNDAVVTVPAYFNDSQRQATKDAGTIA
FT                   GLNVLRIINEPTAAAIAYGLDKKDEGEKNVLIFDLGGGTFDVSLLSIEDGIFEVKATAG
FT                   DTHLGGEDFDNRLVNHFVQEFKRKNKKDLTTNQRALRRLRTACERAKRTLSSSAQTSIE
FT                   IDSLFEGIDMYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVHEIVLVGGSTR
FT                   IPKVQKLVSDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDTSSKTQDLLLLDVAPLSL
FT                   GIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVYEGERARTKDNNLLGKFD
FT                   LTGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSEKITITNDKGRLSKEDIERMV
FT                   SEAEKFKEEDEKEAARIAARNQLESMSYSIKNSLSEAGDKLEAADKETLTKACDEVVEW
FT                   LDHNTTATAEEYNDKLKELQEVSNPIMAKLYQQGGAAPGGAAPGGFPGAGAAAPGADGP
FT                   TVEEVD"
FT   tRNA            join(complement(644868..644903),complement(644792..644827))
FT                   /gene_name="tRNA-Pro"
FT   tRNA            join(645373..645408,645436..645471)
FT                   /gene_name="tRNA-Trp"
FT   CDS_pept        645630..646160
FT                   /codon_start=1
FT                   /gene_family="HOG000022909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778417"
FT                   /locus_tag="AFR115W"
FT                   /orf_name="AGOS_AFR115W"
FT                   /product="AFR115Wp"
FT                   /protein_id="AAS53486.1"
FT                   /db_xref="HOGENOM:HBG370940"
FT                   /db_xref="HOGENOM:HBG704019"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="UniParc:UPI000025307C"
FT                   /db_xref="UniProtKB/TrEMBL:Q754F5"
FT                   /transl_table=1
FT                   /translation="MGSSNRHHADYSNFSASDRSEALIYMIESYQALAEHQDNMVCNLA
FT                   NASSLLWHVYRNLNVKVNWAGFYITEKDDPNMLLLGPFQGKVACQRIQFGRGVCGTAAL
FT                   TQEVQVVPDVTVYPGHIACDGDTKSEMVVPILQDNRTVAIMDLDCSEHNGFTDLDKKYL
FT                   EKLAQEISRTCKF"
FT   tRNA            complement(646253..646326)
FT                   /gene_name="tRNA-Val"
FT   tRNA            complement(646330..646401)
FT                   /gene_name="tRNA-His"
FT   CDS_pept        646558..648108
FT                   /codon_start=1
FT                   /gene_family="HOG000093643" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082767"
FT                   /locus_tag="AFR116W"
FT                   /orf_name="AGOS_AFR116W"
FT                   /product="AFR116Wp"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53487.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059397"
FT                   /db_xref="HOGENOM:HBG396194"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI000025307D"
FT                   /db_xref="UniProtKB/TrEMBL:Q754F4"
FT                   /transl_table=1
FT                   /translation="MDGQVTVKRHGDTHFANIGYGYYTFGVSVGYILLLLLLRKRRGTA
FT                   VPRSRHKLFQMMIDGSPALHLPILLLFLEIAFLGHYSVIDHASVYIKRLGRLSYVLLFL
FT                   NIFLTLRPNYILSDYTYVQLLPMHMWLSRAISTFGVFHGLAFVIKWQLDNEVSLASKLF
FT                   NLWNLLGFIVWILLIILLITSTGVIRRRSYKSFYMVHQINAFAISFIVPVHARPGVALP
FT                   YTITIAVLLGLHALARVSFCMSSAVVHKLSNYQKGSKLVRIKLPRNVMPEHFTPGSHIR
FT                   VSPYRRSNPLYWLVPSHPFTIASLPDDDHVDLILREHGHFEFEVGPRYSIVHNYEGITA
FT                   LQLGLVNRVTIVVGGTGISLGLPLFRYFKENTDIGYLKMIWTVKSHADLHVLDDFEGID
FT                   IFVTQNTTTTPIPGASESWDEIPLEEFELNSMDDLEAEEEHLGESGALLPTTKRKKDPG
FT                   AINIGRRLDWNVELASFVRSEGSSDQLLIVCGPESLVKDGVQFATDHNIVFYKEVYSF"
FT   CDS_pept        complement(648252..651710)
FT                   /codon_start=1
FT                   /gene_family="HOG000141720" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763666"
FT                   /locus_tag="AGOS_AFR117C"
FT                   /product="AFR117Cp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53488.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059398"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001DB2B41"
FT                   /db_xref="UniProtKB/TrEMBL:Q754F3"
FT                   /transl_table=1
FT                   /translation="MSSPTASSKRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGVA
FT                   HLCHYMEQTWAGEAEKELSKDAELKHLRERIRLLEEALGKACNGSGSLPVSPADLAQAS
FT                   PRLVEDGVRGRYDNDTLDLTRQFDMLHVRHGGILHLGATHWLAIMKGDPYLRLLWGHLF
FT                   SVREKMVEWHAQRRRKNQDGARPAGGAGACPVSARVTASRCPVSNQSAAGGRAPKPEAP
FT                   QQCPVTGATAAGHQQLPPFHDLAAKCPVLQHSVTPTPPMSSRRGTIEHTYMGSADAADR
FT                   LAQMLPPKHIIMLFLDHFFKYIYPVVPILDEQSFCHEVDQILSDRQETLVIKVTKPTDN
FT                   CTLGILTIILRLTWLSLPLNESAVELGSQYEQFVVPSVSVSPAAHVKEVSTLFEHQTPL
FT                   DAVTLARKHLVRFDEISSFSNTNVNLATIQFAIFYKMFLMCCPEDASVQPQSATFTSTG
FT                   QDNETHQVLLSSIVQMAFSCGLHRDPDNFPQLSSTLLKTTKDTITNTERLKHTWRKMWY
FT                   FILSLDIQQSLSLGSPRLLRNHKDFSDTKLPFASKIDYVQDIKELVVVKNFTLFFQIDL
FT                   CVVAVLNHILNVSTAKTVRKHELDSLIEALKSLANGGCNLNDLVASLVGQGLLFTTEGF
FT                   IDQTNDVAYSLPSMEHLLSSHTTVPEKDKKPFLPHELTTRSLLFSKHITLRLLLYLLNY
FT                   ILFVHYEPKGNDEPGTRSLARSYAQEAMNYAIDGYYHSLLFFNSFKSDYNKHTSIFTHM
FT                   QVLLAPACLDMGHRALQFMVCLILRAKCGPLTGISDFSIVGSMAPSSDEDDSSGSEDRA
FT                   SSGKELSGALQDFTSIPYISLTAGDHLADTLMEKMALFHKLAKQLSSKYAYATKLCKST
FT                   GFFLTLLKKPSSGSHAKQARQNSLPRIQDLGIASMTGFFKNVPSLVFSATGESITRCPV
FT                   YQDAMDLLPPKEPRASSNMTATVSNGSDVTFLNGSLPPIRPYQPITYNVNGFHKTSDIR
FT                   DTSGSKRRRISANVITPTSSALPPPLPSLCSPQYQCPTSVPDTGTDSIQFQEPHINGNS
FT                   HTPSSRGANDGKGMGNSAFSLSSPSNAEISSGSAQYTPDFEEFLMENSNFNGLIINPSG
FT                   IAEAVGMDQFGHAGDINGLLGADLLPIDDNCMIEVPQSGDLSAFL"
FT   CDS_pept        654516..655214
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763667"
FT                   /locus_tag="AFR118W"
FT                   /orf_name="AGOS_AFR118W"
FT                   /product="AFR118Wp"
FT                   /protein_id="AAS53489.1"
FT                   /db_xref="HOGENOM:HBG059399"
FT                   /db_xref="UniParc:UPI000025307F"
FT                   /db_xref="UniProtKB/TrEMBL:Q754F2"
FT                   /transl_table=1
FT                   /translation="MEDISTLEQAMAVIRALQEQLVDLDSTGKEYEFQLEQTIQLLRQE
FT                   LEQVQQQASEKITRLEIQIDDLQEQTRVWKSKYMDECEQNGNLLQDKLILECELENVKE
FT                   EVARMRMDGPLALDMSSGSEKTASPTTPGSTVSGVLGPALASPLSLHRSMSATNLHSGV
FT                   PMKGTPVPEVGLGLLPQQHSPPSPQPIRVMFKGTSLMLQSMAAEEPKSIVPSLNQATVV
FT                   TTTNTQVPRR"
FT   CDS_pept        complement(655263..656990)
FT                   /codon_start=1
FT                   /gene_family="HOG000188189" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763668"
FT                   /locus_tag="AGOS_AFR119C"
FT                   /product="AFR119Cp"
FT                   /protein_id="AAS53490.2"
FT                   /db_xref="HOGENOM:HBG338194"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001DB2B42"
FT                   /db_xref="UniProtKB/TrEMBL:Q754F1"
FT                   /transl_table=1
FT                   /translation="MRLRLSSCRFAGTIRTGRGHPLAQLRQSSGVALNGSAPKSGENDK
FT                   IRAMFTWKRAAAAGLATGGLLYYTNDNFHDLVRHVGTTSKRVSVVTVATVRCCYQYKRT
FT                   LSQSYESEEARLEALSRCHKTCAEITLHALEKNGGIFIKLGQHIGAMTYLLPQEWTSTM
FT                   IPLQDKCPQSTLEEIDGMFRHDLRQGLDELFETFDPHPIGVASLAQVHIATLKGSHEKV
FT                   AVKCQHPHLKEFVPLDVMLTQNVFNVLDVVFPEYPMTWLSDELQSSIYVELDFTKEAEN
FT                   AINTANYFYKYRKETALRIPRVVSAAKRILVLEFVEGERLDNLRYLDTNGISRSEVSSC
FT                   LSHIFNNMIFTPNVGVHCDPHGGNLAIRVLPKPKAGHNFEIVLYDHGLYRMPTTEMRRD
FT                   YAKFWLALLDKDTEKMKLYAKKFANVKEEQFPIFAAAITGRSIDTALNYDISTVRSQDE
FT                   IDRMKNALLSGGLLVDIMALLSTIPRIVLLILKTNDLTRHLDECLENPLGPERTFLILT
FT                   QYCARTIYQETCERIDHMYRRWTFRWIFCEIKAWLEYERRKSQLIIFDVALWCKKYFV"
FT   CDS_pept        complement(657302..657850)
FT                   /codon_start=1
FT                   /gene_family="HOG000039675" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763669"
FT                   /gene_name="SYM1"
FT                   /locus_tag="AFR120C"
FT                   /product="Protein SYM1"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS53491.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG472290"
FT                   /db_xref="HOGENOM:HBG750297"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI0000253081"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754F0"
FT                   /transl_table=1
FT                   /translation="MSSFFKFYKASLQSHPKRTNALTTGFLFGLGDIVAQTQFPEPGAS
FT                   YDPMRTLRPFLYGAVLFSLVGDKWYRFLSTVRLGRLPQAHWANVLARVACDQLIFAPIG
FT                   VPLYYTAMALMEGGSLEDVRIRLSEKWWSTLLANWIVWPAFQLCNFSLVPVQHRLLTVN
FT                   VLSIFWNTYLSYSNSTASS"
FT   CDS_pept        658350..660020
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763670"
FT                   /locus_tag="AGOS_AFR121W"
FT                   /product="AFR121Wp"
FT                   /protein_id="AAS53492.2"
FT                   /db_xref="HOGENOM:HBG059400"
FT                   /db_xref="UniParc:UPI0001DB2B43"
FT                   /db_xref="UniProtKB/TrEMBL:Q754E9"
FT                   /transl_table=1
FT                   /translation="MFVDYSSKGANKITNRIFAEKLLDLFFLDTLDDAQVLEFVKGRIL
FT                   GNQFMQRLTLNDVHGNRYWLYYILGLKLSNEQMEEALDELVASRLLYQVELTFPDCSFE
FT                   DAYELKESDPMRKVVVDLYISSIFLKCKINSYVKEFTKLVTSDKKMMMLLSREERLLAF
FT                   SQYFPEERHEFDSLVVILPVKFPRTYLSLLEKDGTMRTNIRLEFKKWELADRRLLYSKN
FT                   VHIRDIVARDQDVQLRWIPNDEILTPRVRQSGDVEHSETSIMLRDIHKRHIERQKVMKS
FT                   VNEKMASAGEYTSSEPKPEFLKIFDEINEELEQAMENDEKVINKTQEIRHRVKNGSIVL
FT                   PSEIEYLRDPSTHDILKPINTNQVQHSLEKLNFDSDCVFECENSREFTIDRETSYKTPV
FT                   KDHVQHYPDAVMTYRNVAYVPASNNLEAPDIMLRLSCRRSNSTVRKKLAGIVRSPFAKK
FT                   DSAMYLDDGSMVPESFSKLSFRFFLKAKFRKIKQDWRYYKNVAKQCMDDFRSPSAGIII
FT                   PPKSAALLQEPVQLLSQAHNNSKFVDQKNRSVAGTSALN"
FT   CDS_pept        complement(660508..662382)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931396"
FT                   /locus_tag="AFR122C"
FT                   /orf_name="AGOS_AFR122C"
FT                   /product="AFR122Cp"
FT                   /protein_id="AAS53493.1"
FT                   /db_xref="HOGENOM:HBG059401"
FT                   /db_xref="UniParc:UPI0000253083"
FT                   /db_xref="UniProtKB/TrEMBL:Q754E8"
FT                   /transl_table=1
FT                   /translation="MSEREHARAIEEADERAPMLAEQAAGGTAGYGTGRTSQETLPELP
FT                   ASQLSIPQRFALFLLFVVLLPLSYVYTTMPAPDVLQKYVADITELEVRRVSFQGWAEAP
FT                   PGMAGAAQGNSGKWMAFGVNVSMAVDYEKETTVPVTANQRSLLRLMGNDILGDICVSLN
FT                   EGAVYTHNAAGEVVPLVTVADRQPVCVSLLDGEVTDILTQVYVRPNLTNMVWLVGELQR
FT                   NRKWQPQLLSNLSVSTRKLFFEDLYLPVRDFHVAGTSVDEYVDWQKLRRMLRHGGAIFE
FT                   TITRNSTILELAVTDVPKDSALRLQASVRIPIVGQGMDQFILPEDIVFPATEWMVALPG
FT                   CDGNGTIGLPNATIVVDPVKALKWEQQSSIDISMTAVVAGRLPDPLLYEVCEYDNGNVV
FT                   TPMSLIFRKMFDPAQLVELTVKGRRALESDDLETIPVEVVTELVAATKLPLAFNFTVSQ
FT                   SDMIEDLSIQRLKLRLRRNRHGEKVLHVAGKVRILFNPPFYNVTEDSSVSITAVKGVID
FT                   LYHHNVRFASTPLRTWLPCDTAIDGGRLEVSLELDQDEVDIIDPVQLSVCLNEIIFNGQ
FT                   TEIYIDGKVDILTKTVLGELVLFDMPAHGKTVVKKDDDVLLINQLDTV"
FT   CDS_pept        662731..663627
FT                   /codon_start=1
FT                   /gene_family="HOG000205302" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625873"
FT                   /gene_name="DPH5"
FT                   /locus_tag="AFR123W"
FT                   /product="Diphthine synthase"
FT                   /EC_number="2.1.1.98"
FT                   /function="diphthine synthase activity"
FT                   /biological_process="peptidyl-diphthamide biosynthetic
FT                   process from peptidyl-histidine"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53494.1"
FT                   /db_xref="GO:0004164"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017183"
FT                   /db_xref="HOGENOM:HBG023668"
FT                   /db_xref="HOGENOM:HBG460511"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniParc:UPI0000253084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754E7"
FT                   /transl_table=1
FT                   /translation="MLFLVGLGLSSHEDITVRGLNAVKRCARVYLEHYTSILMTASKEE
FT                   LEGFYGKPVVLADREMVESGCEEILRDADKEDVAFLVVGDPFGATTHTDLVLRAKKQGI
FT                   VVEVVHNASVMNAVGSCGLQLYNFGQTISMVFFTDSWRPDSWYDKVLENRRIGLHTLVL
FT                   LDIKVKEQSPENLARGRLIFEPPRYMSISQCCEQLLEVEEKRGQQAYTPDTPCVAISRL
FT                   GAPTQHMKSGSIHELAEYDAGEPLHSLVILGRQCHELELEYLLEFSEDQERFKDQVHRD
FT                   QEFFKPAPWVPPPEDED"
FT   CDS_pept        663810..664280
FT                   /codon_start=1
FT                   /gene_family="HOG000185227" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931397"
FT                   /locus_tag="AFR124W"
FT                   /orf_name="AGOS_AFR124W"
FT                   /product="AFR124Wp"
FT                   /function="protein transporter activity"
FT                   /protein_id="AAS53495.1"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG333059"
FT                   /db_xref="HOGENOM:HBG353326"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR015604"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI0000253085"
FT                   /db_xref="UniProtKB/TrEMBL:Q754E6"
FT                   /transl_table=1
FT                   /translation="MSKLKYLLLFSRQGKIRLIRWYRPYEQKEKALIIRELTATVLARK
FT                   PKMCNIIEYQDHKVVYKRYASLFFVCGISPEEDNELLTLEIIHRFVETMDRYFGNVCEL
FT                   DIIFNFTRAYNILDELIMCDGSFVESSKTDVLKNMATMDSIESNDNLERALV"
FT   CDS_pept        complement(664351..664743)
FT                   /codon_start=1
FT                   /gene_family="HOG000141721" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778418"
FT                   /locus_tag="AFR125C"
FT                   /orf_name="AGOS_AFR125C"
FT                   /product="AFR125Cp"
FT                   /protein_id="AAS53496.1"
FT                   /db_xref="HOGENOM:HBG059402"
FT                   /db_xref="HOGENOM:HBG104258"
FT                   /db_xref="UniParc:UPI0000253086"
FT                   /db_xref="UniProtKB/TrEMBL:Q754E5"
FT                   /transl_table=1
FT                   /translation="MIPRIVGKLRPFTNIAIKSKGSSLLLAQSRTFRASPLAQTFMAWS
FT                   ELSKEAKKQFIRNYIELYKQKNPCSKSNVMYRALAGDMDVHDDAPYVFGILYNEIRAVQ
FT                   LGISRDNQKGSGGAMGDPDFAALLYK"
FT   tRNA            join(complement(664917..664952),complement(664854..664889))
FT                   /gene_name="tRNA-Trp"
FT   CDS_pept        665254..666522
FT                   /codon_start=1
FT                   /gene_family="HOG000203886" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763671"
FT                   /locus_tag="AFR126W"
FT                   /orf_name="AGOS_AFR126W"
FT                   /product="AFR126Wp"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53497.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059403"
FT                   /db_xref="HOGENOM:HBG329514"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniParc:UPI0000253087"
FT                   /db_xref="UniProtKB/TrEMBL:Q754E4"
FT                   /transl_table=1
FT                   /translation="MVITEALSFLGLAYITFQSVLEVVIVSFAGFWCTYSGLLPKEGQK
FT                   IISRLNVDVFTPCLIFSKLAKSLSIAKILEIGIIPVFYAISTGISFVSGKALAMLLHLD
FT                   VDETNFVVANSIFGNSNSLPVSLTLSLAYTLPGLEWDQIPNDTKDSIASRGILYLLIWQ
FT                   QIGQVLRWTWGYNKLMRWSGERDNEVRQSLLEAQSEDAVTLAEAESELAIRSPTDFDEN
FT                   STSAPSITSIDRLKTTVLHGVNRVRGFMNPPLYAMVLSVIVASIHPLQHELFHADGFIN
FT                   NTLSEAVNELGALSIPLILVVLGSNLYPSHDVSPKSHNYKKIVFASIVGRMIFPSLLLL
FT                   PLIAACVKFINVSILDDPIFLVVGFILTVAPPAIQLTQITQLNEFFEAEMAGVLFWCYV
FT                   ILALPMSILVVSGAISVLRWAEA"
FT   tRNA            join(666734..666771,666802..666845)
FT                   /gene_name="tRNA-Leu"
FT   tRNA            666916..666987
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        667099..667761
FT                   /codon_start=1
FT                   /gene_family="HOG000116065" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625874"
FT                   /locus_tag="AGOS_AFR127W"
FT                   /product="AFR127Wp"
FT                   /protein_id="AAS53498.2"
FT                   /db_xref="HOGENOM:HBG059405"
FT                   /db_xref="InterPro:IPR007277"
FT                   /db_xref="UniParc:UPI0001DB2B44"
FT                   /db_xref="UniProtKB/TrEMBL:Q754E3"
FT                   /transl_table=1
FT                   /translation="MFLQLLAVLGTIFGFLFLTLSIAAGLYYVSELVEEYSEPTRRFLN
FT                   RTIYAVIATYALLLVFDSFPFFLTCFSIASHVVYAQNLRKFPFISLSSPTFVASCVLVA
FT                   LNHYLWLRHFNNNDVPVRFRMDPGYRAPRRTSLAEVTSFFALCVWFIPFALFVSLSAGD
FT                   NVLPTAMGKKDDDARDAVTRKASSLLKVLIDSVRSYFHSVARVFGIRASRHNDGLAL"
FT   CDS_pept        667843..670011
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763672"
FT                   /locus_tag="AGOS_AFR128W"
FT                   /product="AFR128Wp"
FT                   /protein_id="AAS53499.2"
FT                   /db_xref="HOGENOM:HBG059406"
FT                   /db_xref="UniParc:UPI0001DB2B45"
FT                   /db_xref="UniProtKB/TrEMBL:Q754E2"
FT                   /transl_table=1
FT                   /translation="MCRGVDSRAPREDLFQHFKYEYMGSTCLIFLEREVERHNMNRRID
FT                   LTSTFWSEDYLTGIDWLLHNIQSDISELVQFADLYDKFQESWSYAARQIAKVSTGDALE
FT                   GYTKVKSYGKGTEMVARVYRNQTRQLEYLAEKLRTSSLAAVEDPIKNLLFQYREFQTDI
FT                   ESALKLDHGKVKRQMDALRSMHRQIKKKAAAIATLDPEDEEDLQSMETVVERQFPSSLG
FT                   SSLKFGCEAEWEEYLSRLKNDVPITKRKWVIPGLPNEYFSGGDLYHSLKRLDAKMDTSL
FT                   FNLENVGQQLLDFGVLRSYNDVLHRPGYKFTHQGFYCWVPDAPTPTGSMSPASSSGKIL
FT                   QDIWKRVSSGGTVEQDTTYAALEISQLNEQFVKQWFLWENEKLKLEVDLFYFMKKFAKL
FT                   SKHKFRTMVDVDKSIVTSFEQEWKIDGKASAVDADEAWYEVYSKNHGTIGFYTPHAGLH
FT                   FEMYTLQGTPVAQPWLFGTPLQDMPVLDNEQPVVLHKLLEKAQTLDPGLVAKEWAAPLD
FT                   LVGISNMKRDCLNEYLLDCDHAAVMEKVLKKWTIGPNIIQLLRSWLLELPDSVVPFTLI
FT                   GSFKEGGLDWLDLCPSSNLQCIAALAAHFNWLGPERLKVLFEQEPSPQPFPISHHFVRA
FT                   RVRAPLDCLLFDATLHRFFLDDEFTASCTRAARASPSARTGRPPKNHLTVADSYEFVPR
FT                   PFRANSCEPSPTRNKRLSGLTILHPTSG"
FT   CDS_pept        670548..672044
FT                   /codon_start=1
FT                   /gene_family="HOG000255147" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082768"
FT                   /locus_tag="AGOS_AFR129W"
FT                   /product="AFR129Wp"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="phosphogluconate dehydrogenase (decarboxylating)
FT                   activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="AAS53500.2"
FT                   /db_xref="GO:0004616"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="HOGENOM:HBG110488"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012284"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001DB2B46"
FT                   /db_xref="UniProtKB/TrEMBL:Q754E1"
FT                   /transl_table=1
FT                   /translation="MRRDHILTASRGDIGLIGLAVMGQNLILNAADHGYTVVAYNRTVS
FT                   KVDRFLEDEAKGKSIIGAHSVEELCANLKRPRRVILLVKAGSAVDAFIEQLLPYMEQGD
FT                   IIIDGGNSHFPDSNRRFEELKQKGIHFVGSGVSGGEEGARYGPSLMPGGAPEAWPHIKE
FT                   IFQSIAAKSEGEACCDWVGPAGAGHYVKMVHNGIEYGDMQLICEAYDIMKRLGGFTDKE
FT                   IGQVFSEWNKGILDSFLIEITRDILLYEDLDGTPLVEKILDSAGQKGTGKWTAINALDM
FT                   GMPVTLIGEAVFARCLSSLKDERMRASALLSGPEIPKDAVKDRKQFVDDLEQALYASKI
FT                   MSYAQGFMLMREAGKTFGWELNFPAIALMWRGGCIIRSVFLAQITKAYRENPYLENLLF
FT                   NKFFADAVTKAQQGWRRTIGLATTYGIPTPAFSTALAFYDGYRSKRLPANLLQAQRDYF
FT                   GAHTFRVLPEAASAHLPVDKDIHINWTGKGGNISASTYQA"
FT   CDS_pept        672363..674222
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931398"
FT                   /locus_tag="AFR130W"
FT                   /orf_name="AGOS_AFR130W"
FT                   /product="AFR130Wp"
FT                   /protein_id="AAS53501.1"
FT                   /db_xref="HOGENOM:HBG059407"
FT                   /db_xref="UniParc:UPI000025308B"
FT                   /db_xref="UniProtKB/TrEMBL:Q754E0"
FT                   /transl_table=1
FT                   /translation="MMTEEDSFLYLEEQDRIYSRDPTFESVGPKPFLQQNAVPPLPPLP
FT                   ALPQYPTRGVDSKSLLGRVKNMLFKGPYGNGPGGFPIPGDQVPIELHTQLKKQEQLWKI
FT                   IKEKPFDPAVGLAATPPSRGSSGDTFLSGGADLSPRRQPPPPATRPAKAVSGLMNNKEN
FT                   EAAAAKYYHSGALQADNEQNSTAALELLTNKILGHRKIGLKKIQDRLNEIAEKKFAVNK
FT                   LYGKLTQEFNIWSNDVVESEEGLRLVEELQRVLKLDMLMEKNSAQKFRDLAFGLNFIKL
FT                   REDQMLLAKKELNSDIRKYENVRTKKGEYHEETSYWKEIVNTKQNSLAEVTILYQQALA
FT                   KTMRELFTLSCVTFYENCTEMKEACKQFFSDSMEYLAGSLGEEYVDEYLDELRKRRADK
FT                   KWAKLSFEDKNNPNKLAELIGNMYNGDDSLLSNVPKKHMIKFSAEAILKEEFDPVLKEK
FT                   EPKLHFGTGLEEDWSQFPTEKYNGIASNKYFLERQAESIRNLDSHGNAVQNRSTDSTNK
FT                   GSTRTLRGINPKYTRPAAQPLATTKEEVEAEESPKPSVVTQSSVYKTLRPSSQQLKQPG
FT                   TEKSYQEVVMKFGSDIARSLDLRFKEAEEELNTNKWVSARTDG"
FT   CDS_pept        complement(674416..675450)
FT                   /codon_start=1
FT                   /gene_family="HOG000214473" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763673"
FT                   /locus_tag="AGOS_AFR131C"
FT                   /product="AFR131Cp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS53502.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001DB2B47"
FT                   /db_xref="UniProtKB/TrEMBL:Q754D9"
FT                   /transl_table=1
FT                   /translation="MSKETGKKVTLKERMVSASAGSLVTSLFLTPLDVVRVRLQQQEML
FT                   PSCTCTGQLSKPAGKVFWQDECFANVGCREPAARLQGTLEGLRKIAQLEGLPTLWRGLG
FT                   ITLVMAVPANVVYFSGYEALRDNSPLASRLPVANPLVCGAFARILAATTIAPLELLRTR
FT                   LQSVPRARDTERTIYLIGDLLREMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYE
FT                   FCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQ
FT                   LTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKK
FT                   FFTS"
FT   CDS_pept        complement(675736..676500)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082769"
FT                   /locus_tag="AFR132C"
FT                   /orf_name="AGOS_AFR132C"
FT                   /product="AFR132Cp"
FT                   /protein_id="AAS53503.1"
FT                   /db_xref="HOGENOM:HBG059408"
FT                   /db_xref="UniParc:UPI000025308D"
FT                   /db_xref="UniProtKB/TrEMBL:Q754D8"
FT                   /transl_table=1
FT                   /translation="MHQYRKTKPLIPNIDVMNFDHDRRSSMIAGNGRKKFDTPRKDNVF
FT                   GKKRAQETVTETPLQQMSNVDEPSSSFMMHPIQNKEQLLDNPPIFNNSPQYFPDLNYLS
FT                   PWHSYSNGVGTPIPINSSMIGNPNLSNVPMTKTYDPYDVPQSSFPAYFNPRAALNMPHR
FT                   EKVNQWIENVPIHIVHEEYLTHDCYSIDEYMNWEEDEFDMSLFQRGEKTQINMATVDEL
FT                   LQFQLKRITSMVLRLYEESPEVPLDNSDATSY"
FT   CDS_pept        complement(676677..679589)
FT                   /codon_start=1
FT                   /gene_family="HOG000214817" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763674"
FT                   /locus_tag="AFR133C"
FT                   /orf_name="AGOS_AFR133C"
FT                   /product="AFR133Cp"
FT                   /function="endonuclease activity"
FT                   /function="single-stranded DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53504.1"
FT                   /db_xref="GO:0003697"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG059409"
FT                   /db_xref="HOGENOM:HBG397052"
FT                   /db_xref="InterPro:IPR001044"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniParc:UPI000025308E"
FT                   /db_xref="UniProtKB/TrEMBL:Q754D7"
FT                   /transl_table=1
FT                   /translation="MGVHALWDILGPTARPVKLESLSNNRMAVDASIWIYQFLKAARDK
FT                   NGNRLKGAHIIGFFRRICKLLYFGIKPVFVFDGGVPPLKRETIRQRKERREGKRESAAV
FT                   TARKLLALQVQQQGDTAFKGNSRSKSEGSVTFRPSDEYELPNIPGFLYDERDERVMSTE
FT                   EYKAVFEHLDELDGIDLESINPASKEFDELPNATQYLILSTLRLRSRLRMGYTKEQLEE
FT                   IFKDSMDFSRFQIEMVKKRNFYTQKLMNTTGVHDGGLSKLDLEHSRSRVAGQRQKEYTL
FT                   VKTEMGWAMSLGEYDGSEASKAIPLDDAAIAPTRPVQSSWSGNDVEDSDEDNLEWEDID
FT                   IAPKKEKKVADYSLKASAIPTTIVEGSSTGSQSFLDRPFRNSGKLRQPERAIQFVDDNS
FT                   TDSDREYLDYVEETTNMEELKKTRGNLAGVEHRVSKHNPYKTAPDNATSEESLKDLSEV
FT                   EEVPRKPGTRNDAQFPLQHKGTHNIMTDKINSELNDRMIPDVHTLPSINLGKGSFLFDI
FT                   KTSKEESSSSGETKPEQRKINQDVPLWFNSVPTTNPHTATGFVSDKETSTFTEDEKLGI
FT                   FSGVAATELMRQNVSSTDLESLEKELDGDSNDLEELTQLNKEHTEPTRAPDIPKGYLLK
FT                   DTTQRSKEESTFAYDFPEEEEEVLVEQLRKEHADYNRFKHTLDPSIATTAFIEDELYEQ
FT                   NTKDKRDADEVTPEMIRDIQQLLSIFGIPYLTAPMEAEAQCAELLRLKLIDGIITDDSD
FT                   VFLFGGSKVFKNMFQEKNYVEYYNTETISAELGLDRLKFIALAQLMGSDYTNGIKGIGP
FT                   VSGIEILANYNTLEEFRTWYNEGQFRKSLLDKESLFQKNLRKKLTKSGVVLGDDFPSAA
FT                   VSDAYLNPEVDHDTTKFVWGLPELDSLRTFLGSTLGWPTEKADEVLIPLIRELNKRRSK
FT                   GTQSTLVEFFPTKFIDADKGAKLGRRIRDATVMLKKRRTK"
FT   tRNA            complement(679682..679754)
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        complement(680315..681274)
FT                   /codon_start=1
FT                   /gene_family="HOG000239685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763675"
FT                   /locus_tag="AGOS_AFR134C"
FT                   /product="AFR134Cp"
FT                   /function="ATP citrate synthase activity"
FT                   /function="binding"
FT                   /function="succinate-CoA ligase (ADP-forming) activity "
FT                   /protein_id="AAS53505.2"
FT                   /db_xref="GO:0003878"
FT                   /db_xref="GO:0004775"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG001349"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="UniParc:UPI0001DB2B48"
FT                   /db_xref="UniProtKB/TrEMBL:Q754D6"
FT                   /transl_table=1
FT                   /translation="MFRHVSRRCFSRESTPYDKTIKNLLMPKGTKVIFQGFTGKQATFH
FT                   AKISQEYGTQVVGGTNPKKAGQVHLGQPVFASVAEAVRETGATATGIFVPPPIAAPAIR
FT                   EAIEAEVPLAVCVTEGIPQHDMLYIAEMLRTQDKTRLVGPNCPGIINPGSNVRIGIQPT
FT                   KIFTPGKIGIVSKSGTLTYEAVQQTSLVGLGQSLVIGIGGDAFPGTDFIDALRLFMEDG
FT                   VTEGIILLGEIGGKAEIEAAEFLKAYNQTRATPMPVASFIAGTVAGQMKGVRMGHSGAI
FT                   VEGSGTDAESKKAALRAAGVAVVESPGRLGEALLKQFQ"
FT   CDS_pept        681760..684135
FT                   /codon_start=1
FT                   /gene_family="HOG000246531" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763676"
FT                   /locus_tag="AFR135W"
FT                   /orf_name="AGOS_AFR135W"
FT                   /product="AFR135Wp"
FT                   /protein_id="AAS53506.1"
FT                   /db_xref="HOGENOM:HBG053046"
FT                   /db_xref="HOGENOM:HBG395461"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI0000253090"
FT                   /db_xref="UniProtKB/TrEMBL:Q754D5"
FT                   /transl_table=1
FT                   /translation="MYLAMQYHHSSRRQWIVSMDDEREMSVEMDVSIMDPIPTTEGKVS
FT                   KPETAGAAAGQGKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNLHISQTGLFRP
FT                   LPLINQKNYSSDYLRKDDQIFSMRERKSLRSGNVNPVNSSQPPTLLAEAGEDDLKLNGD
FT                   EDGIDDTEDANTIVIHPGSRSLKIGLSTDVFPLSVPSCVAVARRASQRLEPQQRYDKDE
FT                   DFMEHLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSRAQPEKIPEHNDLHRIEWIKDA
FT                   PEGTIYYGEGAERCLPENFVIRYPFSNGAFNVECPDYSSLQELLNDVTKLITFALSETK
FT                   LGISRSQFPNYKVILIIPDLFEKNYVEQMIRLLLSEMNFQAVALIQESLATCYGAGLSN
FT                   STCVIDIGASETKISCVDEGQVIQNSCIRLSYGGDDITRLFVELLLQSNFPYPDWNLNT
FT                   RQGWILAEQLKKTHITFQDADVAVQLFNFFKREPSVPGAEKFEFKLFNEVMISPMAYFY
FT                   PQILSFLKPATSYNKYMAQQLPESRDPYTYKPDNPKSIAQESAFTGKVYTDINKDLDII
FT                   RKLVSVNDEVEALTSGPSERTSGDTIKTNTRRASNYTPLDKAIIESVTTASVLLGDNMS
FT                   KLVNFYSNLLVIGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVVYKKVSEMVKQVENE
FT                   IKKNNPESEEEIAQSRKKLIKSIKIELENYWESVDPYEHVYPIAVLPPPREMDPSMLTW
FT                   KGGSVFGRIKLCEELYITAMDWEMLGSRILKYKCIFDY"
FT   CDS_pept        complement(684307..686394)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931399"
FT                   /locus_tag="AFR136C"
FT                   /orf_name="AGOS_AFR136C"
FT                   /product="AFR136Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53507.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG059410"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0000253091"
FT                   /db_xref="UniProtKB/TrEMBL:Q754D4"
FT                   /transl_table=1
FT                   /translation="MAQLEDPKERAGKVGESQHGQHHNTAFIHKLYSMLEDDNMKDLIW
FT                   WSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNMYGFHKVSDHKPSSAKGTSQDE
FT                   DEAINLWEFRHSMGCFRKGDKESLKSIKRRSSKNQVLLSRNNSAQSLASQYNSQQDLGP
FT                   GGSSIAGHVHPIEPADKYYSTTVYQPPYTDAPPLHSQSQIQAYPDMRFPQEQKPHTSSV
FT                   ITLPHLPNSAIEDLRATNLDMMKLLDLVQKAMHISSPPSANELGGSVCSTSGGSGLSSN
FT                   QLGSASGSANDVTSPSSFARSPTGTRERTLEYLHQEIAAFRTTILMKLQRHAELQLHML
FT                   PPTPSQRHSHPQNSYAVSAPPSTGTNFLPYNGSGSIGMPTGYDAYPTNKPALAIPGAIS
FT                   HGFHGSPYLMLDPYAKGSSSSISRKRHMSVLVDPLAPAPMSAPAAMQVPSLAQPTSTSS
FT                   SPVHAPEGNMPHANAAGANSPFHASCPVSRIDSRQDLHHHQTSNPSASEDKRPFSPSRK
FT                   DSPPSQLLPLLTTNARGSGDGNSLLLAPQSPATLPPTASQHRLPAPTPQNNAGRGPAQV
FT                   SITYKPYFPYGTIPPQPVLSSQYILPLFQSGSGSFTSGSSVTAAHAPLRSTTAIPETSS
FT                   CNNSEIPSFPKPTTDEQQAPATVNQSATNSHRQSIVNQDTCSSPATSKSRGLYALLNHD
FT                   T"
FT   CDS_pept        complement(687006..688109)
FT                   /codon_start=1
FT                   /gene_family="HOG000021113" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763677"
FT                   /locus_tag="AFR137C"
FT                   /orf_name="AGOS_AFR137C"
FT                   /product="AFR137Cp"
FT                   /function="NAD+ or NADH binding"
FT                   /function="isocitrate dehydrogenase (NAD+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS53508.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004449"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG435977"
FT                   /db_xref="HOGENOM:HBG518924"
FT                   /db_xref="HSSP:1AI2"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI0000253092"
FT                   /db_xref="UniProtKB/TrEMBL:Q754D3"
FT                   /transl_table=1
FT                   /translation="MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGV
FT                   GPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATP
FT                   IGKGHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVS
FT                   PGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGR
FT                   EYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSA
FT                   NIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIA
FT                   SSRENRTADLAGTASTSSFTNAVIERL"
FT   CDS_pept        688486..690345
FT                   /codon_start=1
FT                   /gene_family="HOG000216514" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625875"
FT                   /locus_tag="AFR138W"
FT                   /orf_name="AGOS_AFR138W"
FT                   /product="AFR138Wp"
FT                   /function="ATP binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="AAS53509.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG326381"
FT                   /db_xref="HOGENOM:HBG517846"
FT                   /db_xref="HSSP:1JWA"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniParc:UPI0000253093"
FT                   /db_xref="UniProtKB/TrEMBL:Q754D2"
FT                   /transl_table=1
FT                   /translation="MRDYSVRQIIGDGQFTRLRDMKVLLVGAGGIGCELLKNLVQMGFG
FT                   EVHVVDLDTIEISNLNRQFLFRQRDVKRAKAATAVAAVGYFSSGRLVAHQGNITDATVF
FT                   PLAWFRGFAAVFNALDNVAARRHVNRMAQFASIPLLESGTAGFDGQVQPIVPGKTECFD
FT                   CTAKETPRTYPVCTIRSTPSQPVHCVIWAKNFLFQQLFGEPAEPPATEDLGTDDPAEIA
FT                   RIRQESGELAQLQEWARTGDTARVRAVIEKLFVVDIQKLAAIESLWHTRPQPEALEGFE
FT                   LGVPSNAADASALWGIQEHLNRFAASLRRLMERMPREGSIEFDKDDADALEFVATAANI
FT                   RAHIFHIKMLSVFDIKQIAGNIIPAIVTTNAIIAGLSALVSLRVLNLLRVMPNDPLNLP
FT                   MAFTSMASKISSNRYLAAPRLSPPNPNCSVCAHYQRCALTVGAVRCKTLTLGELIEAVQ
FT                   EKYGFSNEVSVVDTSTNRLLADFDFDDLNGNTLEKLELRTGSILTVSDDVPSEEDNTVR
FT                   KPIEFYLELSDSATGFELIELPHIRVIDKETASNSDSVEADGKTAEVDLDLVDASGAIV
FT                   IQDEEDSQPDAAKRKHSRDSESDDSTSKRARLDADSAEILILD"
FT   CDS_pept        complement(690727..693186)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763678"
FT                   /locus_tag="AGOS_AFR139C"
FT                   /product="AFR139Cp"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS53510.2"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="HOGENOM:HBG059411"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI0001DB2B49"
FT                   /db_xref="UniProtKB/TrEMBL:Q754D1"
FT                   /transl_table=1
FT                   /translation="MSEQGALATSPAKSQLAAWWRQFKNSPKSISTDSISGRERPLLGK
FT                   PASVHAVPCAPGRDFRTYRDSFLHSRNDFKGQVFGVPLADSLALASAEVIVQGELANFG
FT                   RIPIVVAKCGAFLKQRGLYTSGIFRIAGNSKRIKELVYIFSTPPHYGTKFTSWDGFTVH
FT                   DAASVLRRFLNNLTEPLIPLVHYETYREPLRTRVRILKHMTRPPPVRDDSGRETENALS
FT                   DPKTSTSDAEEALDAEEVRRQRRHRKRLTRDIKAALHEYEVLFSELSNDSKQLIVYLLD
FT                   LLSLFAQQSEVNLMSARNLAAIFQPSILSHPDHDMDPKEYELSRLVIEFLIDYSYRLLP
FT                   HLLKITKNEQALLQKQQQRGDGLKTHVCGLEAPSDIAVPMANEINQYSNVADSPAPLLK
FT                   TNKEVGSSSPQSNSNVRAPNVMNNAATKTAAAKAAGKPGERDSQYMNVPSPAISIPLTP
FT                   TGSVLKMYDPDLWSASDLPFVTAQQRLTSPALSPSLPNEPQALSSSLPSPQILSSSFPH
FT                   QQLRPEQEQLLLQQQQQQQMQQPQHEQHLQQPQQQQNLSSQQHDHATQQKQRFSRPSQS
FT                   QHLAGLKQPPQQWVQQARLDSRSGSPELRRRYRYRPHSKSLSSAISPSDMIAARRNNVN
FT                   PRIGKYLLLGSDTEGMSEYDEDEECVGYQDIYSPGSNNSDLLVVNPAFSLPATGIRQGG
FT                   SEVSIDSPTATDKRYDPNIVSSRPHDYNTIGTLHPSANPIGHLSDTSADVSATPTIVVS
FT                   KTTHPSEQNEQQQSLATGFSQATNDNDDDATADMYYDEDSQGERVARSKKRDSWFQKLR
FT                   SRSRSAT"
FT   CDS_pept        complement(693462..694628)
FT                   /codon_start=1
FT                   /gene_family="HOG000199510" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082770"
FT                   /locus_tag="AGOS_AFR140C"
FT                   /product="AFR140Cp"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53511.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG053638"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="UniParc:UPI0001DB2B4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q754D0"
FT                   /transl_table=1
FT                   /translation="MSFKGLGKAVVRAPQSIKQRFNVGEQTSDVVYADAERRFKDLETE
FT                   TQKLGTEAKRYFAAVNGMLQHQISFAQAMEEIFKPISGVMSDPTAVLPEDNPKGIEASE
FT                   QYRSIVNELQSVLSPDLELIEDKVVQPVQDLLKIIGTVRKMATKRNHKKLDLDRRLNTH
FT                   RKYESKRERSPKDDEKLYKAEAELQVARQEYDYYNDLLKTELPQLFALQAEFVRPLFVS
FT                   FYYMQLNIFYTLHNAMQDLRIPYFDLASDIVARFEAKRGNVEEQADALTITHFRVGYSR
FT                   NKLELTKRRYGSEASPSPTATFRSTPLDPPAYSEPSYGSSSASPATTAAPETCIALYDF
FT                   AAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREGLFPANYVALKH"
FT   CDS_pept        complement(694802..696616)
FT                   /codon_start=1
FT                   /gene_family="HOG000248281" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763679"
FT                   /gene_name="MUS81"
FT                   /locus_tag="AFR141C"
FT                   /product="Crossover junction endonuclease MUS81 "
FT                   /EC_number="3.1.22.-"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /function="metal ion binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /biological_process="meiosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53512.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG053750"
FT                   /db_xref="HOGENOM:HBG398626"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR020819"
FT                   /db_xref="UniParc:UPI0000253096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754C9"
FT                   /transl_table=1
FT                   /translation="MSAKQLGDLKPLFIEWLKDEIDACGPRQEKMAMVYFRARESLKRF
FT                   DQPITETAKVLKVKGIGNSIKNKLASKLAQYCQDNNIPLEDAAAPSHVVGISVTRVRTA
FT                   TQEKDDQSPKRKKRKYVPRKRSGAYAILLGALELGCPSRGLTKEEIIDAAAKYCDVSFV
FT                   SNPLTREFYSAWTAIKVLIDHDLMLEQGRPRRYIVTEAGEQMAETLKHADSVIFPEDCP
FT                   YQRRQQAPESTAEDHTELSASLSELVRQEHLPQNHSGMCFSFEPPSSAPSDYLDPGQKS
FT                   ANVASSPHRLRPPIGPSIDIVKARWNGTSYELWKPGSYDIELYIDHREVRAKSERDFFV
FT                   NALLTRGVTVEGKALALGDMVWVARHRDSRSTCVLNFMLERKRLDDLAMSIRDNRFMEQ
FT                   KNRLKKTGCKHIFYLVEETSGTNVAGMEGAIKTSIWMTYVYSGFHVKRTRNADDTVEWL
FT                   HDMTCTVQRYYCSKSLLVLRPREIANQEDYGSLLSAFRLQFERNNTSLECCHAFDCYQE
FT                   VLGKTGLMTVKELYIRTLMLNRGVSLEKALAIQSKFPTLRSLMTAFRNCKSEEDGRRML
FT                   YLALLDQPASRRVGKALAATLWDTFGRR"
FT   CDS_pept        complement(696874..699402)
FT                   /codon_start=1
FT                   /gene_family="HOG000231589" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763680"
FT                   /gene_name="EFT1"
FT                   /locus_tag="AFR142C"
FT                   /product="Elongation factor 2 "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53513.1"
FT                   /db_xref="EMBL:AAT12544.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG156268"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0000253097"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754C8"
FT                   /transl_table=1
FT                   /translation="MVAFTVDQIRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGI
FT                   ISAAKAGEARFTDTRKDEQERGITIKSTAISLFSEMSEEDVKDIKQKTEGNSFLINLID
FT                   SPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQALGERIKPVVVINKVDRA
FT                   LLELQVSKEDLYQSFSRTVESVNVIISTYADEVLGDVQVYPQKGTVAFGSGLHGWAFTI
FT                   RQFANRYSKKFGVDREKMMERLWGDSYFNPKTKKWTNKDRDADGKPLERAFNMFVLDPI
FT                   FRLFAAIMNFKKDEIPVLLEKLEIALKSDERDLEGKALLKVVMRKFLPAADALLEMIIM
FT                   HLPSPVTAQNYRAEQLYEGPSDDPACIAIKNCDPKADLMLYVSKMVPTSDKGRFYAFGR
FT                   VFSGTVKSGQKVRIQGPSFTVGKKEDLFIKAIQRAVLMMGRFVEPIDDCPAGNIVGLVG
FT                   IDQFLLKTGTLTTFESAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGLKRLSKSDPC
FT                   VLTYMSESGEHIVAGTGELHLEICLQDLENDHAGIPLKISPPVVAYRETVEGESSQVAL
FT                   SKSPNKHNRIYLKAQPIDEEVSLAIEGGKINPRDDFKARARVMADEYGWDVTDARKIWC
FT                   FGPDGNGPNLVVDQTKAVQYLNEIKDSVVSAFQWATKEGPIFGEQMRSVRINLLDVTLH
FT                   ADAIHRGAGQIMPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAVGGIYSVLNRKRGQ
FT                   VVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWATLGTDPLDPT
FT                   TKAGEIVVEARKRHGLKENVPGWQEYYDKL"
FT   CDS_pept        complement(699602..701182)
FT                   /codon_start=1
FT                   /gene_family="HOG000172935" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763681"
FT                   /locus_tag="AGOS_AFR143C"
FT                   /product="AFR143Cp"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /cellular_component="retromer complex, outer shell "
FT                   /protein_id="AAS53514.2"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0030905"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG055316"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR014461"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI0001DB2B5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q754C7"
FT                   /transl_table=1
FT                   /translation="MASVMPFDPYDDDVDNNPFAEEAPQAGALVEAEASGEASREAAGE
FT                   ASSEGAADTGDKSVVPPLADLLPERHQDKYHLVAKVTGLERVGTLAHRRECPTVLFDVS
FT                   TNLPTFRKSQHKGLKKTYEEFQEVFKYLSGAVPETFVPALPPPSTSYGINNPEDTHKTM
FT                   ANFNRWLERVCADPLLVRNEELAFFMESDFNTYTPMNKSRAPASGLLRKTMKQRPPPYD
FT                   EVTELAEFRPLVKSIYVVAQDVQAKLLRMTKTRKQLSHEESAFGQSFHQLTVEHDGHSR
FT                   LYQRFGKVLTAVGDLDSIMATFDMATLYDSLEWVVRDAYVVKETLTDRHFLMRDLLQAQ
FT                   SCTRLKQDAARRLRAKRDISPLKVDDAIQQLKLATKTEHDLSRRLQRVTANMRIERSRW
FT                   VDNLSNSLLAAVREYTLRKIEYERKKLSLLERVRADVRLVDTQGGLSRLGRHQLVASPL
FT                   PTPSQSLSHGDSWTSDRRASHCLSSSDLEPHLLQGLDSPSPGAFRDSPDISGPLDARQA
FT                   ATILGTSTF"
FT   CDS_pept        701953..702735
FT                   /codon_start=1
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625876"
FT                   /locus_tag="AFR144W"
FT                   /orf_name="AGOS_AFR144W"
FT                   /product="AFR144Wp"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS53515.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG191130"
FT                   /db_xref="HOGENOM:HBG736287"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI0000253099"
FT                   /db_xref="UniProtKB/TrEMBL:Q754C6"
FT                   /transl_table=1
FT                   /translation="MDTVGSQDLEKAGMREGSSCKTQECVETLEDRVTSVGLEGDYVRL
FT                   GTQLFRRQDLQAALGTFRAPLADPVPLGLSSFSFSCMILGLYNAEVLGVTNHQLLVGVA
FT                   FFLGGLAQLLAGLLSFAVGNTFGLTVFSIFGSFWFCQGAIITNSFGVLQSFEQDPEMLR
FT                   NATGLFQLCWFVFTFLMLLCSLKSSWSLFALLVTLDLTFLLLAIGNFSNNPVLGRAAGW
FT                   TGFVSSICGWYTLYAEMSNLGNTYLPLPKLHMPHSMVA"
FT   tRNA            complement(702906..702977)
FT                   /gene_name="tRNA-Asp"
FT   CDS_pept        complement(703202..703528)
FT                   /codon_start=1
FT                   /gene_family="HOG000229897" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763682"
FT                   /locus_tag="AFR145C"
FT                   /orf_name="AGOS_AFR145C"
FT                   /product="AFR145Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS53516.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="HOGENOM:HBG351554"
FT                   /db_xref="HOGENOM:HBG744999"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniParc:UPI000025309A"
FT                   /db_xref="UniProtKB/TrEMBL:Q754C5"
FT                   /transl_table=1
FT                   /translation="MKYLAAYLLLLQGGNDAPSAADIKSLIESVGVEVEDAKISTLLAS
FT                   LEGKSIEELIAEGQKKFASVPAGGAAPAGGASAAAGASEAAAEEAKEEAKEESDDDMGF
FT                   GLFD"
FT   CDS_pept        703820..704665
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931400"
FT                   /locus_tag="AFR146W"
FT                   /orf_name="AGOS_AFR146W"
FT                   /product="AFR146Wp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS53517.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000025309B"
FT                   /db_xref="UniProtKB/TrEMBL:Q754C4"
FT                   /transl_table=1
FT                   /translation="MSEDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFP
FT                   TTWSCVSHTYKQEGLWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEK
FT                   VVFAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLW
FT                   QGQSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFP
FT                   ADTVKSTMQTEHLGLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYESLCGL
FT                   "
FT   CDS_pept        complement(704686..705633)
FT                   /codon_start=1
FT                   /gene_family="HOG000159426" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763683"
FT                   /locus_tag="AGOS_AFR147C"
FT                   /product="AFR147Cp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53518.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001DB2B5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q754C3"
FT                   /transl_table=1
FT                   /translation="MTAQPSNTANPAEVDELVHAVAGAGGGALSMALTMPLVTLATRMQ
FT                   VSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYAGLESAMYGMAVNSFIYYYFYELAARA
FT                   TMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSEQSTLAVLLDIVRK
FT                   DGVTALFNGLRPALMLVSNPIIQYTVFEQLKNVVLKWSGSDVLLPSWAFLLGAVGKLAA
FT                   TGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVKKEGIQGLYHGIGVKLTQSILT
FT                   AAFLFYFKEGFILWAVKLISTLRRYSSRRKAVSV"
FT   CDS_pept        join(706096..706102,706167..706438)
FT                   /codon_start=1
FT                   /gene_family="HOG000111196" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931401"
FT                   /locus_tag="AFR148W"
FT                   /orf_name="AGOS_AFR148W"
FT                   /product="AFR148Wp"
FT                   /protein_id="AAS53519.1"
FT                   /db_xref="HOGENOM:HBG059413"
FT                   /db_xref="HOGENOM:HBG203276"
FT                   /db_xref="UniParc:UPI000025309D"
FT                   /db_xref="UniProtKB/TrEMBL:Q754C2"
FT                   /transl_table=1
FT                   /translation="MSCYLSAGAVAMVLLTKTIIRNRKDKQFLPAARQLGDGTEVEDPY
FT                   GNIAAIKPGFPMQQEQRPRKSEFEGAGLSYRTRKSGDRLGFFDRRQE"
FT   CDS_pept        join(complement(707472..707720),complement(706527..706940))
FT                   /codon_start=1
FT                   /gene_family="HOG000177542" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082771"
FT                   /locus_tag="AFR149C"
FT                   /orf_name="AGOS_AFR149C"
FT                   /product="AFR149Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS53520.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG059414"
FT                   /db_xref="HOGENOM:HBG396717"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000025309E"
FT                   /db_xref="UniProtKB/TrEMBL:Q754C1"
FT                   /transl_table=1
FT                   /translation="MSANLDKALDEIIDSQKKPVRRPNKNAPRKVAKSVTAGRRRGPAA
FT                   GVRKSVPVERATSMLEAAYATKVNVEGLPRDIKEDAVRDFFRSSVGGLQRVLLSYNERG
FT                   NSTGMATLTFANAEKAREAVKKFNGAPIDGGKSRLRLNLIVDPTRKPLAARIAPVAKGP
FT                   ERSLRVARPDPAVRRDTRAPTKKAVAAKAQKRKPKPQKKSLEQLDQEMADYFDEAKK"
FT   CDS_pept        708468..708668
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059041"
FT                   /locus_tag="AGOS_AFR149WA"
FT                   /product="AFR149W-Ap"
FT                   /protein_id="ADJ41789.1"
FT                   /db_xref="UniParc:UPI0001DB2B5E"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGE0"
FT                   /transl_table=1
FT                   /translation="MSKRSPNTPISGLQKKLKMSPPPSAALAGSSSAEKFRRQLLVMGF
FT                   ELQRVRELNQFLEWERQMQVE"
FT   CDS_pept        complement(708723..709772)
FT                   /codon_start=1
FT                   /gene_family="HOG000111296" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763684"
FT                   /locus_tag="AFR150C"
FT                   /orf_name="AGOS_AFR150C"
FT                   /product="AFR150Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53521.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG123862"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000025309F"
FT                   /db_xref="UniProtKB/TrEMBL:Q754C0"
FT                   /transl_table=1
FT                   /translation="MAKHIPVKVLCTTRYARIQLLEDGSVAKSVKIESQCAPHDVETEL
FT                   RILQACQHSNIIPVLSATVEGGIVKICMPYVKTDLYAFMRQHYGGKHLAYLMPCLDSEA
FT                   RGRRAQKNRLSMARTMHVCSQLADALAYLHGLGVIHRDIKPQNVLVDSNDHVYVIDFGV
FT                   CYDTAQRGPRRYGETDDSKIPDVSTSIYKAPELMFSVRNYGLPVDVWSLAVTFSQLFQR
FT                   YETPQGGIAAFVDDGAEELETGTDIRAVMSIFQQLGIPSQEQWPQVVRYGSSGFVGMFG
FT                   TEGDGNYIFDKPWPEQLAKVEQLFPRLAEVSQHEELARMLLGMLHFDTQKRIPASHVAA
FT                   TLRTFAQLQ"
FT   CDS_pept        complement(710030..711085)
FT                   /codon_start=1
FT                   /gene_family="HOG000200579" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082772"
FT                   /gene_name="ERG3"
FT                   /locus_tag="AFR151C"
FT                   /product="C-5 sterol desaturase "
FT                   /EC_number="1.3.3.-"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="sterol biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53522.2"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016126"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG028850"
FT                   /db_xref="HOGENOM:HBG559159"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI0001DB2B5F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q754B9"
FT                   /transl_table=1
FT                   /translation="MDLVLEFCDSYFFDYVYATLLPASLSPKMGGTWQQAMIKEQMVNA
FT                   TRVFGRSLERPLEVYGYAPFMFEVSPHAFGSVLPRYSLLRQSLSLFLVTTVFGWLLYLI
FT                   VASFSYVFVFDKSVFNHPRYLKNQMSMEIKQGLGAIPYMAVMTVPWFLLELHGYSHLYM
FT                   GLELNVRGYVRLALEALFFILFTDFGIYLLHRWLHWPAVYKVLHKKHHKWLVCTPFASH
FT                   AFHPIDGYLQSLPYHLFPMLFPLHKVSYLVLFTFVNVWTVMIHDGEYLSNDPVINGAAC
FT                   HTVHHLYFNYNYGQFTTLWDRLGGSYREPDHELFDSNLKKDKAVWEQQIKEVDEMIKNV
FT                   EGPADDRVYER"
FT   CDS_pept        complement(711433..712245)
FT                   /codon_start=1
FT                   /gene_family="HOG000200636" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082773"
FT                   /locus_tag="AFR152C"
FT                   /orf_name="AGOS_AFR152C"
FT                   /product="AFR152Cp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="AAS53523.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG316888"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="UniParc:UPI00002530A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q754B8"
FT                   /transl_table=1
FT                   /translation="MDTSQAVEVTGLSYKFPHAEEESLTDVNLVLPWRKRMLLCGSNGA
FT                   GKSTLLKLLSGKHLCRSGNIRVDGRDPFAPANTADPADVMVTAYLGTEWCHMAIVHRDI
FT                   GVQELLDSIGLQHFRERGTELLRILDVDLRWRMHRLSDGQKRRVQLCMGLLKPFKLLLL
FT                   DEVTVDLDVVARTKLLHFLRLETERRECSIIYATHIFDGLADWPDRVVHIAHGRVLADL
FT                   DVARDVSFAADRTDVVEAAGRVRIGHVRSLHPLALAWLARDEGKMASE"
FT   CDS_pept        712587..714317
FT                   /codon_start=1
FT                   /gene_family="HOG000173633" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763685"
FT                   /locus_tag="AGOS_AFR153W"
FT                   /product="AFR153Wp"
FT                   /protein_id="AAS53524.2"
FT                   /db_xref="HOGENOM:HBG059415"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001DB2B60"
FT                   /db_xref="UniProtKB/TrEMBL:Q754B7"
FT                   /transl_table=1
FT                   /translation="MDEVDDILNQNQVEEEEDDEDDLDEEIADVADPANGNDEEGQDDD
FT                   EEQEHNMDEDEDEDDDAEEEDMEDEDEDMEDEDEDEDEDEDGDNADLNGNSYSKVGSSK
FT                   TTPEVETSRTSAYDKIHMYYSELARNAVLASDYSITPTAAIPIQTHVHSITMSKGLKYL
FT                   FLGGQDGYIRKFDFLNTIEGKLSLTILQKHSLVESISNAGIMLSYWENEVPQAQKDMKL
FT                   TKNGKEYEPKVSPVHSLEVHSECLYILAGQEGGGITLQGVRYMEGQIGHYFKKHTSTVN
FT                   QLLLNDDETRFVSGSWDKQILDWDLHTGHCITEFKGVPAQISTLSFRPRYSTVELSSLV
FT                   STDEESKLKADSSRADDDMDSLFGEDDEEQPPKSREKALSRDASFAKEADIKTSMSDAR
FT                   DVLSKYSLRTRMDENALLSSCISGTIQLWDRRAGSGPQLTLPRDKATPPWCMSACWSHD
FT                   GDRIYAGRRNATVDEYDLRYTLRASKTLKLPKISGPVSAVQALPNGKHILCASQDNIRI
FT                   YDVTSSTSTPFLIVPGHHGGTISNMYVDPTCRFLISTSGNRGWQGTSTDTTLIYDIDLE
FT                   "
FT   CDS_pept        complement(714686..716338)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625877"
FT                   /locus_tag="AFR154C"
FT                   /orf_name="AGOS_AFR154C"
FT                   /product="AFR154Cp"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS53525.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG059416"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI00002530A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q754B6"
FT                   /transl_table=1
FT                   /translation="MIILGALSGAGRGAIRTITATVGPDSHKEARDHGYGRTMSDSLFS
FT                   SCDNISLTDSVFDHRSLTYFSNDEQRQLKLQIMQSCGASDQWEGRQKNLQLGVSRNGFV
FT                   SHSLRRHFWHCILRGRVRVCPRAGVSEHPDEHQMELDVRRSFGFVENEGQKQKLRELLQ
FT                   ATLVRFFRKYPSLRYYQGYHDVVSVILMVYYDALESDQFSTLQGSADDLLSSSVASSMS
FT                   EATVLPDESTQSTVDTMFEVVEMFSLLYLRDFMMDSLDFTIDQLQVIPQLIKIRDVELF
FT                   RQLHLDQVSPFFALSSILTIFSHDLKPCKNQLSPLYQIFDLVITSGNMMAPLVIYMELI
FT                   VEHKEDLLRECDAQSDLFENITDLVHGAMQQVMQREQTTEQWQDVLERGRLFLEDHPLA
FT                   ATSSEVRKFRWLNPYSVLKENPGDGANYSLSELLDIVEREIAENERRKSMALASDALRN
FT                   RIKNIRRICRSLVYFGSLWRWPIYIGIFALLIRVYSANFRELRPINIWYVLSSVLSGDS
FT                   PITGIPFSFRLPGVGTKTWFLDPLRSLLPSSAR"
FT   CDS_pept        716650..718341
FT                   /codon_start=1
FT                   /gene_family="HOG000076290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625878"
FT                   /locus_tag="AGOS_AFR155W"
FT                   /product="AFR155Wp"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein refolding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS53526.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0042026"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="UniParc:UPI0001DB2B61"
FT                   /db_xref="UniProtKB/TrEMBL:Q754B5"
FT                   /transl_table=1
FT                   /translation="MLRSSGTKSVLRGLRFYSHKELKFGVEGRAALLRGVETLADAVSA
FT                   TLGPKGRNVLIEQQFGAPKITKDGVTVARAITLEDHFENMGAKLLQEVASKTNEAAGDG
FT                   TTSATVLGRAIFTESVKNVAAGCNPMDLRRGTQAAVEKVIEFLSKNKKEITTSAEIAQV
FT                   ATISANGDSHVGKLLASAMEKVGKEGVITIKEGRTLEDELEVTEGMRFDRGFISPYFIT
FT                   DAKANKVEFEKPLLLLSEKKISSIQDIIPALEISNQSRRPLLIIAEDIDGEALAACILN
FT                   KLRGQVQVCAVKAPGFGDNRKNTLGDIAVLTGGTVFTEELDLKPENATLQHLGSADSIT
FT                   ITKEDTVVLNGNGTKENIEARIEQIRNSIDLTTTNSYEKEKLQERLAKLSGGVAVIRVG
FT                   GASEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALLKATRVLDEVKTENFDQKLGVD
FT                   IIRRAIAQPARKIIENAGEEGAVIVGKIIDDFGEDFTKGYDAAKGEYTDMLAAGIIDPF
FT                   KVVRSGIVDASGVASLLATTEVAIVDAPKPANAAPPAGMPGMPGMM"
FT   CDS_pept        719061..720737
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625879"
FT                   /locus_tag="AGOS_AFR156W"
FT                   /product="AFR156Wp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53527.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001DB2B62"
FT                   /db_xref="UniProtKB/TrEMBL:Q754B4"
FT                   /transl_table=1
FT                   /translation="MADRASSASIEKADNGGYMHKVKTPHSRTSLEELETQSAGSEYNT
FT                   LHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAE
FT                   MICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPM
FT                   AAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTG
FT                   FRYWKNPGPFAMSLAPGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEK
FT                   ASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVL
FT                   DHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLV
FT                   ACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAYIRFRRGIVFNNLQSRIPYQGP
FT                   LQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTR
FT                   WYIPVEQIDVITGLVEAEEESKMTPPRIPKNLWEKFLYWLL"
FT   CDS_pept        join(720875..720929,720981..721378)
FT                   /codon_start=1
FT                   /gene_family="HOG000061063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082774"
FT                   /locus_tag="AFR157W"
FT                   /orf_name="AGOS_AFR157W"
FT                   /product="AFR157Wp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS53528.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG123543"
FT                   /db_xref="HOGENOM:HBG743217"
FT                   /db_xref="HSSP:1AV5"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniParc:UPI00002530A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q754B3"
FT                   /transl_table=1
FT                   /translation="MASAVAHDAACVFCKIIKGEIPSFKLMETAHSYAFLDIQPTAEGH
FT                   TLIIPKYHGAKLHNVPDEYLADILPVTRKLVKALGCDNDGPTGPGYNVLQNNGRLAHQE
FT                   VDHVHFHLIPKRNAVSGLGVGWPAAPADMESLKHVHKTLSGRLQSL"
FT   CDS_pept        721630..724128
FT                   /codon_start=1
FT                   /gene_family="HOG000223224" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778419"
FT                   /locus_tag="AGOS_AFR158W"
FT                   /product="AFR158Wp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAS53529.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniParc:UPI0001DB2B63"
FT                   /db_xref="UniProtKB/TrEMBL:Q754B2"
FT                   /transl_table=1
FT                   /translation="MVKDEHKRLLDASGTEPRDEDATATAILKRKKKDNYLLVDDAVKD
FT                   DNSVIVVNSNTMDLLQLFRGDTVLVKGKMRKDTVLIVLLDDELADGVCRINRVVRNNLR
FT                   VRLGDLVSIHPCPDIKYAERISVLPIADTIEGLTGNLFDVYLKPYFVEAYRPVRKGDHF
FT                   IVRGSMRQVEFKVVDVEPEDYAVVAQDTIIHSDGEPINREDEENNINEVGYDDIGGCRK
FT                   QMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVANETGAFFFLIN
FT                   GPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLL
FT                   TLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILNIHTKNM
FT                   RLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREKMSLIDLDEDEIDAEVLDSLGV
FT                   TMDNFRFALGNSNPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKF
FT                   GLSPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDK
FT                   ARAAAPTVVFLDELDSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATN
FT                   RPDQIDPAILRPGRLDQLIYVPLPDEAGRMSILKAQLRKAPLEPGLDLGAIAKATQGFS
FT                   GADLSYIVQRAAKFAIRDSIEAQKRAEAERADKPKTEDVEMSDANVASEEEVDAVPFIT
FT                   REHFADAMKTAKRSVSDAELRRYEAYAQQMKASRGQFGNFSFGSEARSDSGAGAAPAGT
FT                   ESSGAAAFNNAADEDDDLYS"
FT   CDS_pept        complement(724500..725426)
FT                   /codon_start=1
FT                   /gene_family="HOG000000866" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778420"
FT                   /locus_tag="AFR159C"
FT                   /orf_name="AGOS_AFR159C"
FT                   /product="AFR159Cp"
FT                   /function="protein kinase binding"
FT                   /biological_process="regulation of cell division "
FT                   /biological_process="regulation of cyclin-dependent protein
FT                   kinase activity"
FT                   /protein_id="AAS53530.1"
FT                   /db_xref="GO:0000079"
FT                   /db_xref="GO:0019901"
FT                   /db_xref="GO:0051302"
FT                   /db_xref="HOGENOM:HBG192607"
FT                   /db_xref="HOGENOM:HBG203067"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI00002530A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q754H9"
FT                   /transl_table=1
FT                   /translation="MSDYEALLRFNKMPVSVEMVHFLASTTASIIQVRSEGNSEHILSL
FT                   VDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIETSRHRMFLGCLILAAKNLN
FT                   DSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISCLSHFLNPIRDSF
FT                   IRGEQRSHLLFHVPLTGQTKQFILQNGDVYSSSSSNMSIPSLVSSRTISTISTNGSRCT
FT                   ARSALAAHQAVTMECIQEERLPKLHLREANITSTQCPRKGLTRPVILQPKLNTFYDGAH
FT                   SINGTSDGANVGAYRTLKNAGWTALFS"
FT   CDS_pept        complement(726122..727333)
FT                   /codon_start=1
FT                   /gene_family="HOG000083011" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082775"
FT                   /locus_tag="AGOS_AFR160C"
FT                   /product="AFR160Cp"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53531.2"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG328108"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI0001DB2B64"
FT                   /db_xref="UniProtKB/TrEMBL:Q754H5"
FT                   /transl_table=1
FT                   /translation="MDTQTPLLDRRRRRATGGVAARLGRDLRVVFHSSPVNYLLVFVPL
FT                   GLALGYAGASAGWVFSVNFLAIIPLAAILAFATEELAEHVGSTLGGLLNATLGNAVELI
FT                   VSVIALRRGQVRIVQASMLGSLLSNLLLVLGFCFLFGGINGGQQKFNQTAAQTMSSLLV
FT                   ISCASLLIPAAFKATLPSETEEQSVIIGDKLLKLSRGTSMVLLVVYVLFLCFQLLTHHE
FT                   MFEQQEEAVVETYEPRHAQLSVRSSLGYLLASTVLVSLAADFLVDSIDDIVESTGLSKT
FT                   FIGLIVIPIVGNAAEHVTSVIVAMKNNMSLALSVAIGSSLQISLFVTPFMVLIGWWINV
FT                   PMTLNFSTFETATLFTSVFLSNYLILDGESNWLEGVMSLAMYALISLAFFYYPDEEAIA
FT                   SVLA"
FT   CDS_pept        complement(727767..729050)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763686"
FT                   /locus_tag="AFR161C"
FT                   /orf_name="AGOS_AFR161C"
FT                   /product="AFR161Cp"
FT                   /protein_id="AAS53532.1"
FT                   /db_xref="HOGENOM:HBG059417"
FT                   /db_xref="UniParc:UPI00002530AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q754B1"
FT                   /transl_table=1
FT                   /translation="MTRIGYWGAYYMPVLLDSSPYAPAAALVGAAAAIAAAGAGAGLLG
FT                   AAAGPFEPNAQDYFRTALLGFLPPVLVHCIKTFVLGTDGSATLVELLVDYPLSDALMAA
FT                   LLAALAYPQVHQAASADGGWCLTPRQSYVFGLSWALNELLLAVLGSLNDYVEEPHGLII
FT                   HAPDAQSEELSSLRRSISLSRCMNVRRQASRISDNIYQPPPRASHSYGSLAPARADDDL
FT                   VVLAFTGDSPDADGVCPSLRHRAHPHSGAPLYFAPAASWHAFSRRLLLASLIVLAHLLQ
FT                   AAGQALLMSLYFLYVPDSDARLARLVLYFGGHSFAFFAAVLLLPFSLANFACHLLLLTW
FT                   KDDRAVLLARPHSHEPDSLLPSPATDSPVGACVLSPFHARLASHRLCRRTLQSWRALAS
FT                   RRGASPVGALCWALAVFAAGVCAARPPT"
FT   CDS_pept        complement(729371..730453)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763687"
FT                   /locus_tag="AFR162C"
FT                   /orf_name="AGOS_AFR162C"
FT                   /product="AFR162Cp"
FT                   /protein_id="AAS53533.1"
FT                   /db_xref="HOGENOM:HBG059418"
FT                   /db_xref="UniParc:UPI00002530AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q754B0"
FT                   /transl_table=1
FT                   /translation="MRAELHLAGTRKHRPSSSAPIPTTPVSRSRSSLPPDTEHISASRD
FT                   LLKPVRSTVTARREPVPADALTVESPPVAPGSPKAIPLLVVPSPLRTPPPLAQHSCAAR
FT                   EGSSPPRYPPCPPSPPLRATSRKSNPPTEDMTTCHLHEQPAMGRRPVNRTSTLQAIITP
FT                   EEPARLPEDADKPSGGCSKPEPPAADSLPVRLPGTPEAPAHLLGATKDLKMHIIRVMDK
FT                   LKAGDQQELPREELLAVLDCSLSAISHWSLQAQLAQLSQSKSVWDSRLLVENNLIKKEA
FT                   EFFKKRLEQAGRSAGTEPASAGRVAKRPLAQTPRKRQALLDSPQGYKLVENTKPHPRMR
FT                   RHMDNPSTSGFVRVFHLERL"
FT   CDS_pept        join(complement(731398..731511),complement(731139..731342))
FT                   /codon_start=1
FT                   /gene_family="HOG000229898" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763688"
FT                   /locus_tag="AFR163C"
FT                   /orf_name="AGOS_AFR163C"
FT                   /product="AFR163Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS53534.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="HOGENOM:HBG351554"
FT                   /db_xref="HOGENOM:HBG631105"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniParc:UPI00002530AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q754A9"
FT                   /transl_table=1
FT                   /translation="MSDAIISYAALILADAGLDITSDNLLSLTKAAGASVDNVWAEIFA
FT                   KALEGKDVKEVLSGFHAAGASAGAASGAAASGAAAEAAAEEAAEEAAEESDDDMGFGLF
FT                   D"
FT   tRNA            complement(731674..731745)
FT                   /gene_name="tRNA-Glu"
FT   tRNA            join(733050..733086,733106..733150)
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        733270..733884
FT                   /codon_start=1
FT                   /gene_family="HOG000141971" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763689"
FT                   /locus_tag="AFR164W"
FT                   /orf_name="AGOS_AFR164W"
FT                   /product="AFR164Wp"
FT                   /function="tRNA binding"
FT                   /protein_id="AAS53535.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="HOGENOM:HBG059419"
FT                   /db_xref="HOGENOM:HBG103732"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00002530AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q754A8"
FT                   /transl_table=1
FT                   /translation="MNLCFRTLPKLMARSMTTVPSGQLPYSLADIRIGKVLSVREHPES
FT                   YKMYITQVSFGGLGTKQICTGLRDHVPTSEMQDSLVVVLNNIKKCKLRGEVSEAMILCA
FT                   EYSPQESKPSVQLLQPAISSPEFCGARVLVGDLLGKEVAPTCRRIKPAEWEELSSRLYV
FT                   DNSGRVVLQSEGKELPLYVRDNIGSLHYIMASSMPTGSQVR"
FT   tRNA            join(complement(734048..734085),complement(733975..734018))
FT                   /gene_name="tRNA-Leu"
FT   CDS_pept        complement(735621..736232)
FT                   /codon_start=1
FT                   /gene_family="HOG000160229" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763690"
FT                   /locus_tag="AFR165C"
FT                   /orf_name="AGOS_AFR165C"
FT                   /product="AFR165Cp"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS53536.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG333344"
FT                   /db_xref="HOGENOM:HBG372468"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI00002530AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q754A7"
FT                   /transl_table=1
FT                   /translation="MRIAATFSLLFLAIFQVSWAHNVLLPPYGRRCFFEQLKGGDVLTI
FT                   TYQFGDRDPQSHQQLSGDLLVYGIDGRSVLDAQRASSHGELTLKAPTDGKYQYCFANDN
FT                   SGYLTKDVTFNTYGVLSPDAADSSSETLEGAVRKLSMLTMEVMNEQQYIEIRERTHRNT
FT                   AESTNDRVKWWSIFQLAVVVAQSLFQVYYLRSFFEVTSYV"
FT   CDS_pept        join(complement(738819..739001),complement(737857..738618))
FT                   /codon_start=1
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763691"
FT                   /locus_tag="AGOS_AFR166C"
FT                   /product="AFR166Cp"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAS53537.2"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG488218"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI0001DB2B65"
FT                   /db_xref="UniProtKB/TrEMBL:Q754A6"
FT                   /transl_table=1
FT                   /translation="MSMETPPVDIDNIIDRLLEVRGSKPGQQVDLEEHEIRYLCSKARS
FT                   IFIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLET
FT                   ICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIA
FT                   AIIDEKIFCMHGGLSPDLNTMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDR
FT                   GVSFTFGPDVVSRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAG
FT                   AMMSVDESLLCSFQILKPAVKPSAGRGQPKKKK"
FT   ncRNA           739463..739497
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR52"
FT                   /product="AgSNR52"
FT   CDS_pept        739516..740136
FT                   /codon_start=1
FT                   /gene_family="HOG000000919" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778421"
FT                   /locus_tag="AFR167W"
FT                   /orf_name="AGOS_AFR167W"
FT                   /product="AFR167Wp"
FT                   /protein_id="AAS53538.1"
FT                   /db_xref="HOGENOM:HBG059420"
FT                   /db_xref="HOGENOM:HBG204454"
FT                   /db_xref="UniParc:UPI00002530B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q754A5"
FT                   /transl_table=1
FT                   /translation="MSDEIEADGSVRGAPRDTGRGTLDESAAATLVRDVRAMHARLRQA
FT                   VYPALRSGWQPVADGPPETDLWAPLVFVLAQAALLARGGGHFYALFVVHWGVLALLAAH
FT                   LKLMRVGEKRSWLVYVSACGYCLFPLVMASLLSRLGYPTLLLFFAAGPWRVRALYCLRL
FT                   GGFLLSSLWAHASACAVASCVGFIECYPLALCLAGLSWLSVVV"
FT   CDS_pept        740358..745100
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778422"
FT                   /locus_tag="AGOS_AFR168W"
FT                   /product="AFR168Wp"
FT                   /protein_id="AAS53539.2"
FT                   /db_xref="HOGENOM:HBG124462"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI0001DB2B66"
FT                   /db_xref="UniProtKB/TrEMBL:Q754A4"
FT                   /transl_table=1
FT                   /translation="MPLILPSAGNCFPLRLPKLDAGQLQDLDERAQKRLLLECRTGAAV
FT                   ALGRSSLFVYGGLTIPLNLPEVTLVQIQQELILHFARCKTANYLNLCEYISQEVFSLDL
FT                   LSRRWERVQLAEEEKSGGAGVSAEGPDGTVMRERIFHAMVYCGGCLYVFGGLVASSHSE
FT                   YELVATNELWQLDMRTKVWTLLSDDPRVQRRFNHELHVLNEFDDHDTHLIIVGGLDNMD
FT                   KKVHKVEVYNVTRGCWESFEDCYPADITNCNTLESACDLHVGQIHSNIDDQPAGLVRGS
FT                   NFGLLVDNEDHVPTLAFYSAPETNKTRDSSCWENPIVMMPLLPNARGKRTKVHMPSKAS
FT                   IRRLKMLFDLSFVSGILFGPNIIIIGFHAGLLGSNFYAFLYSIPLGKWTHLNINCPHSG
FT                   MRRHRYWSLFHWESHHKALLLGTYEDDSNLPTVQKFDRMLAIRLQNAFPTVKSLLSDGV
FT                   GIRVKIARTHSGQGFTSQKDAFKKTEQFESYSRYIVPPSEITSIRSVFPSYASVLGKDA
FT                   LEVYGKSLADFEFITLEGDSVSIPSLLLRKRWGRFFDHILAQDYSKLSSSVDHVQFEKS
FT                   VDGSNSDSSTNIANQLANPSTEGRDQHAPESQVSSENVPRLNFGLRSNVATGSAMLNKK
FT                   SVSLILNPTWRLSPSVSGLALNIQEQESKEEPSDPLSEETINESGAKGASLTSSSGGMV
FT                   FRVPFTESSESLKQRENSQPAPSIHLELADYSPQSKKSLSTSTDKRRRSSYTAGSHWKQ
FT                   VKASGYRRASHPIGNIRDLLYGADRTTSSPLNSRRGSAVSNTSSISYVSSSSERLSNRH
FT                   CKRDSEDSSSGTLTFNINLPPQQPPPTDPLPTLPLNITGEYQYSNRRESEHSLVGIPRS
FT                   LKSSPSSSRCSSSFNEFDTKFRQYTLAERGRESTTGPHAPPIQFNPVMESGEKLFYKET
FT                   ELDPKQPIARSQTTESFNKSVGDVSRLSLTPTLESYKSQSSLSAALGELEPLLIPRSLY
FT                   LPWPTSSVKAFSEFFYTGQVNSKWPFSPVSLDLLHMAKLYEVPLLYDLTCEVFYSIIGK
FT                   KMVGLIQSVSALKELFLQRVATFLDNDELKINEYTKSHHTFQTLLQLEESIASVDDGYF
FT                   DLKLMQKVSRAFSTSTDGSTDADHDKEFSTTSSCISSPALSPVFGDYLRDSISLPGARS
FT                   HPPTSLRPPGRNQSAFRHRSISSSKKKENIIADFSKVPNRSSPSEGHLMGEAPLSESGG
FT                   HADHIDEDPHVVSDADIEDFDQDLPKINKHDDTGSVKKDPALHECETVRRLDSFDIEME
FT                   GCPSESSSDSDEDETAELGRISNAKLAKLRARNLEEAIDPLDKITTTMDNLNLRYQTPP
FT                   IKTTPDVDPSPNNTLTLESLASRNAPPPMDYVVELILDATVLNNDVLMMVRCENCLSLS
FT                   KWLRSTKKRLFQDISLLDAQISEKGKVRGGSKHSDSSQDHSDLSDRERPSKSPLKLVYK
FT                   KSRPSTPDLKDGPTPASLQHATCSSPKSTCSTHNSRDGTRPEEECRSNWSGRSSAKSST
FT                   SSAVAASGQRMSTVKRTANVAPSSLSATPSYNAAALYKHKKPKEGAGNSAANFSFFNRK
FT                   K"
FT   ncRNA           complement(745290..745340)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR4"
FT                   /product="AgSNR4"
FT   CDS_pept        745556..753571
FT                   /codon_start=1
FT                   /gene_family="HOG000213714" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082776"
FT                   /locus_tag="AGOS_AFR169W"
FT                   /product="AFR169Wp"
FT                   /function="binding"
FT                   /protein_id="AAS53540.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG052842"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR022716"
FT                   /db_xref="UniParc:UPI0001DB2B7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q754A3"
FT                   /transl_table=1
FT                   /translation="MYKWGQIEPVLDKLCYDSQLLVRTPVLKSIHEQLQGGHVKETEQL
FT                   DRISNCMLKTYAIYQDAESKGAVRQILEQVLRMEPVRLDTYLKFISGEVGSKLGTKAFA
FT                   DYMCFLEWLHMFLVFTSSSSSMFHEYARPLVQLHCSVTSGIELGLDNQERGMRAASKQN
FT                   QHRRRIRKSLLQSSTKALVKVLEADEEYKYAALISETLVSQHAQLKLHPCGVVILTGAL
FT                   VNSIMRLVPRQPAHFNVFQGYVDKFGEYLGAEVMLGKNPPTVFCVEVALPTFLHEFVDK
FT                   EFMVKYFVPSMEKCNLRSPEMSFGLAAEIYKLTNPNSIDLMSVFVSSKLMSQTLSAYKS
FT                   TKEAVREATLNATRELLNSLTKETCDQDALQQFVAELFKSMKSNMHVDYKSTVARILTW
FT                   VPTFSELVSNKILEGIHTYVIKESNEAALSLMLDAFLTHLGAVSVAADTYLASLGKGFQ
FT                   EKKLPIRKLWLVSFLSNVECLPAPIIERFEEPLLEFANEVLSKPSKMGPMPLVGLLSFW
FT                   YRLHELQLDHFEAKFLTAVQNATSEEFTSSCLGFTWVYTTLSRVLPAESRLRAVHILEK
FT                   LFPSYPKLIGNSIIEACKELFSDNSLTQVKESLSFRYSTPVFAALSQNIAERDALEVVL
FT                   INMLIVTQCSELPIKQTWAELVMNAKFDPSRLVEKFAKNITDEANKIMLNPLLHDTKLG
FT                   VAAANAVAYSAFINPEAMAPLLSDIISYGLDDMQLARLSSTDIEIWRGQDDQLVVNVLE
FT                   KSNNKQTISKNSKDYETLKWEESIRKKQQIKSGSTKKLTKEEQILVNQQLEKEKSIRAH
FT                   VNNCRLSIKRSIQLISVLTRGAAQINNGAGTWYPIAVNKLLDILHQERFMEIVGSSGTE
FT                   TFLQLSTLVTNSMGTMRYMLGVATLRTCQIPLQADLQESSLSDLISTVLFKAKFASDKK
FT                   PFDATSLAYILPLLIRVLEEGKRVAVLRADKPIGNTEFVEEDKEEEHLLLALEIISSHA
FT                   EAFLDPSIPRGCIVGVLLMLLAVPSKAKLAKDCFMSLCRNISMSPSKDDIKLLLENLMS
FT                   SNSFVRGTILEALDDEFELHPFMDSSPELFICMHDEDTSNSEVAEFIWEFNNFKVSEGM
FT                   LVDLLKFFDQSDSGLRLFVAKSFTAAVLSLMQESTDLFVRALNMLIDLYSTKARPAEAV
FT                   LDEFGLVAVAASEQKDPWQERSTIAITFKHMAHLFSDNNDILTFVKFLAESGPLGDVND
FT                   LVRQEMKEAGIEVIKLHGAKTIEDLIPIFESSLSSASDITVKQNVIILYGSLARHLNVA
FT                   DPRLNIIVERLLVTLDTPSEDVQHAAAVCISPLVPLFQERVGTYVEALFMKLFDSTLSD
FT                   STRRGAAWGIAGLVKGYGISALSKFDIIRNLAEVSEDKKDPKRRESVAYAFECLSKSLN
FT                   KFFEPYVIEVLPNILKNLGDSVPEVRSATAEATKSIMSHTTSYGVKKLIPVAISNLDDM
FT                   SWRTKRGSVELLGNMAYLDPTQLSASLSIIVPEIVGVLNDSHKEVRKAADQALKRFGEV
FT                   IRNPEIQKLVPTLIKAIGDPTAHTEAALDALIQTQFRHYIDGPSLALIIHVIHRGMRDR
FT                   SANTKRKACKIVGNMAILVDTKDLVPYLQQLIDEVEVAMVDPVPQTRATAARALGALVE
FT                   RLGEDQFPDLIPRLLSTLSDDSKSGDRLGSAQALAEVISGLGLSKLDELLPTILNGVTS
FT                   YRAYIREGFMPLLLFLPVCFGSQFAPYINQIIQPILSGLADSDENIRDVAFKAGKLIVK
FT                   NYAKKAIDLLLPELERGMFDENERIRLSSVQLSGDLLFQVTGISAHNEFSEEDADAEHE
FT                   LSGQMVEVLGEERRDRILSALFICRNDSSGIVRATTIDIWKALVPNTPRTIKDILPTLT
FT                   SLVVVHLASSSSTLRHIAAQSLGDLVRRVGGNALSQLLGSLDASLQTNSDQNSRQGVCI
FT                   ALRELISSSNVDSLMEFEDTIVNILRNTLVDESESVRESAALSFDKYQDAVGRVAIDKV
FT                   IPYLLNILESSENSEYALLALQEIISTKSEVIFPILIPSLLAPPMDAFKARAMGSLAEV
FT                   AGVALYKRLSAIINALVNAMIDPEVDETAKESIINAIDKVLSSVSSEDGVHPLLQQIMA
FT                   LLKHANIEKRVVTLGRLPTFFKNTVLDYSIYTADIVSQAILSLDADDERIVKGNFEMLS
FT                   TLVKLQDKQMLERLVKPSLQALQLTGKPGEDLMAFSLPNGPNCILPIFLQGLVYGSSED
FT                   RESSALGIADIVSKTPAANLRPYVTVITGPLIRVVGERSSSDIKAAILYALNVLFSKVP
FT                   QFLRPFIPQLQRTFVKSLSDSTNETLRLRAAKALGTLIQYQPRIDPLVVELVTGAQQAT
FT                   ERGVRTAILKALLEVVSKAGSKISEASKANIIRLVEQEMASTDSKFAVAYAKLLGALSE
FT                   IMSPEEAQTILHEKVLESNFEDATGRFAVLTLNSILRDAPVHVFTADLNQYVDFLVAAT
FT                   DSSNPFISDNGIVAVGKLLLLNGEVKSPHSKVAAEEPFTLEEEQIVKLISQLARCMLRP
FT                   RSSSLDSRFLSLVVVRTLCRYQYASCIAPHLTLLAASTFACLRDTVIPVKLSSEKAYLA
FT                   MFRLVDEKDMDTFNAWSSGTLPDPLPTAVGTTVALRSITDYTRRVGARLAKVERDRIAA
FT                   GGDAETMFSDRYEDESEIWAVGGVDLNTDV"
FT   CDS_pept        complement(753610..753873)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763692"
FT                   /locus_tag="AFR170C"
FT                   /orf_name="AGOS_AFR170C"
FT                   /product="AFR170Cp"
FT                   /protein_id="AAS53541.1"
FT                   /db_xref="HOGENOM:HBG059421"
FT                   /db_xref="UniParc:UPI00002530B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q754A2"
FT                   /transl_table=1
FT                   /translation="MKHMSKEEIVAVLKLASRILAVVLFCNVGFKLVKRHFFPYLYYWL
FT                   MSSSDELYGVLWWQRFSSLEQLIWRLVDYIEINYDIEMPNHV"
FT   CDS_pept        754009..755847
FT                   /codon_start=1
FT                   /gene_family="HOG000141934" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931402"
FT                   /locus_tag="AFR171W"
FT                   /orf_name="AGOS_AFR171W"
FT                   /product="AFR171Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53542.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059422"
FT                   /db_xref="HOGENOM:HBG103832"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI00002530B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q754A1"
FT                   /transl_table=1
FT                   /translation="MDVPEAGRKGVARRSKYSKNGCSECKRRKVKCDETKPACWQCSHL
FT                   GKRCVYMVNNSKIRFKEINVLSLRGRERVTDKKACARNGTGSSDPARVTMREVDNRMDL
FT                   GGMDDPLQTTESQLRVPNYEFHGNWVVQARAGWDAVAQRLYMVPEEELGYLRVFYYKSS
FT                   WWLLPLAVSAETNICNNVLFEQLARINIAEQVTTSYLQSALISVAAKFLYNTTRLVKHR
FT                   EVRQTHLRLVFEQLHREFSRLPEVNIAQGKIESLMLCVLILTLDSSSFDGKSWRIHFSG
FT                   AKNLFSKYGIYCNRLPMEPSQRYLVVLVKSWLAAIEATASLLNSGTLQTDQEIDEIFSL
FT                   GSTDDSAPILREMGLLTNGGYNIFLGYSREALMLLKAVKKFLRDPSADRYNDQFLLITD
FT                   LLQASRKYAVIPNNFGLVNNTACTEMFSIKASAIVRHRGQVYSILDTIQQVQVESLFIT
FT                   FLLKGFHFSQNCMLIQNSANRIWRNIEWMFEESHLSAGEIHSIMAKIADGSVKTYEDFR
FT                   TLNINLAPLYIIKPLLSDFRCMMVHTGIVICSSVLTHRMDIDMIRCKLIAYFQYIVDVL
FT                   GAESGKTSLQYLFSIWRQPSYCSATCLREDVPLPFS"
FT   CDS_pept        complement(755890..757239)
FT                   /codon_start=1
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763693"
FT                   /locus_tag="AFR172C"
FT                   /orf_name="AGOS_AFR172C"
FT                   /product="AFR172Cp"
FT                   /function="histone deacetylase activity"
FT                   /biological_process="histone deacetylation"
FT                   /protein_id="AAS53543.1"
FT                   /db_xref="GO:0004407"
FT                   /db_xref="GO:0016575"
FT                   /db_xref="HOGENOM:HBG396919"
FT                   /db_xref="HOGENOM:HBG460465"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniParc:UPI00002530B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q754A0"
FT                   /transl_table=1
FT                   /translation="MSQTFSYDAKTVNEQPLFEFGASYTPRVSYHYNSRVSQYHYGVRH
FT                   PMKPFRLMLTDHLVSRYGLHKVMDLYETRAATKEEVLAFHAQDYVDFLSHVAPENLNKL
FT                   PRGSLEKFNIGDDCPIFQGLFEYSMLYAGASLDASRKLINGQSEIAINWSGGLHHAKKS
FT                   NPSGFCYVNDIVLAILNLLRYHPRVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYNGE
FT                   FFPGTGDLDEIGCSRGKHFSLNVPLNDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCG
FT                   ADSLGHDRLGCFNLNIRAHGECVKFVKSFGIPMLCVGGGGYTPRNVSRLWTYETGILND
FT                   VLLPSDIPEDIPFREWFGPDYSLHPVLDDLYENKNSKKYLENIRIRCLENIKYLQGAPS
FT                   VRMDAELIPTQDLPGLTEEEEDLIRELNQEDDSYRLEQIEKDNVRRGELL"
FT   CDS_pept        757680..759359
FT                   /codon_start=1
FT                   /gene_family="HOG000247956" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763694"
FT                   /locus_tag="AFR173W"
FT                   /orf_name="AGOS_AFR173W"
FT                   /product="AFR173Wp"
FT                   /function="methyltransferase activity"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /protein_id="AAS53544.1"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG059423"
FT                   /db_xref="HOGENOM:HBG396087"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="UniParc:UPI00002530B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Z9"
FT                   /transl_table=1
FT                   /translation="MAVNLELVKYLIENHVTILAHPVDGRLKDLYALFCMYLQQWADKD
FT                   QETPSYGEFHEDLVLIAQVVQGAIGVVCDSIFPEGEQLDYVHVTPLKYLVNRFHPGYYN
FT                   LREQAAAEEAECAPATLLERLTNALETRIETPSTQALNRLEELLACKLASFRLARERVK
FT                   RTVPHAPYIPTCKDLQHSSILSTVAYISNNKIVSLQKEKLFKADKEYPGLVQCIQTHIH
FT                   FIPNLKPQTDLSLGDCSYLDTCHKLNSCRYVHYLQYIPERLMQSVEQSVNQLNETQEKN
FT                   RRIGFYTHGDCCSSVVKSILPSQWIKCDVRKFDFTILGKFSAVIADPAWNIHMNLPYGT
FT                   CNDNELLLLPLDILQDEGLLFLWVTGRAIELGKESLMNWGYKVINEISWIKTNQLGRTI
FT                   VTGRTGHWLNHSKEHLLVGLKGDPEWLNKQIDIDLIISSTRETSRKPDELYGMVERIVG
FT                   THARKLEIFGRDHNVRPGWFTIGNQLTGTCIHELDVKRKYENFIATSRRQNEGRAFDYR
FT                   DDIPQKGQYNKQVYLQQQQHHSKQMPAMKAAQYVTTTYRSTI"
FT   CDS_pept        759857..760951
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763695"
FT                   /gene_name="RRG1"
FT                   /locus_tag="AFR174W"
FT                   /product="Required for respiratory growth protein 1,
FT                   mitochondrial"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS53545.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG059424"
FT                   /db_xref="UniParc:UPI00002530B7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q753Z8"
FT                   /transl_table=1
FT                   /translation="MSSLYEKASDFDTATLQTRMVQPFTRYAAHRHLVLSWYRYTLRIT
FT                   NYVPISNLLRRQTREVVRETILKHRGTQSSWKVLQLLEDMKQLNSHLAVAKAVGAWQII
FT                   QKYAAKPTPQEERLPMPAKHYNDPSKDKEAHYYWRYHRDLTRKHLLPAVIPNDYMEKLI
FT                   APLARHASDLRTLGIVQRNIQRSPKAYLSYTMVGSDRLWFVRSAVNRKKRQSRRLTAMI
FT                   VALRRAAQRSLDMSNRLKEEVIWATHEAKWEQLLATGTLPPDGAKSDWKPGRAWLEPYE
FT                   AAFRNQLANRKRTSQKLKRYSAQISKVHLPYYIKCSAAMHTRRAKRFECFQKELHTVNP
FT                   FVPGRDLGSLLSKWRMVNGKNYYR"
FT   CDS_pept        complement(760971..761597)
FT                   /codon_start=1
FT                   /gene_family="HOG000000844" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625880"
FT                   /locus_tag="AFR175C"
FT                   /orf_name="AGOS_AFR175C"
FT                   /product="AFR175Cp"
FT                   /protein_id="AAS53546.1"
FT                   /db_xref="HOGENOM:HBG124708"
FT                   /db_xref="HOGENOM:HBG203696"
FT                   /db_xref="InterPro:IPR007308"
FT                   /db_xref="UniParc:UPI00002530B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Z7"
FT                   /transl_table=1
FT                   /translation="MATIEDIQKQVLVAYQQHRQLSLKEADLLTVELLELLSQTECTPE
FT                   TLKYVGRFFTKTTYSDLIDERNLNKLCGYPLCGQSQGRIRDPYENRRVSNFLTQNNPYK
FT                   YLTSFCSKLHFRCSQFYQVQLSDEALFARVGVHLDDYEAGRVLLLEEAMAEERDLRTMI
FT                   RGMNGLSLGENGAGDELQKDLSEWLSEVRIVENERPPLLGDLMKE"
FT   CDS_pept        761787..763283
FT                   /codon_start=1
FT                   /gene_family="HOG000066104" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082777"
FT                   /locus_tag="AGOS_AFR176W"
FT                   /product="AFR176Wp"
FT                   /protein_id="AAS53547.2"
FT                   /db_xref="HOGENOM:HBG059425"
FT                   /db_xref="InterPro:IPR008010"
FT                   /db_xref="UniParc:UPI0001DB2B7E"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Z6"
FT                   /transl_table=1
FT                   /translation="MRRREKLTKPWENIRAWDIVGLLGNARRVLLNSLEPLAARIASQT
FT                   EAVATDAEVAGEVEQIINMVMLPMTLERFFLFALLGCLDCFIYYFTIVPLRLAGGLVRR
FT                   DTSAKATRDLLMLSMIVVASAILLRVDTSRVYHRIKGQSAVKLYMMFQVLDMCDKMLAS
FT                   LGQNLLSTLTVSRAWRTRDTALVVAATGYLVAHAFVLIYQTIALNVAVNSYSNSLLTLL
FT                   LSMQFAELKASVFKRMDKEGVFQLAIADIVERFQLLTFLTSIAFRNVVATGHSISRVLP
FT                   NSWQLASTSSVLLGVLYGPMVMVIGSELLVDWVKHGYVTKFNRLRPHLYDRFLHILCND
FT                   HQNNLHKFQARIGLPVPALVVLFIVLVGPAVLQMLDPTNTSRLNIITVLALVFICMVLA
FT                   KFILQALLMKWAKTLQQQHAPAPQGIYVPGALSPGLGKVDDQMRASIHSKPFPSSSDSN
FT                   EETRKTVPPSLNELRNKKDTKNTHSLEAVERFKMVSKRIW"
FT   CDS_pept        complement(763362..764453)
FT                   /codon_start=1
FT                   /gene_family="HOG000199266" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931403"
FT                   /locus_tag="AFR177C"
FT                   /orf_name="AGOS_AFR177C"
FT                   /product="AFR177Cp"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS53548.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059426"
FT                   /db_xref="HOGENOM:HBG397992"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="UniParc:UPI00002530BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Z5"
FT                   /transl_table=1
FT                   /translation="MSEVSVKEYISQQEALERQAREAMPGDPTKCTYSMGPLRQPIFAC
FT                   RTCGDIGVCYSCSIQCHTECDLVELFEKRQFSCDCGTERQKSAEKTCKLRENSTADIPD
FT                   YSNRYGQNFKGLFCWCAREYSPEKDAVMVQCLLGLECNEDWYHDHCIMGVRDDPDSADA
FT                   ERELPGFPALDTFAAFICWNCVHKYEMQFKRLLAHELADQLIADTVDWIPTDTPAERAA
FT                   LSDADRAMPGAAGSKRKAADQIYSIFLKEGYSAVLERVRDSLPPGDKLRIFLTDIAPFL
FT                   IHEDPVYEPPEDSDPVSSYEAASRALDMVSHERALNGILAYQAFKTKLSEFLQPFADTG
FT                   KVVKEEDIKSFFQAQKEPPEDSS"
FT   CDS_pept        765049..767706
FT                   /codon_start=1
FT                   /gene_family="HOG000224124" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763696"
FT                   /locus_tag="AFR178W"
FT                   /orf_name="AGOS_AFR178W"
FT                   /product="AFR178Wp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53549.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="HOGENOM:HBG409874"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008045"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI00002530BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Z4"
FT                   /transl_table=1
FT                   /translation="MASHNGMEGSHGRRRARDENDTEQRSSDSRSQSYEHPPSSPQVGS
FT                   GRGSRMGNNSPLGSPDEIDFENPDNDGDERIEFADDLDDAEERIDEVDLVGDDMYADYT
FT                   ANRNKDFYENEGVDDAEHEELSLADRRRIDAQLNARDRMLHDSQVFLDDEMDADDKMQV
FT                   DAMGMPVQRRRRRNQYDEADYDDLLSDMDVDPLMEELTLESLSDVKSSSYSEWITQPNV
FT                   ARTIARELKSFLLEYTDEYGKSVYGARIRTLGELNSESLEVNYRHLAESKAILALFLAR
FT                   CPEEMLKIFDTVAMEATQLHYPEYTRIHSEIHVRISDFPTIHNLRELREANLNSLVRVT
FT                   GVVTRRTGVFPQLKYVKFNCLKCGSILGPYYQDSNEEIKISFCTNCRSKGPFRTNMEKT
FT                   LYRNYQRLTLQESPGTVPAGRLPRHREVILLWDLVDVAKPGEEVEVTGIYKNTYDGNLN
FT                   ARNGFPVFATVLEANSIKRREGGLHSGDDAGDEGLDVFGWTEEEEREFRKMSRDRGIID
FT                   KIISSIAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILK
FT                   YVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMN
FT                   DQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLSQNVDLTEP
FT                   ILSRFDILCVVRDLVDEESDERLATFVVDSHIRSHPESDIHQEPADEDMEEADAGTAAL
FT                   SNRQKKLKRHRDKEGEISPIPQEVLMKYIHYARTKVNPKLHQMDMGKVSKVYADLRRES
FT                   ITTGSFPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVTVDSFVGAQKISVRRQ
FT                   LQRSFAIYTMSRGD"
FT   CDS_pept        complement(767878..769980)
FT                   /codon_start=1
FT                   /gene_family="HOG000205147" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763697"
FT                   /locus_tag="AGOS_AFR179C"
FT                   /product="AFR179Cp"
FT                   /function="RNA binding"
FT                   /function="methyltransferase activity"
FT                   /protein_id="AAS53550.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG385837"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="UniParc:UPI0001DB2B7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Z3"
FT                   /transl_table=1
FT                   /translation="MARKKHSRGKGAKKTFGARNDSNAQKDWTELVKENEKWENYYKQL
FT                   GVVPEAEWEDFKKTCQTQLPLTFRITGSRKHAQEVLELFENEHLPKLTNVVWDGEKVEA
FT                   PKALPWYGDNMAWQLDVSKSVIRKNEEFSKMQRFLVVENAVGNISRQEAVSMIPPIVLG
FT                   VEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSGFVVANDADYRRSHMLVHQLKRLNSA
FT                   NLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGTMRKNINVWKDWGTGSGLG
FT                   LHTVQLNILNRGLTLLKNGGRLVYSTCSLNPIENEAVVAAALRKWGAKIKLVNCDDQLL
FT                   GLVRSTGISSWPVLDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTG
FT                   GFFISVFEKINTEPVETAQDEKSEEPEQKKQKHEPAPKKERLPRDANEEPFVFVSPTHP
FT                   ELANCWSFYGVDDAFDRNTCLVRNAAGEPTRVIYHVATPLKYLIEANEDRLKIVYSGIK
FT                   LFVSQRSDVGCSWRIQSEALPIMQHHMNDARVVDTNLEMLKKLLLEAFPRFEDMQEAHI
FT                   DDDFIAKMSSLSSGCAFIRVTRGQDKEGLFLPLWNGNKCVNLMVCKEDTHELLYRVFGI
FT                   ETTSKQNPKAEAQAKAQEEKAAALADKDSPQESAEDVQVDVSESAAEKETPLTAVHTEA
FT                   DASEQV"
FT   CDS_pept        complement(770113..770517)
FT                   /codon_start=1
FT                   /gene_family="HOG000141763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778423"
FT                   /locus_tag="AFR180C"
FT                   /orf_name="AGOS_AFR180C"
FT                   /product="AFR180Cp"
FT                   /protein_id="AAS53551.1"
FT                   /db_xref="HOGENOM:HBG059427"
FT                   /db_xref="HOGENOM:HBG204261"
FT                   /db_xref="InterPro:IPR007898"
FT                   /db_xref="InterPro:IPR022793"
FT                   /db_xref="UniParc:UPI00002530BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Z2"
FT                   /transl_table=1
FT                   /translation="MDRNVYEACSDLIRSHHGVASADEVLGEKIGHQVPVPVPAAEEVE
FT                   LAAKAELEAGDNVLPHMDLKVLHYFMTQLVVQKYEHLVGCFDETALVTLGLIVEEWVRE
FT                   YLRAAGGSAGPGPALVVSKETNYRHSPADI"
FT   ncRNA           complement(770665..770855)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNRSCR1"
FT                   /product="AgSNRSCR1"
FT   CDS_pept        771176..771568
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931404"
FT                   /locus_tag="AFR181W"
FT                   /orf_name="AGOS_AFR181W"
FT                   /product="AFR181Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS53552.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059428"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI00002530BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Z1"
FT                   /transl_table=1
FT                   /translation="MQNTADRPDLGVLTRLLADRNASKEQYERKLAQLTTLLDSLLTMQ
FT                   QRVGDAGGAMALDGNALEQMLAEPLEVIEKDGQQYALVPLCGAGAGAAEPPKQRRKRTQ
FT                   LTCSYCHEVGHTRARCERRLLGRDAD"
FT   CDS_pept        join(complement(771949..772002),complement(771642..771875))
FT                   /codon_start=1
FT                   /gene_family="HOG000166937" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778424"
FT                   /locus_tag="AFR182C"
FT                   /orf_name="AGOS_AFR182C"
FT                   /product="AFR182Cp"
FT                   /protein_id="AAS53553.1"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016654"
FT                   /db_xref="UniParc:UPI00002530BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Z0"
FT                   /transl_table=1
FT                   /translation="MLFFSFFKTLVDQEVTVELKNDIELKGTLKSVDQFLNLKLDNISC
FT                   NNEAKYPHLSSVRNIFIRGSTVRYVYLKKGMVDTNLLQDAARREAMSERK"
FT   CDS_pept        complement(772272..773612)
FT                   /codon_start=1
FT                   /gene_family="HOG000163825" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763698"
FT                   /locus_tag="AFR183C"
FT                   /orf_name="AGOS_AFR183C"
FT                   /product="AFR183Cp"
FT                   /function="Rab GDP-dissociation inhibitor activity "
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of GTPase activity "
FT                   /protein_id="AAS53554.1"
FT                   /db_xref="GO:0005093"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0043087"
FT                   /db_xref="HOGENOM:HBG018239"
FT                   /db_xref="HOGENOM:HBG330736"
FT                   /db_xref="InterPro:IPR000806"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniParc:UPI00002530C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Y9"
FT                   /transl_table=1
FT                   /translation="MDEDYDVIVLGTGLTECILSGVLSVEGKKVLHIDRQDHYGGESAS
FT                   VTLSQLYAKFKQNPLTKEDIEQKFGRDRDWNVDLIPKFLMANGELTNILVHTDVTRYVE
FT                   FKQVSGSYVYSKGKVYKVPANEMEAISSPFMGIFEKRRMKKFLEWIGDYKEDDPKTHLG
FT                   LDLDNNTMEEVYYKFGLGSSTKDFIGHAMALWTNDDYLQQPARPTFERIVLYVQSVARY
FT                   GKSPYLYPLYGLGELPQGFTRLSAVFGGTYMLNTPVDKVLYTEDGKFKGIVTKEGTARA
FT                   PLVIADPTYFPDKCQSTGQKVIRAICILDHPVPNTANADSCQIIIPQSQVGRKNDIYIA
FT                   VVSDTHHVASKGYYLAIVSTIIETDKPHIELEPAFKILGNIEERFMGIAEIFEPKEDGS
FT                   KDNIYLSKSYDASSHFESMTDDVKDIYFRVTGQPLVLKKREDAEPEQ"
FT   CDS_pept        complement(773972..774628)
FT                   /codon_start=1
FT                   /gene_family="HOG000264264" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763699"
FT                   /locus_tag="AFR184C"
FT                   /orf_name="AGOS_AFR184C"
FT                   /product="AFR184Cp"
FT                   /protein_id="AAS53555.1"
FT                   /db_xref="HOGENOM:HBG107686"
FT                   /db_xref="HOGENOM:HBG522249"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniParc:UPI00002530C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Y8"
FT                   /transl_table=1
FT                   /translation="MNPVHGGAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSD
FT                   HRGTPELPGRVATLVPAADARLLVVAYFIPAAHVAAVTAYLDVREQDGYLPQTVPVHLV
FT                   APPQPPHELRDALDALPCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTAAVIAHNHG
FT                   PSGPNYEYLKLLHSALHSIAETFGARLCELEDHYLDELLEAVDRLRAQACAAVGA"
FT   CDS_pept        complement(774725..775579)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763700"
FT                   /locus_tag="AGOS_AFR185C"
FT                   /product="AFR185Cp"
FT                   /protein_id="AAS53556.2"
FT                   /db_xref="HOGENOM:HBG059429"
FT                   /db_xref="UniParc:UPI0001DB2B80"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Y7"
FT                   /transl_table=1
FT                   /translation="MAKRGRKPLNRGWRVQQQGGHGHMHGMHGMQQQKFERHRSQRLNP
FT                   EQIGTSVHDESDTISFRNHLLANYILTAGWMDALTTQAVPVSRIGRTPLYSELLRLDDL
FT                   RARKAAAADEVAALEARLDSWAPDSAFQEAYTELEKSPLHQEAVERALARYEHHFRRTA
FT                   RMQQSVVFRSCGGRPQPAAGCAPDNYWSEIYPRLREQRARRLLEERKRRREEEKLKEQA
FT                   GAEQMQLQLPADAAAAASTAHQAQTAEPPSAQMLDTMFNDIDQEPFNNGFDDAFGELDS
FT                   AFF"
FT   CDS_pept        776662..778815
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763701"
FT                   /locus_tag="AFR186W"
FT                   /orf_name="AGOS_AFR186W"
FT                   /product="AFR186Wp"
FT                   /function="RNA binding"
FT                   /protein_id="AAS53557.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG059430"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI00002530C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Y6"
FT                   /transl_table=1
FT                   /translation="MRMEQYVPVRTKVFRKPSQAVFCTQNNWKPFDEAGEAIFRLPQSE
FT                   QCVAKREISKDNIIEYHYLLRWSGAAAWGGGSISGICIPVNTEMTGELERELGELFSSA
FT                   ELRGVDFVLSQTKIYPIKASEQRPAYYGYLIGEKGALNAAHVQLAVLLHLHDGNVVECL
FT                   ELQSVSFIPMVAGVQSLNLKNISTSFQTKVFLPNLSNAGTETVPHVYLAGPVHSMVLQA
FT                   KEVLTSMIRSIDSEIYYAKLQNVSQVKLRYICSERSKELNHLMMKYQTFIHLNMEKEEV
FT                   EFQSSSTHLLELVRKEFTMEILSQVSELQLLFHDGEYNSIEKAIPGPLLALCIKYSVTL
FT                   LAEPDHWNFVLVGDQGKLEKVLEWVSKNMLNTPLQVKYFVELDPSYKDFVSGKKNGKIS
FT                   RIMDSTDVVINLDLQNGHGNMILTMFANDIKNAILGQKLVSDELPSERSFFIPEAYHRP
FT                   VIGTGGSVIQTIMRKHNVFIQFSNSFQLPQNKLAHIRYDNVVIRCPSKNRGEIIPAKEE
FT                   LNQLAQEYSEMQPNVQLRLSPGQYRYLLHHNEKDKLSLVDNIGTIERRTSTYVMFPFQE
FT                   PKEGFLLEIRGNDNQATIAARKLSESFGEELEITITSPIVDTVDFCNSIVVPFLAMGLI
FT                   VTTADCLIRFTYQEGNKSVTYALDILREYLRKINVTIMDKSFIRSWIVEAPKHPVPQPV
FT                   TEKKHHAHHGAYIQQYSYGYATL"
FT   CDS_pept        complement(778810..779451)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763702"
FT                   /gene_name="IRC19"
FT                   /gene_synonym="RRG4"
FT                   /locus_tag="AFR187C"
FT                   /product="Increased recombination centers protein 19 "
FT                   /biological_process="sporulation resulting in formation of
FT                   a cellular spore"
FT                   /protein_id="AAS53558.1"
FT                   /db_xref="GO:0030435"
FT                   /db_xref="HOGENOM:HBG124399"
FT                   /db_xref="InterPro:IPR016613"
FT                   /db_xref="UniParc:UPI00002530C4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q753Y5"
FT                   /transl_table=1
FT                   /translation="MLPLAIPPNNIVRAMSSPNATGPLMRTSKAIITSNYTLLTDKTPY
FT                   LLPVCFNESCRAEQVRMLYRRFFRLRPLVAQRAMIKESYTNYIRVKFSEDYALKRRQAL
FT                   PQNTCPVLDAIEAGRRSLTFILKAVSEIEDADSNPELAYDNYICRKILKNVLTLEYQRE
FT                   RLEFKNPKRKQILRQNYEYLDAKYHDPKYTSLRNADVSIIHFNETLGTRL"
FT   CDS_pept        779748..782231
FT                   /codon_start=1
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763703"
FT                   /locus_tag="AGOS_AFR188W"
FT                   /product="AFR188Wp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAS53559.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI0001DB2B81"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Y4"
FT                   /transl_table=1
FT                   /translation="MAKPRNAAKKGSLSQSLDNKIADLIYRMLDEKSLEKQRARAQLAQ
FT                   EGGDTDSESMDDLKNDFADIYLAQDLKLMDVIAYVQTRDLSLQRVKKVLLEKTVERVLK
FT                   QVIEDEKDGLDLTPQPETITEEEMSKQNLMVIQDKNEMNRSITGQWNFSPVPPPTPKSA
FT                   EDGMAVESDSKKGNKKRPTKDAIIKPKRQKVQDRTPPSADLSSLGGMDDVIAQLMELVA
FT                   LPILHPEIFASTGVEPPRGILLHGPPGCGKTSIANALAGELQVPFISISAPSVVSGMSG
FT                   ESEKKIRDLFEEAKSLAPCLVFFDEIDAITPKRDGGAQREMERRIVAQLLTSMDELSFE
FT                   KTNGKPVIIIGATNRPDSLDSALRRAGRFDREISLNVPNELSRMHILKKMTSNLKVDGE
FT                   IDFLKLAKLTPGFVGADLKALATAAGTCAIKRIFQNYASVAASDGAMEIDSDNNQSSLK
FT                   NTADVIEPLPLSTIQVFLKNYTEPLNEQQLSTLSITYEDFLKALPTIQPTAKREGFATV
FT                   PDVTWSSVGALSNIRVELNMAIVQPIKRPELYEKVGISAPAGVLLWGPPGCGKTLLAKA
FT                   VANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDTS
FT                   LSESSSRVVNTLLTELDGLNDRRGIFVIGATNRPDMIDPAMLRPGRLDKTLFIELPNAD
FT                   EKLDIMHTLVKSNGTPLAPDVDLSAVVNDERCRNFSGADLAALLRESSVLALKRNFFHS
FT                   GEIQSVLDNNLDREFGDLSAGTPMNEIIVTVTDFENALRKIKPSVSDKDRMKYNKLNKK
FT                   MGWNDEAGVQVEEEA"
FT   CDS_pept        complement(782332..784233)
FT                   /codon_start=1
FT                   /gene_family="HOG000112809" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763704"
FT                   /gene_name="GRC3"
FT                   /locus_tag="AFR189C"
FT                   /product="Polynucleotide 5'-hydroxyl-kinase GRC3 "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="polynucleotide 5'-hydroxyl-kinase activity "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS53560.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0051731"
FT                   /db_xref="HOGENOM:HBG059432"
FT                   /db_xref="HOGENOM:HBG202506"
FT                   /db_xref="UniParc:UPI00002530C6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q753Y3"
FT                   /transl_table=1
FT                   /translation="MSDDFVVPTYEVGGSDSGSDQDISDIEEGSFNGISATPLPTADVE
FT                   YVSEASPMDATASLGYLSGAEGANLYVAREGANYFNDAANKAVVLCLHSYEQLAISGVF
FT                   KLQVMKGGITYNSIHYNCGLHTYDFWHPLSESIPPIAASFAADWEEHSYGLSPWLPADI
FT                   KEEYECILRISEGSNIGDVGRLMAELGQLWTRHTGCTFSILRPEDYARPLILNKDWDNL
FT                   QAELMIHHMNSEHDMRVMCIGGKNSGKSTLLRLLLQKFLHGNKSTTKATGVSHEADVVN
FT                   YLDMDPGQPEYSAPDSISWSKLTSETLSLGQHLAQGHREMIQTTYIGSSTPQTWPEMYL
FT                   TAMEHIIHKWEMEGQMNTALLNLPGWIKGFGITIINKAMELFKPTHIIFLTHGGKLISK
FT                   ELVVPNMFETMQKGKYKPMIYNLQAFTQHNIPGLPAQDPRYHAANIRSFRLLAHLHRLS
FT                   EQSYYPGPLLSSPPLQVSFGSQGIMAFRFLQDPSSGYHQDDISAALQGCVVCLYHSKMP
FT                   PDIDMCGVFPMLKHSADYTSMDFVTLALIHSIDVERKFMNIYIPGHVSGRVHSLKNNFV
FT                   LVRGATDLPLCELYPQKLLSSSYRNREIPYVSFSKRKKYEYVWKIRKNVRRRGHYNK"
FT   CDS_pept        complement(784526..785824)
FT                   /codon_start=1
FT                   /gene_family="HOG000115422" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763705"
FT                   /gene_name="RIM101"
FT                   /locus_tag="AFR190C"
FT                   /product="pH-response transcription factor pacC/RIM101 "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53561.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059433"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00002530C7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q753Y2"
FT                   /transl_table=1
FT                   /translation="MSHINHLLNSDEAIPSTALRSCAQRSPMSSDDELVGTAGYRENQP
FT                   VPGSTLPTSPSDVSTDTENDEHQRLLCQWDACGSEFSQPELLYHHLCQDHVGRKSQRNL
FT                   QLNCHWGSCTTKTVKRDHITSHLRVHVPLKPFSCSTCSRKFKRPQDLKKHLKVHMEDTM
FT                   KERSRAAPGSRGVRKTGVNKGSALQEKARTLPNLTVESFVSQEMQNYYPYYKSRQHLDE
FT                   TLSHIILPPPAALGGTLASEPPSYTRKAVSFFTTLSQDMSRRLPSLAPCNSPGPAGKMV
FT                   MLPRPEQQYARVPRYPAMPELPPLVTSPGAESHALPRGHNFRPAPLIPGSMLPSLSRFS
FT                   HDKSQFVARNSYSLNQKASLNEELCENELDIALENLALDDTDALRAELQTVNIIKDYLT
FT                   CLLLEDVYTESFELPASVEKSHSTLRKYPQIKV"
FT   CDS_pept        complement(786342..787850)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763706"
FT                   /locus_tag="AGOS_AFR191C"
FT                   /product="AFR191Cp"
FT                   /protein_id="AAS53562.2"
FT                   /db_xref="HOGENOM:HBG124398"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniParc:UPI0001DB2B82"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Y1"
FT                   /transl_table=1
FT                   /translation="MGGILAVSKLKTIWLTLALLLRAVNAGVSLTYCFRSNLGTTDPIF
FT                   SNYMSNGLCMDHCRSNHEWAIVSGKQCWCSDNMPSRGLEMSDCSTPCWGISSEMCADPD
FT                   KNTYGYIYMGEGSPPSIEVGSEENTQSSAQSSTATTSSTSSSSISVSSQDPETSTTPSS
FT                   TTSPLTSSDNGETKTKSTVTSLLKTTDEQHETRTTSTDSSSSAASPASTPESVTSTSST
FT                   SSSTSSSTSSSTSSSTSSSTSSTSSSSTSSSSSTTAAPTPVVPVLVRTTTTVPTPVTSY
FT                   QAITSVIYSVFTTTAAFSENGSQGSSSIVSVATVISTAVYYSTLTPVNSETVPATSAAP
FT                   IAKVNSFWDSKAKVIGTFLPVALLLFLLLLLLIWILIRLRKKRNGYQDDELQHFHSDVS
FT                   SAGSILGGHGATSFVYTDEKGILPSPDSNGARVSALASQATMGGGTLCSNSLPASRESK
FT                   ADALVFDQRLDPSHVMSQWENGGSRVSLADDVDYTRKVLRVINE"
FT   CDS_pept        788840..790522
FT                   /codon_start=1
FT                   /gene_family="HOG000000867" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082778"
FT                   /locus_tag="AGOS_AFR192W"
FT                   /product="AFR192Wp"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS53563.2"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG059434"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI0001DB2B83"
FT                   /db_xref="UniProtKB/TrEMBL:Q753Y0"
FT                   /transl_table=1
FT                   /translation="MALQRNSKQNQQQWYRELVNKVIQLLQQNDHDSLALIARNCGVPP
FT                   QLRHLVWPVLLKYHPFVISPSILSNTLIFDKTEDKWVYECENRARRDVEQAVMHDLQKF
FT                   FVNKRSDQHMPLPDIEQHMRFLRDTIMRFLDKWERVFKYEVALAWIAIGLAEWVPIDGW
FT                   GESAPGGGGVCSEDMALPKGRSTDVPVLQGKRHHITIRSLYKEYPLPRELSSRLTKRCF
FT                   NFYDTFERLVLVILHCPDVTRTKMKVANGRNYPFISGGDVLFQTQLFFKIFQMTLPELY
FT                   QPFTDEESLQSSRKADWIYWWFKACGAKVMHKQDRAHLWDVLLGWRPHPSTLNFYLDYN
FT                   NKSFAHLYNTKLNLDPQFFHKVCKHGNDHFWFPDLDTLPLGSPGLETDCQVVNELIRHN
FT                   SYESKDTGAPGTPSKTSQAGNNYRSPIRPSQKHQKDIPFSLIDPHVQLIFIYIAILQQN
FT                   EFKLLEFEEAEITEFLTKVPLLSKTDDYSYKRLYDEESTSLSSTDTEDSQNSSSRPSTS
FT                   SHMMIEVGNDDKIANTFDDLSQLAGDIWRKWMWFEFEESQDSV"
FT   CDS_pept        791296..791757
FT                   /codon_start=1
FT                   /gene_family="HOG000184129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625881"
FT                   /locus_tag="AFR193W"
FT                   /orf_name="AGOS_AFR193W"
FT                   /product="AFR193Wp"
FT                   /function="cytochrome-c oxidase activity"
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="AAS53564.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="HOGENOM:HBG174654"
FT                   /db_xref="HOGENOM:HBG324015"
FT                   /db_xref="InterPro:IPR002124"
FT                   /db_xref="UniParc:UPI00002530CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q753X9"
FT                   /transl_table=1
FT                   /translation="MFSLRQSVRLVAPATRAFSTSRAIFQKQLKTASNLAEVEGPESLI
FT                   GKGAAEGQIPTELEQATGLARLEFLGKLEGVEIFDTQPLDSSRRGTMKDPILVDSYDDY
FT                   RYVGCTGSPAGSHSTMWLKPSVEKVARCWECGSVYKLNPVGVPTEDHHH"
FT   CDS_pept        792097..792456
FT                   /codon_start=1
FT                   /gene_family="HOG000108824" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625882"
FT                   /locus_tag="AFR194W"
FT                   /orf_name="AGOS_AFR194W"
FT                   /product="AFR194Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS53565.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG410512"
FT                   /db_xref="HOGENOM:HBG744826"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="UniParc:UPI00002530CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q753X8"
FT                   /transl_table=1
FT                   /translation="MPKKRASNGRNKKGRGHVKPVRCVNCSKCVPKDKAIKRMTIRNIV
FT                   EAAAIRDLSEASVYAEYALPKTYNKLHYCVSCAIHARIVRVRSREDRRIRTPPQRQRFN
FT                   RENRVNPADAAKKAL"
FT   CDS_pept        793484..794848
FT                   /codon_start=1
FT                   /gene_family="HOG000089745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763707"
FT                   /locus_tag="AFR195W"
FT                   /orf_name="AGOS_AFR195W"
FT                   /product="AFR195Wp"
FT                   /function="protein phosphatase type 2A regulator activity "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="protein phosphatase type 2A complex "
FT                   /protein_id="AAS53566.1"
FT                   /db_xref="GO:0000159"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008601"
FT                   /db_xref="HOGENOM:HBG025071"
FT                   /db_xref="HOGENOM:HBG443924"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI00002530CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q753X7"
FT                   /transl_table=1
FT                   /translation="MPQQQNSFDFKFSQCFGDKADIVVTEADIITATEFDHTGNFLATG
FT                   DRGGRVVLFEKNNSKHCEYKFLTEFQSHDAEFDYLKSLEIEEKINQIKWCRPTNQSHFL
FT                   LSTNDKTIKLWKIYEKNIKLVSENNLSEGVFNQRVAGSGSGSAKAVLSLQALRLPRLSL
FT                   HDKIIAATPKKVYSNAHTYHINSISVNSDQETFISADDLRINLWNFDIPDQSFNIVDIK
FT                   PANMEELTEVITSAEFHPTHCNLLMYSSSKGTIKLADMRQNALCDFRAKTFEEYMDPIH
FT                   HNFFTEITSSISDVKFSPDGRYIAARDYLTVKLWDVNMDSKPLRTINIHDQLKERLSDA
FT                   YENDSIFDKFEVCFSGDSSSIMTGSYNNNFMLYPNVVKTGDYATSTSLDEIVLQADKSA
FT                   FKTKRLGSIMQQSARNKEWGDDIDFKKSILHFSWHPRENSVAIAATNNLFIFSAL"
FT   CDS_pept        complement(795284..795664)
FT                   /codon_start=1
FT                   /gene_family="HOG000193965" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763708"
FT                   /locus_tag="AFR196C"
FT                   /orf_name="AGOS_AFR196C"
FT                   /product="AFR196Cp"
FT                   /function="cytochrome-c oxidase activity"
FT                   /cellular_component="mitochondrial respiratory chain
FT                   complex IV"
FT                   /protein_id="AAS53567.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005751"
FT                   /db_xref="HOGENOM:HBG026861"
FT                   /db_xref="HOGENOM:HBG324116"
FT                   /db_xref="InterPro:IPR001349"
FT                   /db_xref="UniParc:UPI00002530CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q753X6"
FT                   /transl_table=1
FT                   /translation="MLRQAIRRASSLPPHALKPAYPNANAAAGKAFLESMNATKEHAKH
FT                   TTKLWIKIWYVVGIPAIVLTAINTYFVEMEHAEHRKHLAHVPDEEWPAQYDFMNMRLKP
FT                   FFWGNGDRTLFWNPVVNRNVKD"
FT   tRNA            796218..796289
FT                   /gene_name="tRNA-His"
FT   tRNA            join(797083..797118,797159..797194)
FT                   /gene_name="tRNA-Pro"
FT   CDS_pept        797299..798723
FT                   /codon_start=1
FT                   /gene_family="HOG000248851" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763709"
FT                   /locus_tag="AFR197W"
FT                   /orf_name="AGOS_AFR197W"
FT                   /product="AFR197Wp"
FT                   /protein_id="AAS53568.1"
FT                   /db_xref="HOGENOM:HBG059436"
FT                   /db_xref="HOGENOM:HBG397959"
FT                   /db_xref="UniParc:UPI00002530CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q753X5"
FT                   /transl_table=1
FT                   /translation="MLRPILRASIKSWPVRRAHVPRMTLAPTRAYNTVSQQRSNRWKSA
FT                   VLAAGGLSILSLGLWWFYWPHHSFPRPVAKLLRKALWAESDKKGHNFQEALGFYIDALE
FT                   ECEHLDIDRISDEYTGIQLKIAEMYEKLNMFKEAQSIYLEMLHQYYEALITNGRVPEWQ
FT                   RPHYIQKDLRVLIKALEMNQDLQLGKRLLLTHLMLPQEEVLMRSPELKKFFDRRKEEAR
FT                   NAGDRDHSQPQRWRDFKPHVNEENIKLDDKGNMILDLQKDSSAWQPFKEEFFTARDLYT
FT                   VYCLSTDDLPSALSCKMTTVEWMVMADMPPGQILLSQANLGSLLYLEAERTEALLYKLE
FT                   RQLVDKAKSEKDIIMMRSLNSKRSLLLDMATTSYESIITFAKRNNKLRFHAKELMDPSA
FT                   SQAVALSTYGLGVINLHRGILPKAERLLKDSISIAKDTDFRDLLKEANQELQKLERAKQ
FT                   SNPSTVFMEPKGTETP"
FT   CDS_pept        798903..801233
FT                   /codon_start=1
FT                   /gene_family="HOG000076521" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763710"
FT                   /gene_name="OCT1"
FT                   /locus_tag="AFR198W"
FT                   /product="Mitochondrial intermediate peptidase "
FT                   /EC_number="3.4.24.59"
FT                   /function="metal ion binding"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="AAS53569.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG056557"
FT                   /db_xref="HOGENOM:HBG562792"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniParc:UPI00002530CF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q753X4"
FT                   /transl_table=1
FT                   /translation="MFVRFYKRLDRQYIQSQRRWILSSNKCLLQGNKNATISPLRRAFD
FT                   DQDHWEESQAQNTSSEQDNKGKNSSYFWSRSKATAPQVAHTGLFQNPYLNSPEGLRKFA
FT                   NKSLTEATALVRNLREDSSQEGLVRYIIRLDQLSDILCRVIDLCEFLRAAHPDEQFVAA
FT                   AQECHEQMFEIMNILNTDVVLCKRLKQVLSDENISSKLSSEEIRVGHILLEDFEKAGAY
FT                   ASPEVRKQFIQLSQNISIIGQDFINNTESLSSSYIKIPCKDLESSGTSHLVLRQLTKDT
FT                   MGNNYKIPTSGYAPYTLLNACPSEAIRRQVWTAMFSCSEKQVKRLKSLLQLRRKLANIM
FT                   GATDYVSYQLEGKMAKSPENVKNFLNTLVDHTKPLAAGELEELAKLKRNVENLSETNTL
FT                   KLMRPWDRDYYSSLSPNFTRPNHRVDGFTSINTYFSLGVVMQGISDLFRDIYGISLKPV
FT                   VAQAGETWAPDVRKLQVISETEGIIGLIYCDLLERPGKTTSPSHFTVCCSRQIYPEEND
FT                   FSTIQVGENPDGSRFQMPVISLICNFRATRHGKNKSLCLLELSDVETLFHEMGHALHSM
FT                   LGRTQLQNLSGTRCVTDFVELPSILMEHFAKDRRVLLRISSNYATGEPIPEELLSAFQE
FT                   QNNFLKNTETFSQIKMSMLDQRLHSITDQDDIIAVYHGLEREMEVLVDDQTNWCGRFGH
FT                   LFGYGASYYSYLMDRAIAAKIWDHLFKKDPFSRSSGEKFKEGVLKWGGSRDAWQCIADA
FT                   LDEPRLVKGDDWAMRFIGEVEDM"
FT   transit_peptide 798903..798986
FT                   /gene_name="OCT1"
FT                   /locus_tag="AFR198W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q753X4 "
FT   mat_peptide     798987..801230
FT                   /gene_name="OCT1"
FT                   /locus_tag="AFR198W"
FT                   /product="Mitochondrial intermediate peptidase "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q753X4 "
FT   CDS_pept        join(complement(801945..802526),complement(801328..801750))
FT                   /codon_start=1
FT                   /gene_family="HOG000091643" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778425"
FT                   /locus_tag="AFR199C"
FT                   /orf_name="AGOS_AFR199C"
FT                   /product="AFR199Cp"
FT                   /protein_id="AAS53570.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG627825"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00002530D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q753X3"
FT                   /transl_table=1
FT                   /translation="MLELTIHVKERTIELIMSTDEILVLRGTLEGHNGWVTSLSTSPAQ
FT                   PNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKT
FT                   LRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDCVVTLLGH
FT                   NDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPD
FT                   GSIFASAGKDGQIILWNLNEKTALYTLDAKDEVFAVAFSPNRYWLTAATASGIKIFDLE
FT                   ERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQTLFAGYTDNIIRVWQVMTAS"
FT   ncRNA           801813..801895
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR24"
FT                   /product="AgSNR24"
FT   CDS_pept        802970..805054
FT                   /codon_start=1
FT                   /gene_family="HOG000163270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763711"
FT                   /locus_tag="AGOS_AFR200W"
FT                   /product="AFR200Wp"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="AAS53571.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG201632"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="UniParc:UPI0001DB2B98"
FT                   /db_xref="UniProtKB/TrEMBL:Q753X2"
FT                   /transl_table=1
FT                   /translation="MDKKIKRFLKDAVRVAPKISNKGELFELKNGLVSKYPQTRKDAIK
FT                   KTIQQMTLGKDVSSLFPDVLKNIATSDIEQKKLVYLYVINYAQTHPELCILAVNTFVTD
FT                   AQDPNPLIRCMAIRTMSMIRVDKILEHVEIPLRKTLQDDNPYVRKTAVICVAKLFQLNR
FT                   ELCMELDVLTDLMSALDDSNPMVVANSIAALTEIYELDRSAVPLPLLIQSHVTQFLNAL
FT                   NECTEWARITILGALAQYEAKDAMEAQDTIVRVTPHLQHVNAAVVLASVKVIVKNLDFL
FT                   PREMQKQPSEKISTALVSLMSTPPEMQYVALKTIRILLQKYPTLLEKELRIFYVKFNDP
FT                   MYVKLEKLDIMVRLVTTSNLKQCSTLLLELREYALEFEPEFVSKAILAISQLAIKFAHG
FT                   ADAVNASKFIAKAIDILSTLIQDRNTFQDECLISICDLLRYDPQLSGMPLSIISSWTDA
FT                   ESRLVTDQGKCNYIWLLGQYQFPNAEEKLMQFVDTYPQQGQSTQMSILVTVVKLSQQLP
FT                   GHVLQRVLELATTQAQDIDIRDMAMLYWRCLSLPNPESLINELCNTKLPQLTNTLDYFS
FT                   PELLHTLLNELSTLSSIYYKPLSQFKYRAPQQSEVQSKALDELTSLAHAEIAKNMNNET
FT                   LLNMDDAQAAPKPGNTLAELSDLFGNTGGSLLDKPMQDMSLHADSRTVQGASKDLLDLF
FT                   "
FT   CDS_pept        complement(805091..805420)
FT                   /codon_start=1
FT                   /gene_family="HOG000111896" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763712"
FT                   /locus_tag="AFR201C"
FT                   /orf_name="AGOS_AFR201C"
FT                   /product="AFR201Cp"
FT                   /protein_id="AAS53572.1"
FT                   /db_xref="HOGENOM:HBG059437"
FT                   /db_xref="HOGENOM:HBG202412"
FT                   /db_xref="InterPro:IPR013892"
FT                   /db_xref="UniParc:UPI00002530D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q753X1"
FT                   /transl_table=1
FT                   /translation="MSKEQGQAEQHGRRLPVWMLSPAEEKEARKNLKTMAYEKCSEYVR
FT                   AMAECSKAHGLNVFPACDGPKRQMGECLLFYQKDEFLDAEWDRIVERKLDALEQQVRAR
FT                   KAGEQ"
FT   CDS_pept        805613..806014
FT                   /codon_start=1
FT                   /gene_family="HOG000166603" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931405"
FT                   /locus_tag="AGOS_AFR202W"
FT                   /product="AFR202Wp"
FT                   /protein_id="AAS53573.2"
FT                   /db_xref="HOGENOM:HBG059438"
FT                   /db_xref="InterPro:IPR016340"
FT                   /db_xref="UniParc:UPI0001DB2B99"
FT                   /db_xref="UniProtKB/TrEMBL:Q753X0"
FT                   /transl_table=1
FT                   /translation="MFGPFKSSQPLLGGLLWKIPWRMSAPQKQRQRRRLQAVDDVLKQL
FT                   NLGLQIRKKLQSLPDLPFDALKQERVKKCVDIKQLRLLNDPAVFPAEHQMSPKDKYTVF
FT                   NKSSRGYRKGAHKVPKWTKVSNRRNPANF"
FT   CDS_pept        complement(806031..806645)
FT                   /codon_start=1
FT                   /gene_family="HOG000154375" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625883"
FT                   /gene_name="SPC24"
FT                   /locus_tag="AFR203C"
FT                   /product="Probable kinetochore protein SPC24 "
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS53574.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG059439"
FT                   /db_xref="HOGENOM:HBG203431"
FT                   /db_xref="InterPro:IPR013252"
FT                   /db_xref="UniParc:UPI00002530D4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q753W9"
FT                   /transl_table=1
FT                   /translation="MPSQAPGPDVLENPADLLRQTRENFSIAHDLQLLNATEENLRRLM
FT                   QRTQQLEAKGAQELSELQAQQTERAQAAEAMRAEKETQAQHLQALTHSQDLVRLANELE
FT                   ELEQQLVSLRAELDEGMTQLLQTSEPTAAFQGDAEHEQQSPEVQTNLLKLQLYSSLGVT
FT                   LDTEHNQALIERGDAAGIDLIALEDDSLSPFFRTKYVWDRL"
FT   CDS_pept        806759..806965
FT                   /codon_start=1
FT                   /gene_family="HOG000001076" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763713"
FT                   /gene_name="HSK3"
FT                   /locus_tag="AFR204W"
FT                   /product="DASH complex subunit HSK3 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS53575.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG059440"
FT                   /db_xref="HOGENOM:HBG398802"
FT                   /db_xref="InterPro:IPR013183"
FT                   /db_xref="UniParc:UPI00002530D5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q753W8"
FT                   /transl_table=1
FT                   /translation="MDQTKRRHYSQLSQQLQLLQKNLEATTQHVETMSVQCNEHLVNKL
FT                   GKIQASWFIGGNRCFEQELLGKR"
FT   CDS_pept        complement(807034..808407)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931406"
FT                   /locus_tag="AFR205C"
FT                   /orf_name="AGOS_AFR205C"
FT                   /product="AFR205Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS53576.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1KE8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00002530D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q753W7"
FT                   /transl_table=1
FT                   /translation="MSYNNKKRNGSFKRRNGGDYYFPNKRPHHHHQPTGTTSRYNNQVR
FT                   PPTEPEPAAPAPADVATSAAVAATRQSRFQPHRALPKAPRQVSRYNNGNLPAPPAGPAS
FT                   LRVPATIITHTHSVESSYQRITQVGEGTYGKVYKCRNIYTNKLVALKKLRLETERDGFP
FT                   ITSIREIKLLQHCQHENVSTIAEIMCEAQKTVYMIFEYADNDLSGLLMNKEIHFSDANC
FT                   KHLFRQLLKGMEYLHECRILHRDIKGSNILIDNRGNLKITDFGLARKMKQEPDYTNRVI
FT                   TLWYRPPELLLGTTRYGTEVDMWGCGCLLVELFLKAAFFQGTNELEQLRCIFQVLGTPT
FT                   IEQWPGLFDMPWWFMMIPQQKENYPSRFDEKVSGVLPTQSCRDLARGLLLYDQKKRFSA
FT                   SEALKSAYFYELPRPEPLNLGDFDGCHEFEARRQRRKEREETKKAAAASASSASKKSA"
FT   CDS_pept        complement(808632..809960)
FT                   /codon_start=1
FT                   /gene_family="HOG000173756" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763714"
FT                   /locus_tag="AFR206C"
FT                   /orf_name="AGOS_AFR206C"
FT                   /product="AFR206Cp"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="AAS53577.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG024584"
FT                   /db_xref="HOGENOM:HBG332621"
FT                   /db_xref="HSSP:1K8Q"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR006693"
FT                   /db_xref="UniParc:UPI00002530D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q753W6"
FT                   /transl_table=1
FT                   /translation="MQKQTEAAETRSRPQGARQLLGYAVGLTALAEVLLWQLFRLILAV
FT                   FWKREPKHGRPDAGRVLEAELAAARDIYDMCRLFGVSLRTHMVRTEDDYLLAVHHIPAS
FT                   EAGAPVVYLHHGLMMSSDIWCCRLDRQDSLPFVLAASGYDVWMGNNRGNRYSTKHLRCA
FT                   PHDERFWDFSLDEFALFDIPNTVDYILAATGARTLTCIGFSQGSAQLFAALSVHAGLNC
FT                   KVSRLVAIAPAMTPPGMHHRLLDSLIKFTPNLTYLLFGRKALLSSTVLWQRLLPHGVFD
FT                   ALIDRALCLLFGWRSANIAPEQKHVSYSKLYSTTSVKCIVHWFQILRAQQFQFFHPSDC
FT                   LFHSVARPYAVAHFPTNTSITVPTMLIYGTSDSLVGINVLLKNLPGQRLDIVAVPGYEH
FT                   LDLLWGRKVRELVIKPLLALLDHDSRTRAEDKASSCQTAGHQV"
FT   CDS_pept        complement(810103..810603)
FT                   /codon_start=1
FT                   /gene_family="HOG000160253" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778426"
FT                   /locus_tag="AFR207C"
FT                   /orf_name="AGOS_AFR207C"
FT                   /product="AFR207Cp"
FT                   /function="electron carrier activity"
FT                   /function="succinate dehydrogenase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS53578.1"
FT                   /db_xref="GO:0000104"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG362919"
FT                   /db_xref="HOGENOM:HBG734972"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR014361"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="UniParc:UPI00002530D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q753W5"
FT                   /transl_table=1
FT                   /translation="MFASQFKFFIRPSTTGAARRALSTIKTSTKESQELLVAQRKNRPV
FT                   SPHLTIYQPQLTWYLSSVHRISGVLLGGAFYAVTISFGVSALLGLGLNAENLATWYHSH
FT                   MPTWGDLTVKGGAAYLFAFHFGNGIRHLIWDMGRELSLKGVYRTGYAVLGLMAVGGTYL
FT                   LTL"
FT   CDS_pept        complement(810769..811329)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763715"
FT                   /locus_tag="AFR208C"
FT                   /orf_name="AGOS_AFR208C"
FT                   /product="AFR208Cp"
FT                   /protein_id="AAS53579.1"
FT                   /db_xref="HOGENOM:HBG059441"
FT                   /db_xref="UniParc:UPI00002530D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q753W4"
FT                   /transl_table=1
FT                   /translation="MNDSPTHRSSRQHEFALNSDKLRQQQPAALQTPGLPTPKRPSPIQ
FT                   QASRAPRRDSEDVLQLEYNSVKQENDKLKNIITKLKQEIDVYSRLLQRQTGAPRPPPPH
FT                   PCGIPLIESILVNSSKRRKRATTVVARAVPQTHSTSRVLKDASKDVMLGPASQALAPPA
FT                   AEDLAPEDLLLMNRLTDLLKRMD"
FT   CDS_pept        811835..812548
FT                   /codon_start=1
FT                   /gene_family="HOG000209960" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778427"
FT                   /gene_name="SNF7"
FT                   /gene_synonym="VPS32"
FT                   /locus_tag="AFR209W"
FT                   /product="Vacuolar-sorting protein SNF7 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="AAS53580.1"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG371348"
FT                   /db_xref="HOGENOM:HBG618740"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI00002530DA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q753W3"
FT                   /transl_table=1
FT                   /translation="MWSYLFGSGNAKQKKELPKKAILELREHIQLLSKKQAHLQTQMTS
FT                   QEESARHFLSKGNKNMAKAALKRKKVFESQLLKIDKQVDSLEQQLYSIENANLNLETMK
FT                   AMKQGASAMKHIHEGLDVERVDETMDEIREQVELGEEISEAISRPLYTGVNEIDEDELD
FT                   EELDMLAQEEVARKVMEPGAAVPAAAPATKVSLPSVPSSDMPQQDRGQPVTLGMDQEED
FT                   EDERALRELQAEMGL"
FT   CDS_pept        complement(812722..813711)
FT                   /codon_start=1
FT                   /gene_family="HOG000194860" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763716"
FT                   /locus_tag="AGOS_AFR210C"
FT                   /product="AFR210Cp"
FT                   /function="SNAP receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS53581.2"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG025919"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR021538"
FT                   /db_xref="UniParc:UPI0001DB2B9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q753W2"
FT                   /transl_table=1
FT                   /translation="MMDIKDRTIEFQRSVTSYSRRNAKQGAGGPGEGADRQSLRKSEFQ
FT                   QRASRISHEIANLAQMLSKLAQLAKRKPMFNDNPVEIAEMTYLIKHKIYSVEQEMMELS
FT                   RHMPNNGGGVADGGAQTRLHTKNVVNLLNTKMKNISGDFKSVLEARQKLELANRDRWEK
FT                   ISADRNSAAAASLQDGLPMGGMGVSSGSAAAYNSANPFMSSLLAEDDASGQPNGQLSLP
FT                   NEESVLLLEEQQTANQQYLQERGRAVETIESTIQEVGNLFQQLAHMVQEQGETIQRIDA
FT                   NVEDIDINIAGAQRELLKYFDRISSNRWMAVKIFAILFAFFLVWVIVN"
FT   CDS_pept        complement(814128..815387)
FT                   /codon_start=1
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778428"
FT                   /locus_tag="AFR211C"
FT                   /orf_name="AGOS_AFR211C"
FT                   /product="AFR211Cp"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="AAS53582.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG122224"
FT                   /db_xref="HOGENOM:HBG446828"
FT                   /db_xref="HSSP:1AJS"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00002530DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q753W1"
FT                   /transl_table=1
FT                   /translation="MSLTAFNQLEILPPDALFDVKKRLTQDTRSFKVDLGLGAYRDENG
FT                   KPWVLPCVREAEKQLMADPGYNHEYLGIAGLEEFRAAAARVLLGEDSEALAEGRVVSVQ
FT                   SISGTGALHVAAKLLAKTVPDATVYMSDPTWGNHFAVFETQGLRTATYPYWDAATRSLD
FT                   MEGVLGALGAAPRGSVFVLHACAHNPTGLDPNEEQWVQILDAVAAREHTVLFDSAYQGF
FT                   ASGSLARDAYALRAGLRRLAEVTPVLVCQSFAKNIGMYGERVGALHVVLPRQPAESLAH
FT                   VKAAVLSQLSHITRSELSNPPAYGAKIVTKVLTTPELAAQWKKDMITMSSRIARMRRVL
FT                   RDRLVELGTPGNWDHIVQQCGMFSYTGLTKEMVARMEKDFAIYMVSSGRISIAGLNDSN
FT                   VGHVANAIDNAVRHFSTPKL"
FT   CDS_pept        815797..817677
FT                   /codon_start=1
FT                   /gene_family="HOG000034100" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625884"
FT                   /locus_tag="AGOS_AFR212W"
FT                   /product="AFR212Wp"
FT                   /protein_id="AAS53583.2"
FT                   /db_xref="HOGENOM:HBG123739"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001DB2B9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q753W0"
FT                   /transl_table=1
FT                   /translation="MNSSVLERLDYLNQSSHFLVSDSTPLASLVNTPYRIYKAFYDAVV
FT                   TQYLASLNNPETLPFNSETFMSSVGYFFSSYAVGCFFIAVILSRLSAMAGLRSNTVRTS
FT                   IPNWSRVTLHAVAIAALVYGLCGVAIQYQVGWLRRWPTLEVGAFLSRTYVVFTLSHCIE
FT                   TFLSITTNGKPLEESDYTIFELSAQFYGMTKGGATAHEYGPDCIMALSGRLIIHLVELF
FT                   RKRRWRLACSTLLNTGFISYLLLEVRSNGLGSLSLFTKCKHFPKFFSVFIIGISMACYL
FT                   LACLVRLNPTRDEGTSAVEDLQFHSFVSNWFKNLNLTGEEEFSITVMRLAVLLCNPSQN
FT                   KEHGLHRELPHLKAAASLHKSYMISGYMNKLSKIPEAVTGSRADPAPKPRSVAIRRVLW
FT                   LGSMLKGIFSRIRGSLAPPKAATPVRNTHQKSANFNDYINENNYTHFMTMENDETFSPL
FT                   LPEEDGSADYESDSPDENDDVCDSDLDLEEPQDILQEVVSPQAMLELAHSSPQDLTWYL
FT                   SMWTILNCESAPGKRLTRSQYAHINENGILKEVLLQRNMETCTSPSKLQDEDADMSCVV
FT                   CKTNLRNIVLWPCRCFALCEECRVSLGLRGFKACVCCRADVHGYSRLNAV"
FT   ncRNA           818269..818365
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR30"
FT                   /product="AgSNR30"
FT   CDS_pept        complement(818582..820354)
FT                   /codon_start=1
FT                   /gene_family="HOG000230372" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082779"
FT                   /locus_tag="AGOS_AFR213C"
FT                   /product="AFR213Cp"
FT                   /function="IMP cyclohydrolase activity"
FT                   /function="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase activity"
FT                   /biological_process="IMP biosynthetic process"
FT                   /protein_id="AAS53584.2"
FT                   /db_xref="GO:0003937"
FT                   /db_xref="GO:0004643"
FT                   /db_xref="GO:0006188"
FT                   /db_xref="HOGENOM:HBG236844"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR013982"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI0001DB2B9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q753V9"
FT                   /transl_table=1
FT                   /translation="MVYSKTAILSVYDKTGLLDLAKGLAENNVRILASGGTARMVREAG
FT                   FPVEDVSSITNAPEMLGGRVKTLHPAVHGGILARNLESDEKDLKEQGIEKVDFVVCNLY
FT                   AFKETVAKVGVTVEEAVEEIDIGGVTLLRAAAKNHSRVTILSDPRDYSQFLSELSKGEI
FT                   PEDMRNKLALKAFEHTADYDAAIADFFRKKYSEGKSQLTLRYGANPHQKPAQAFAALHD
FT                   ELPFKVLCGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVGLPLSDVE
FT                   KHVYFVAEIENLSPLACAYARARGADRMSSFGDWIALSNIVDVPTAQIISKEVSDGVVA
FT                   PGYEPEALEILKKKKSGKYCILQIDPNYTPEPLESRQVFGVTLQQKRNDAIINKSSFKE
FT                   IVSANKDLPESAIVDLTVATIALKYTQSNSVCYAKNGMVVGLGAGQQSRIHCTRLAGDK
FT                   ADNWWLRQHPRVLAFKWAKGVKRPERSNAIDLFVTNQVPTEEPEKSEYESKFEEVPTPL
FT                   SEQEREEWLSKLNNVALSSDAFFPFPDNVYRAVKSGVKYIAAPSGSVMDKAVFAAADSF
FT                   ELVYVENPIRLFHH"
FT   CDS_pept        complement(820874..821488)
FT                   /codon_start=1
FT                   /gene_family="HOG000229584" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology