(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7

ID   ASHGO_7; SV 4; linear; genomic DNA; GRV; FUN; 1800949 BP.
XX
AC   AE016820_GR;
XX
DT   01-SEP-2009 (Rel. 111, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 19)
XX
DE   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-
DE   1056) chromosome VII, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Eremothecium.
XX
RN   [1]
RX   PUBMED; 15001715.
RA   Dietrich F.S., Voegeli S., Brachat S., Lerch A., Gates K., Steiner S.,
RA   Mohr C., Poehlmann R., Luedi P., Choi S., Wing R.A., Flavier A., Gaffney
RA   T.D., Philippsen P.
RT   "The Ashbya gossypii genome as a tool for mapping the ancient
RT   Saccharomyces cerevisiae genome.";
RL   Science 304:304-307(2004).
XX
CC   This Genome Reviews entry was created from entry AE016820.4 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1800949
FT                   /culture_collection="ATCC:10895"
FT                   /organism="Ashbya gossypii"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /strain="ATCC 10895 = CBS 109.51 = FGSC 9923 = NRRL Y-1056"
FT                   /strain="ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome VII"
FT                   /chromosome="VII"
FT                   /db_xref="taxon:284811"
FT                   /db_xref="taxon:284811"
FT   source          41146..102189
FT                   /clone="BAC clone bAG2526"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          64936..135462
FT                   /clone="BAC clone bAG1221"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          102795..170796
FT                   /clone="BAC clone bAG1631"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          148009..214350
FT                   /clone="BAC clone bAG2250"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          209294..282254
FT                   /clone="BAC clone bAG2502"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          267867..330021
FT                   /clone="BAC clone bAG1879"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          288962..333184
FT                   /clone="BAC clone bAG2524"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          322838..390417
FT                   /clone="BAC clone bAG2530"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          776051..817915
FT                   /clone="BAC clone bAG2156"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          796619..856748
FT                   /clone="BAC clone bAG2220"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          817013..881212
FT                   /clone="BAC clone bAG2041"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          870038..940236
FT                   /clone="BAC clone bAG1112"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          896623..966110
FT                   /clone="BAC clone bAG1833"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          937863..997453
FT                   /clone="BAC clone bAG2181"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1002044..1056382
FT                   /clone="BAC clone bAG2476"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1037893..1112921
FT                   /clone="BAC clone bAG1734"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1092855..1184307
FT                   /clone="BAC clone bAG1947"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1172760..1246096
FT                   /clone="BAC clone bAG1429"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1245982..1299774
FT                   /clone="BAC clone bAG1303"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1270386..1344162
FT                   /clone="BAC clone bAG2278"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1322693..1397112
FT                   /clone="BAC clone bAG2269"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1368500..1426712
FT                   /clone="BAC clone bAG1109"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1429177..1498731
FT                   /clone="BAC clone bAG1736"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1467267..1530034
FT                   /clone="BAC clone bAG1365"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1520198..1563680
FT                   /clone="BAC clone bAG1431"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1541918..1623396
FT                   /clone="BAC clone bAG2334"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1610289..1689834
FT                   /clone="BAC clone bAG1339"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1660529..1722281
FT                   /clone="BAC clone bAG2324"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1689787..1737757
FT                   /clone="BAC clone bAG2027"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1718904..1762665
FT                   /clone="BAC clone bAG2165"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1737756..1787598
FT                   /clone="BAC clone bAG1989"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   CDS_pept        3308..3979
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749015"
FT                   /locus_tag="AGL369W"
FT                   /orf_name="AGOS_AGL369W"
FT                   /product="AGL369Wp"
FT                   /protein_id="AAS54121.1"
FT                   /db_xref="HOGENOM:HBG059736"
FT                   /db_xref="UniParc:UPI00002532F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q751S3"
FT                   /transl_table=1
FT                   /translation="MMCMVVPAECLMKRSKWKLKALVLCSIYLILIDPALLCASGLLLN
FT                   LFPSVKSWSQDDITKYTFWEACAMCPFVACVPIPVIFKLAFKRVPHQEKEAASSLDGYD
FT                   RVSGTDAEPQGNSFGWKLCKVFYIYCSLCSLAQAFLAISSYPDLVKSELFGKSTLYSRA
FT                   LVGTLFFQSVALLCSLFCNFYILNSGERRELYLAGAISLCSYNFLYICHDYIVVAVGLE
FT                   N"
FT   CDS_pept        6032..7165
FT                   /codon_start=1
FT                   /gene_family="HOG000144380" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749016"
FT                   /locus_tag="AGL368W"
FT                   /orf_name="AGOS_AGL368W"
FT                   /product="AGL368Wp"
FT                   /protein_id="AAS54122.1"
FT                   /db_xref="HOGENOM:HBG025195"
FT                   /db_xref="HOGENOM:HBG058532"
FT                   /db_xref="UniParc:UPI00002532F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q751S2"
FT                   /transl_table=1
FT                   /translation="MLRDIWGLRAARPSQSHRLRDICGGVPAHASDHSGQARAFSGEAC
FT                   NLPVRHENCQLNLLFTLARCHVVSGMLRDIESNTSIEEHKVDEVKDNTLKRYQYRTAIC
FT                   LLFCYVCHVAFCNCVLARSLQLPQDKDSEELLDKLNGYAIFSCHAVGLITLTREPAERL
FT                   MNRWKLTALALCSIYLVIFDPELLFVSGWLLNFFPSVKSWSLGNIAEYTTWEACAMCLV
FT                   VAWVSVPAIFKLAFKRVPHKEKEAASSLECCDRVPGTDAESQDDRISFLNGKLGKVFNV
FT                   VFLFGLLHQVFLVVRSYLDLVKSESFGNSVLYSCALVAVSFLYLVALLSTLFCTFYMLT
FT                   SKKIEGPFISICFHLFCSYNFLYYCQRFIISTVSLVG"
FT   CDS_pept        complement(10794..11414)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927756"
FT                   /locus_tag="AGL367C"
FT                   /orf_name="AGOS_AGL367C"
FT                   /product="AGL367Cp"
FT                   /protein_id="AAS54123.1"
FT                   /db_xref="HOGENOM:HBG059849"
FT                   /db_xref="UniParc:UPI00002532F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q751Q7"
FT                   /transl_table=1
FT                   /translation="METQPLLKTSDHMRLAIKISDCLLHWGPSIIFCKAALALFFYTLY
FT                   IPFSTCCLAKAHSLNESDVFTERLHYIGTVDLMAIGGAAMAFITTNAMLEDFIANITSL
FT                   KWNGPIGDPDFRRIITLRLVIILPLWIWQFPVWFPALGIKVGSLLLHFLPLVDSWHEEG
FT                   ILIFYATSSAAMLVYMIYSYVASHFTKSPKEGTFESEEESLSV"
FT   CDS_pept        12573..12719
FT                   /codon_start=1
FT                   /gene_family="HOG000034188" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774746"
FT                   /locus_tag="AGL367W-A"
FT                   /product="Putative ATP synthase protein 8-like protein "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="AAS54124.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059889"
FT                   /db_xref="InterPro:IPR009230"
FT                   /db_xref="UniParc:UPI00002532F5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751Q6"
FT                   /transl_table=1
FT                   /translation="MTPQIIPFFFMHQFTYGFLVILLTLLLLSYAFLSMILRLYLSRIY
FT                   LSK"
FT   CDS_pept        complement(14796..15518)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749017"
FT                   /locus_tag="AGL366C"
FT                   /orf_name="AGOS_AGL366C"
FT                   /product="AGL366Cp"
FT                   /protein_id="AAS54125.1"
FT                   /db_xref="HOGENOM:HBG059951"
FT                   /db_xref="UniParc:UPI00002532F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q751Q5"
FT                   /transl_table=1
FT                   /translation="MYPIICKSLPSSFMLLLLLVTSVSCLFTGPAEVVKRLDSTPAAPE
FT                   NVIQEDSDPETAFMAIYRYGYAQDGPRTRWKEAGIIARTNIWTEWTPVTCCIERTEGMR
FT                   TLRGNYAINATWSWGSVSVEMEFPDVEAILGASVRRIVSEASSMICGVTRAGAIVQIQV
FT                   QIEMAKASFSLRDCSQDATGVQCTPWSDELSVSAPTGGITASCREVSNMQSSSCKIPGL
FT                   LCEFTALGDPLYQTTTSV"
FT   CDS_pept        complement(16191..17990)
FT                   /codon_start=1
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749018"
FT                   /locus_tag="AGL365C"
FT                   /orf_name="AGOS_AGL365C"
FT                   /product="AGL365Cp"
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54126.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG059453"
FT                   /db_xref="HOGENOM:HBG323814"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00002532F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q751Q4"
FT                   /transl_table=1
FT                   /translation="MNSAEPEPKNIEKKPDSSSFQNEIVTVCTQYPEELLEPTEEEEKR
FT                   LRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPGA
FT                   LGRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAAL
FT                   PAVIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILN
FT                   RDASLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNV
FT                   KVTPPLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGF
FT                   YKESLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPL
FT                   AIIITMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGK
FT                   HASTCSETIRQVSPLSRWLVGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFL
FT                   VTTALSSILTQIFNGIMTDPYLVIPFILFAVLGTLFAILFLYRYWNLDKVMEAERRERA
FT                   ILDPLEILAHNGPPDYDETKQKL"
FT   CDS_pept        complement(19123..22905)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774747"
FT                   /locus_tag="AGL364C"
FT                   /orf_name="AGOS_AGL364C"
FT                   /product="AGL364Cp"
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /protein_id="AAS54127.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="HOGENOM:HBG025333"
FT                   /db_xref="HOGENOM:HBG060065"
FT                   /db_xref="InterPro:IPR003104"
FT                   /db_xref="InterPro:IPR014768"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00002532F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q751Q3"
FT                   /transl_table=1
FT                   /translation="MSTRNFGLSPLTLSRLGKTPQELLSNSGPRCGVRKDHAIGGLKED
FT                   GRGTSRETETECTSKLKPCLYKNNLKNSTLFEVPDGSSRLEFNKGVIPDKTVVDMYFDN
FT                   LQCNSSSGRNSCNKVGKMSYKTKWELVCEEYNAQNGVISEQNPEHIEVDLRRLLAMLQK
FT                   DQQEIVSQGMWFQLEKQLRGRNACHYFIESNGIAIILRKLEAVTKETEYAYLRCFKTLI
FT                   SHEKGRLAILDNLEAIGMLCRFIANSEAQVRTRLLTTDMLLLLTYMDSVKVSKELDSVY
FT                   ALWFDTVTASINDLEQWHRSFTIQKPQQLIIDYCVSTMFLINSIVQGQATYSDKRKILV
FT                   LLNDAGIHTIFRIILRSGDRLSSEILLDQVSKYRSREAEINSKCATEGQIEPEKTFETQ
FT                   IKTIISLTQGTELGCSMAQLVDSVMQIITFRTSAEALKLLNLLQATFDHLLENYHKEQM
FT                   PSVEEALRSSISRLMDDLQAQQVNRRAVQEMEEMKQKMIEMKETMRRLGTLTHVQKYSG
FT                   VGPMIRGKSNQSKKMDYIAELEEKLEAIERQRKTGNRQSAVISDESTRKDTGSLSLFDL
FT                   QGASALLPYSNVARSSTIARSKRTCFASVLNAEKNRRSISGPEGITTADAENGYRCLIA
FT                   RSKHHRKLHETYPAPLDEQTDSKDLSAPSPVLSLASNVVGLQRRKPSTSTWDTKALPEN
FT                   SSKSDSSAASPNLITNEERTLQSPEALSEIEEKKEIGLASPMTPPPPPPPLPISLSATG
FT                   SFRCSLQGPVSPTSQRVKLKQIHWDKIDNIKETVWNEHNERISTSTKLETFGVFKEIED
FT                   LFKVVPATPKTASSNSPTQTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLC
FT                   HAEILQNQRVIEFFSKDDINHIPQSTQRMFAPYETNYLTGKTPDKDPAVLERADRIYLE
FT                   LFYNLRSYWAARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEI
FT                   GNYMNNKQALGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQ
FT                   DMANIIVQHVQQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKK
FT                   AELLIDQSTLTMGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKENIEREEI
FT                   RRSQVKRVIERVPSPEKTKSVARSTPLSVGTEVDEQHAVDVLLKRLRDVRYQEPKSSKD
FT                   HTEPYKSQTVRVRRQKEDGDLLSRTREMLMGVKKI"
FT   CDS_pept        complement(23487..25097)
FT                   /codon_start=1
FT                   /gene_family="HOG000066000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749019"
FT                   /locus_tag="AGL363C"
FT                   /orf_name="AGOS_AGL363C"
FT                   /product="AGL363Cp"
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54128.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG060107"
FT                   /db_xref="HOGENOM:HBG626339"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="UniParc:UPI00002532F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q751Q2"
FT                   /transl_table=1
FT                   /translation="MLLARIDNFLRLEDSNSMKNRDIVPIPLARRRWNMMSYLSYWSII
FT                   CLCMSTWTGAAALYDLGLNGPQSLGVVIVGNAIITAISICNSLYGSEYHIGYSVFQRIL
FT                   WGTNGAWFGVLLRSLLSVVWFAAQAWMGALCVNVVLSTFSSSYLNMKNTFPDSVGFRPD
FT                   ELIGFVIFLLLELPLLFIKPEYFDLMLIVSSVVTLVASFALTLWVCIMVGNQGTLMRAP
FT                   ITLSRSEHAWAWIFGINTWYSGLVAGLANQSDYSRFNRRPSHSHWGTILGINIAGIFVP
FT                   LLALFCTSSFAWKYEQTVVTPADICLLIMKEDYTPGVRAACFFLGLCFVVSQLSVTTVA
FT                   NAIPGGMDLSTIFPKYINTRRGALIVFLLAWPSQPWTYYSSGKAFLDVMSSFSVFITPI
FT                   IAMSVCEYYVVRNREIKLSDCYIRGPQSLYWYCRGINFKSIFCFIAGSALGVPGLIKTA
FT                   NPKAKMSKGIYDFYKGGFIFQFLITFAMYWIANLIFPSPVDGRDEADYFNTFTEEERKR
FT                   WNIAGADEKEEAELDASSY"
FT   CDS_pept        25591..26109
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749020"
FT                   /locus_tag="AGL362W"
FT                   /orf_name="AGOS_AGL362W"
FT                   /product="AGL362Wp"
FT                   /protein_id="AAS54129.1"
FT                   /db_xref="HOGENOM:HBG060114"
FT                   /db_xref="UniParc:UPI00002532FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q751Q1"
FT                   /transl_table=1
FT                   /translation="MVSEAVSCTREAPPESRKRRTKRRPQRIKQVGQSERLQKELQQAR
FT                   HLLGESLKLRSQSAQWSVFRICTPGICEEESCTFLVHVPHDYPCSALRVEPEGRGSGAQ
FT                   SRVAAHFNWRCKQQCTRDAPLAAQLNYLISERQLLATPDYVARERLRKSFYALFAAPTS
FT                   GCGGVDGER"
FT   CDS_pept        complement(26363..28453)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749021"
FT                   /locus_tag="AGL361C"
FT                   /orf_name="AGOS_AGL361C"
FT                   /product="AGL361Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54130.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058382"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00002532FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q751Q0"
FT                   /transl_table=1
FT                   /translation="MDILTIITNQPSKEGRTREAKSQSYPNRLSFQAAPQTNSSADMLE
FT                   TLKSKKPKVQYSRKGCSQCKKSHIKCDKVQPLCTTCAKKNILCTYELSFVFEDGSSKRK
FT                   ILKRLPKTKKKRPQEIVTPLSLASNSTSSLSTSSRSQSLSQMLPAVAVLHAEQECVRGN
FT                   VRRASMDDTSDAQNQRSSTTSAGISNFSFESDQFDIQNFLDTSPADLILFDNAEFELNA
FT                   WTEQQTHAGWKMFTFDWRDADWPEVMKLLEAYDPIQHGSPVSQPCAPTDLGVDPSELNR
FT                   FVWTMARSTQLFGNFAIFPNDKMEELINVLWIINLHYGVIQDALTYGCGMFIKEVYERA
FT                   NYQTFAYHWGMIAMSSKESVSFDLLNTQLLKAVVFTDFVAVLFAYFLAIASNSTCERFE
FT                   WDTYFPQGYHVIRHVRTLIPLSGCMSELERAAISAFGVLEDWFCQAEVIAQVISDKGGA
FT                   LSERTELEYLLTKVPPLLTSYQNKYDLMKGCFHNFNAIFLKLCLKLTDLKDRGVQLGGR
FT                   HMIEYKLLNTNTSLALELHAFGSTLLEELEAIQPSKTELRQACNGIADHRLQHAMKNSH
FT                   EMYFIGLQLYLKALFMDTPLNSPELVELLERMLEAGQNITYYSAKTICCHLFAFLGAEV
FT                   ALLINNRSLFKSFMGLLKTIADSGTAAAKNSMRRLNYISLVLETRSYTLLVNPIYNNGI
FT                   DL"
FT   CDS_pept        29577..30662
FT                   /codon_start=1
FT                   /gene_family="HOG000294663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622187"
FT                   /locus_tag="AGL360W"
FT                   /orf_name="AGOS_AGL360W"
FT                   /product="AGL360Wp"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS54131.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00002532FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q751P9"
FT                   /transl_table=1
FT                   /translation="MVSAKQWVLKNEADPNHDFNFDMGTSGSTFEMLDVELSSEQVKEG
FT                   QLLVQTQYLSNDPAQKFWICSGDKNYAAGVAIGEVIPARGIVKVLFSRNQNVKQDEYLA
FT                   GPIGWRTHAVIEDVSVYSKVSLRAVGELWGHLSVLGSTALTAYFIFKEYLNVAQDESGH
FT                   HKVFLISGAAGSVGSLCIQLALNVYKASKVIAVAGGAEKVKYVESFGQQVVGVDYKDPE
FT                   FKKNLLAASGGANTVDYFIDNVGGDILDIGIDLLKVHAVITACGSISGYTDASKFVLKN
FT                   SSRILTKRLVIKGMLVTDHANKFPEAIEQLASYVQSGEISLEKSATIRDATGDAFKDVP
FT                   LIWRGLFQGINKGKLITKVSA"
FT   tRNA            join(complement(30872..30907),complement(30795..30830))
FT                   /gene_name="tRNA-Pro"
FT   CDS_pept        complement(31314..32441)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622188"
FT                   /locus_tag="AGOS_AGL359C"
FT                   /product="AGL359Cp"
FT                   /protein_id="AAS54132.2"
FT                   /db_xref="HOGENOM:HBG059750"
FT                   /db_xref="UniParc:UPI0001DB2AA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q751P8"
FT                   /transl_table=1
FT                   /translation="MEAATINEEQVISERDLEKLPVSRNVSRGWAVRKLAILYFLLASF
FT                   AIGTVHLFQSGYMGANSKSPQIGRWQLFAENSQGLTKRSRWAMIAEKHHAPLLAAASLS
FT                   TAVEPNVCPPDGRRCMGELITRLLLQSLAIAQDLYGGEWKITQPHPPYNNNKRSLSNYA
FT                   FETASELSTQIKSRADTLAALNINLVGRFRSNDPNGLAKRGEEDSEDTYMIETPHGYHL
FT                   LSPLTTTAGAMFDEIIEQTKSQTVGTIEAARVPSPNVSLKKRDPIRFNVEWISYQWGKS
FT                   YFYGGMTIPDLHGELLSNFEPVNQYLRNARAWKYCASVHRNIDPSRVTYDSFNIDTGSI
FT                   YGELYFNTYGPVDKFCLDEKGGAQCPGEACDGTNN"
FT   CDS_pept        complement(32992..35412)
FT                   /codon_start=1
FT                   /gene_family="HOG000094405" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774748"
FT                   /gene_name="YME2"
FT                   /locus_tag="AGL358C"
FT                   /product="Mitochondrial escape protein 2 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS54133.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059754"
FT                   /db_xref="HOGENOM:HBG397948"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018850"
FT                   /db_xref="UniParc:UPI00002532FE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751P7"
FT                   /transl_table=1
FT                   /translation="MMFLEMQRAFMLHGRRAVTRSAVGVRYISEDIQQKDAQAGEKATA
FT                   TATGVIYKSDEETLMYFDNVYPRATSLWRPTQWYNILLSNQSREAVREKIMRLASPASN
FT                   PVHGLELRSTIPIKRDGGVFATFRVPREYTRAQVNALIQANTQQESSKSLLAAFTRAAA
FT                   FPVKGVPWIEDLKRLPNNVVRVEVEGPALSEEELYSLFRRYGTILDIYPAGKNGYATIR
FT                   YRSFRGAICAKNCVSGIEINGSTLHVKFEPVVRAHAIRDFFVNHPRIAIPLLIALLSIC
FT                   AVLIFDPIREFSIEQKITRMYTLSRDNFVVKSILRLTSYTVSSVKHLWGYDDDQPEKRQ
FT                   LWQERVEKVNDLKMWLEENNNTFVVVTGPRGSGKHELVMQHTLHDRPNVLYLDCDTLIK
FT                   SRTDSKFLRNAAHQIGYFPIFPWLNSVTTLVDLAVQGLTGQKSGLSESKETQFRNMLNT
FT                   AMMSIRHIALSGYKATLHSGDDVTTVKEEDYLQQHPERKPVIVIDRFSNKAEINGFVYK
FT                   ELADWASMLVQMNIAHVIFLTESVSPNQLLAEALPNQVFKFLFLSDASKDSARSYVLSQ
FT                   LYPSSPAYSEKMPAADADANEEYRKEIDRALEPIGGRMLDLQAFVRRVKSGEEPSEALE
FT                   KMVEQASEQITQIFLSERSEPIKTAQAWELIELLSQNDVVKYGDIVFRPLFKSSPEAGL
FT                   LELEKNGLITISRNRGVLQDIRPAKPLFKAAFSYLLQDKDLSIVLRTGYYLRLIAFETG
FT                   RIKKWEEELRLLAKVSDQRICKSRLNYLASKIDASSGVINSCEDKVKEMSKRI"
FT   mat_peptide     complement(32995..35337)
FT                   /gene_name="YME2"
FT                   /locus_tag="AGL358C"
FT                   /product="Mitochondrial escape protein 2 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751P7 "
FT   transit_peptide complement(35338..35412)
FT                   /gene_name="YME2"
FT                   /locus_tag="AGL358C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751P7 "
FT   CDS_pept        35645..39145
FT                   /codon_start=1
FT                   /gene_family="HOG000160240" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749022"
FT                   /locus_tag="AGL357W"
FT                   /orf_name="AGOS_AGL357W"
FT                   /product="Ubiquitin carboxyl-terminal hydrolase "
FT                   /EC_number="3.1.2.15"
FT                   /function="cysteine-type peptidase activity"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAS54134.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="HOGENOM:HBG028491"
FT                   /db_xref="HOGENOM:HBG385658"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR013322"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI00002532FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q751P6"
FT                   /transl_table=1
FT                   /translation="MDVPETRETNMEAVELGKTFEEVLPPLEGEETEYEGRFTWRIERW
FT                   SELRGEKHYSPRVQVGRWEWDLLVFPHGNSTKGIAMYLAPHPVQAEADWYVCAQFAIVL
FT                   SRPGDDARTQLVSRSQHRFNAVDKDWGFSNLIELEHLRFATRGRPSGFLSGDQLNVTVY
FT                   VRVLRDPTGVLWHNFANYDSKKVTGYVGLKNQGATCYLNSLLQSYYFTKYFRKLVYQIP
FT                   TEGETPANSVSLALQRAFFQLQRSSEPLDTCELTRSFGWDTGDAFTQHDVQELNRILMD
FT                   RLENKMKGTEVEGKLNGLFVGKMKSYIKCVNVDYESSRVEDFWDIQLNVKGLKGLQQSF
FT                   ENYIEVEMMDGENQYAAQGHGLQDAKKGVLFESFPPVLHLQLKRFEYDFNYDQLIKIND
FT                   RYEFPESIDLSPYLDPEVQEDSPANAKYNLHGVLVHTGDISTGHYYAMIKPGLEDAWYR
FT                   FDDDKVWRVTKKQVFEQNFGFDKLSEYDLRSLTKEQYQNYLIARQTSAYMLVYIREDME
FT                   STILQEVTDADVPEYIVNTIEEELKERERFQKEREEMHLYAKVYVHSMKNFIHYQGYDL
FT                   SPNERSKLYIPELHGEDEYALSVKLPKNTKVKEIYTLFNEKLGIKRTDLVRYWTINYRT
FT                   NTSLRLDLPILPSYDEMTLESLMTSQGRNTAIDLFVEESYFDLGYIHSIWDELDTSQNF
FT                   ADVLQQVKDMVNEGLLPSSETYIREKDQTQILLLVKKFDIGAQRLTGLGHILLSQYSKL
FT                   SQLGTILSKLLNISEEITFVEEYGPDGVETVDNHTELVRTELMDGDIITFAINPAEESL
FT                   TYPFYSSIIEYYDYLRNRVKLKFTKTMSYDEEYVLPDNDGPNEFEFWISVKCTNEELAR
FT                   VVSKYVNVSPEYLRLYAIYSNGKFSMESGSLLTDYLVKRYNRNSIPPFGYEVLTIPLKE
FT                   LEHLRSIKFYWLEDSYVHFQSYEFRVANSSTVSEFLDKVQARIGFDDEKKKQVLLWTNS
FT                   DFRFQGILSLDSKIESIDDSFLIFARVLPEEVSVVYHLEQLPSAEATDKSSENDLSISK
FT                   HSNAEETIVIVQQYFKDWENKHGISFLFTLLPGETFPETKKRLHERFGLGQKEFSKIKL
FT                   GILYNTEEGPIFKSLSSDDEEVGEIVLHDLMNNLDFITMDHPDRSRNQTHQDRPMMIKN
FT                   "
FT   CDS_pept        complement(39218..40081)
FT                   /codon_start=1
FT                   /gene_family="HOG000000944" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927757"
FT                   /locus_tag="AGL356C"
FT                   /orf_name="AGOS_AGL356C"
FT                   /product="AGL356Cp"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="AAS54135.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG059765"
FT                   /db_xref="HOGENOM:HBG396472"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0000253300"
FT                   /db_xref="UniProtKB/TrEMBL:Q751P5"
FT                   /transl_table=1
FT                   /translation="MSSVAVVLNNATTIDAGPELRGVFERCVPFLDAQRSVLDIILLEP
FT                   FDSPTSLDLTLLKIYGTSRNILLKQKLYTTPINVLFNVSMEAYSRMKWDVVFLSDRLLQ
FT                   DAFPHRQIELFDSPAMAAAGPVESGGRDKYAVSALGGTFDHLHDGHKILLSVAALVTAS
FT                   RLIVGITDEELLRNKKYREQLQSFDERCDNVCSFLHRLKPGLEIKIFALHDVCGPTGSE
FT                   PGIEALVVSEETVAGAQTINDTRESKGMRKLAVHVVNVLGGEEADKWKNKLSSTELRRR
FT                   LMNEDS"
FT   CDS_pept        40239..41903
FT                   /codon_start=1
FT                   /gene_family="HOG000112091" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927758"
FT                   /gene_name="CWC22"
FT                   /locus_tag="AGL355W"
FT                   /product="Pre-mRNA-splicing factor CWC22 "
FT                   /function="binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS54136.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG371314"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000253301"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751P4"
FT                   /transl_table=1
FT                   /translation="MDEELQLKNWTELHNHIKSVLDRLDESRINESFQELLEVNVIRGR
FT                   GILASEVVREERVVRQGAVLGALVELFEDYIPELGIMVSREALLLFLKSFRGGRTKYCY
FT                   GLLALLCQLCNSDVMHEIGLLQLADLLLEVPRDRAVGMLCFMLGQAGAHLMNVCRTAHD
FT                   QLLARLTDMLHDGKLSPTSSNRIQELLRLRRSNYKGQATKFSLPDHGVCTHRVTLELDI
FT                   PARLEPDSSLGKFYVDNQFFDTEERFAALRRQALERFLGQQQQQAEPVKDMTNAEEVQY
FT                   KKQIYLILKGSLTGDEAAHKLLKLRPDASQKATIVEIVVKACAQEQTYTKFYGILAERL
FT                   CGSHRNWPTSFTNLFRDLYGTLHEFEPNQLRNMGKFWGHMLAADHIGLNLFECVHLSEH
FT                   RTTPSSRVFLKFIFQELVADLGIAEVRKRLEDENAQPLVQGLFPKEGNADTVFAINYFT
FT                   AIGLGVLTESMRTSLPTQAKSDSGNMSPNGQTLSYPSSRVPRRTRSRSPPRTRVRGDSP
FT                   QRARVEQRYSRYDPGPAHRDRRRSRLSVTPPPRRNIH"
FT   CDS_pept        complement(42205..43560)
FT                   /codon_start=1
FT                   /gene_family="HOG000216601" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749023"
FT                   /locus_tag="AGL354C"
FT                   /orf_name="AGOS_AGL354C"
FT                   /product="AGL354Cp"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS54137.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG397417"
FT                   /db_xref="HOGENOM:HBG540127"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000253302"
FT                   /db_xref="UniProtKB/TrEMBL:Q751P3"
FT                   /transl_table=1
FT                   /translation="MRFTKLISSSAVVGLACASEVAHEHHDRRAVAYVTNYRTTTVWAK
FT                   APMTIAGSSTTLVMNSDMARPTGPATESYSAVSREGAVPVPQQSSSGSSVSSSWTPVAT
FT                   PAVTPVEAPSGTPVAPPAAPPVETPVETPVSSSSVPNVPSSSSAPSSSSAPSSSYSEPP
FT                   ASTPATPASSSAASTVSSASASASASDEAGHHLFGAGARGITYSPYASDGTCKSPAKIT
FT                   EEIKTLSSFPVLRLYGVDCAQVETVLQAKAPGQKLFLGIFFVDQIEAGVKAIKEAVQKH
FT                   GSWDDIDTISIGNELVNNGQATVDQMAGYMKTGRKCLAEAGYKGPVVSVDTFIAVINNP
FT                   GLCDLSDYMAVNAHPYFDFHTSAAMAGPWVLHQIQRVWSACNGNKKVVITETGWPTQGQ
FT                   TYGKAIPSKANQKMALESIKATCGDSAILFTAFDDYWKPDGPYGVEKFWGML"
FT   CDS_pept        44040..49382
FT                   /codon_start=1
FT                   /gene_family="HOG000216604" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18078993"
FT                   /locus_tag="AGL353W"
FT                   /orf_name="AGOS_AGL353W"
FT                   /product="AGL353Wp"
FT                   /function="1,3-beta-D-glucan synthase activity "
FT                   /biological_process="1,3-beta-D-glucan biosynthetic process"
FT                   /cellular_component="1,3-beta-D-glucan synthase complex "
FT                   /protein_id="AAS54138.1"
FT                   /db_xref="GO:0000148"
FT                   /db_xref="GO:0003843"
FT                   /db_xref="GO:0006075"
FT                   /db_xref="HOGENOM:HBG056034"
FT                   /db_xref="HOGENOM:HBG332273"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="UniParc:UPI0000253303"
FT                   /db_xref="UniProtKB/TrEMBL:Q751P2"
FT                   /transl_table=1
FT                   /translation="MNFQNPSPALSQTDLQYPAWCQDDQVPVTKSELKDIFDDLARKFG
FT                   FQQSSKENMYHHLLTQLDSRASRTTAQAALISLHASYIGGDCANYKKWYFAAQLNLDEE
FT                   IGFSNMRLQGKSHKRNKRIAKEKGISIKEQQRLWKERQEEFMKNHPKIVMTPGERDDDS
FT                   SFKAADFKWKLRMRDLTPAQMARQLALYLLVWGEANQLRFTPECLCFIFKCAYDYDTRV
FT                   LEAGSKVPDKQEFAYLNDIVTPIYRFLRNQIYEVGLRGKLLRRDNDHKDIIGYDDVNQL
FT                   FWYPEGIERIVLKNGDRLVDKSAEERYEYLREVAWDKVFYKTYRESRSWMHCATNFNRI
FT                   WIIHFATFWFFTSFNAPTLYTKNYIQLLNNQPTMQSRFSAIALGGAVTCLVQIVATLFE
FT                   WTFVPREWPGAQHLSRRMLGLIICFVINFGPSVYVFGFFDLDEHSRSAYVISIVQFVIA
FT                   LTTTFFFAMRPLGGLFTSYLQRGKHKRRYVSSQTFTASFPKLTGRSKWFSRGLWICVFV
FT                   AKFLESYFFLTLSLRDPIRVLSILDMSRCRGDRLLRDFLCRWQPSITLFLMLLTDLVLF
FT                   FLDTYLWYIICNCIFSIMLSFSLGTSILTPWKNIYSRLPKRIYTKILATSEMDIKYKPK
FT                   ILISQVWNAIVISMYREHLLSIDHVQKLLYQQVDSIYQDKRTLKSPTFFLAQDDSTFKS
FT                   MEFFPRNSEAQRRLSFFAQSLSTPIIDPIPVECMPTFTVLIPHYAEKLMLKLKEIIKEE
FT                   SPKSRITLLEYLKHLHPTEWECFVHDTKLLAIEKSARYKHEKEEGSDESLSPSMSDSAP
FT                   VPAGINNDVLEARIKDLPFYCLGFGASDPEDTLRTRIWASLRTQTLYRTISGFMNYSKA
FT                   IKLLYRIENPSMIQFYAADEEALDNDLNAMANRKFKMVVAMQRYAQFTPDETECVEFIW
FT                   KAYPEIMVSYLLEEPNPNDPDGEPIYYSCLTDGTCSVDPKTGRRENVYKIRLSGNPILG
FT                   DGKSDNQNNAIIFYRGEYIQVIDANQDNYLEECLKIRSVLGEFEEMEMDNFIPYIPGIE
FT                   YQEQPPPVAIIGAREYIFSENIGVLGDIAAGKEQTFGTLFARTLAEIGAKLHYGHPDFL
FT                   NAIFMTTRGGISKAQKGLHLNEDIYAGMNAICRGGRIKHSDYYQCGKGRDLGFGSILNF
FT                   TTKIGAGMGEQLLSREYYYLGTQLSIDRFLTFFYAHPGFHLNNLFITLSVQLFFLLLLN
FT                   LGALNHETITCMYNKDIPITNLERPIGCYNLQPVLHWVTIFVLSIFIVFFISFAPLLIQ
FT                   ELLEKGIWKACSRFIHHLLCMAPLFEVFVCQIYSNALFSNVTFGGAKYIPTGRGFAITR
FT                   MDFHHLYSRFAATSIYSGSRIFLMLLFATTSMWQPALLWFWITVVSLSLAPFIFNPHQY
FT                   SFVSYFVDYRNFVKWLFRGNSRYHPDSWSSYVKSSRSQYTGYKKKLIGDKSELSVRDTK
FT                   KAAIGNLLFAEVLIPFFTVLFSVTAYTFINAQTGVSGVTPTHALIRLAIITFIPIIVNA
FT                   LVLGMLFGLSFAAAPILIYCCQRTGAAIAGIALCASVAVYIVDFELMWFLEGWNFTRAL
FT                   LLLITCINIQNFLFKIVSICILTREYKNNKSHIAWWSGKWYNTGIGWQVIFQPAREYLV
FT                   KIIESSFFAGDFILGHWLLFLQTPILFFPYIDHWHSTMLFWLKPGNLISGELIFTNKQR
FT                   KARRSIVRRYTLLYFLIMTIFIALLVAPIVAQQYVPDGAKLFSGSPLDGLAQPNNQDNN
FT                   DTDTKAPRTILRTTPRMPQFKTVR"
FT   CDS_pept        49847..51448
FT                   /codon_start=1
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749024"
FT                   /locus_tag="AGOS_AGL352W"
FT                   /product="AGL352Wp"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS54139.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056738"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001DB2AA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q751P1"
FT                   /transl_table=1
FT                   /translation="MLFNKLAAVAALGSLVTAATSSSGEVPEIVIKGNKFFYSNNGTQF
FT                   FMRGIAYQTDGHDGSGSNKYVDPLADFKTCSRDIPYLQQLRTNVIRVYALDGKKDHTEC
FT                   MKALADAGIYVIADLSEPSLSINRNSPEWSVELYDRYTQVVDELQKYKNVLGFFAGNEV
FT                   TNEVNNTEASAFVKAAVRDTKAYIKQKGYRKIPVGYAANDDAKFRDEITAYFACGSNEE
FT                   RADFYGFNVYSWCGDSSFEKSGYSDRTKEFSRLPVPAFFSEYGCNEVKPRKFTDVAALY
FT                   GDQMTDVWSGGIVYMYFQEANEYGLVTVKGDKVSTLSDFSYYSAQIAKASPTGVQSASY
FT                   TPSITSLECPTIADNWKAASSLPPTPSKDACKCMMDALSCVVNDSVDKEDYGKLFGYLC
FT                   GSDKKLCNGIAVDASKGEYGAFSYCSGKEKLSYLLNEYYKANGKSSSACAFSGSASLRK
FT                   PTEAATCAAVLSSASAGLPAGGNASGSSGAATSTGGSGEPKPSMGTANAKYNMLNVLIS
FT                   SAATLSVFMGFGLIFI"
FT   CDS_pept        52019..53683
FT                   /codon_start=1
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774749"
FT                   /locus_tag="AGOS_AGL351W"
FT                   /product="AGL351Wp"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS54140.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056738"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001DB2AA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q751S4"
FT                   /transl_table=1
FT                   /translation="MLQTAIYGTVACLLQAVVAQRNNGGAALSATAGTAPSIATSSPST
FT                   NKVPPIEIHGNKFFYSNNGSQFYMKGIAYQAETSDASASATINDPLADYESCSRDLPYL
FT                   LELNTNTLRVYAVNSSLDHSRCMELFESNGIYIVADLSEPALSINRNNPEWSLKLFERY
FT                   AGVVDEMQKYSNVLGFFAGNEVTNEINNTAASAFVKAAIRDTKAYIKEKGYREIPVGYS
FT                   TNDDSNFRQEIADYFACGSQEEKADFYGFNVYSWCGDSTFEKSGYSDRTKEFSNLGIPV
FT                   FFSEYGCNEVRPRKFGEVSALYGSDMTDVWSGGIVYMYFEETNQYGLVTVDSSGRVSTN
FT                   DDYNNLKTALATISPSSANKDSYTASSGSVACPTTGSNWQAATSLPPSPQKDVCDCIKS
FT                   ALRCVISPDVDQKDYSELFGYLCSEADVDCSDISADGTTGNYGAFSFCDDETKLSYLLN
FT                   KYYQEKGRSSSSACDFSGSATLVSATGTASTCVPTSTGINLGSSSSNSGSGRGDSTTAT
FT                   SSAAAAADAIQPNTFSMALFIPTALVFMLTGFGIAMS"
FT   CDS_pept        complement(53849..54856)
FT                   /codon_start=1
FT                   /gene_family="HOG000048630" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927759"
FT                   /gene_name="PXR1"
FT                   /locus_tag="AGL350C"
FT                   /product="Protein PXR1"
FT                   /function="nucleic acid binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS54141.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG190448"
FT                   /db_xref="HOGENOM:HBG396989"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniParc:UPI0000253306"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751P0"
FT                   /transl_table=1
FT                   /translation="MGLAATKTKQRFGLDPRNTTWSNDKSRFGHKYLEKLGWEPGKGLG
FT                   HASHAMSTHIKVTIKDDTMGLGAKLKKKEKKDEFDSGECAGLDVFQRILGRLNGKEEVI
FT                   ADELEKQRKENIINGKWGIHFVKGEVLSSTWDADTMQLKSYSYDKKEITADDAEDAKVS
FT                   GKHRDRKSRAKREKSNNAALKEKCRDIDRTRKSKRKEKEQEKEKNREKKHNGKEHKEKE
FT                   HKEKKDKKDKKEKKEKKEKKEKKEKKHKEKSNKRLRSSDSIDDPEATKPSKKSKTKAAD
FT                   SDNVTRDSMLQPRASAASPPPTISTRLSVRSKWIRQKRAAVMDPKALNEIFMVT"
FT   mat_peptide     complement(53852..54853)
FT                   /gene_name="PXR1"
FT                   /locus_tag="AGL350C"
FT                   /product="Protein PXR1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751P0 "
FT   CDS_pept        complement(55263..58541)
FT                   /codon_start=1
FT                   /gene_family="HOG000209725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749025"
FT                   /locus_tag="AGOS_AGL349C"
FT                   /product="AGL349Cp"
FT                   /function="binding"
FT                   /protein_id="AAS54142.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG380768"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB2AA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q751N9"
FT                   /transl_table=1
FT                   /translation="MSALSSDVNNTLINVLHGFGSADNNIRAAAEETLNNQWITEENIH
FT                   VLLVFLAEQASFSEDLTLAGLSAVLFRKLALRAPPSSKAVIIAKNITHISKEALEQIRT
FT                   TLLKGFVSERSNGIRHKLSDAIAECAQDDLPAWPELLRTLFEATKNQNPNFRESSFRIF
FT                   STVPHLINAIEITNALPIFEAGFTDTEDDVKIAAVTAFVGYFKQLPKMHWAKLGVLLPS
FT                   LLNSLPKFLDDGKDDALAAVFESLIELVELAPKLFKSMFDQMIQFTDMVIKNKDLETSA
FT                   RTTALELLTVFSECAPQMCKSNPNYAQSLIMDTLLMMTEVSIDDDQAIEWQNSDDVEED
FT                   DEETAYDNARQALDRVALKLNGKYLAPILFQYLQQMVGSAEWRERFGALMALSSAAEGC
FT                   RDVLIGEIPKILDMVIPLINDPHPRVQYGCCNVLGQISTDFAPLIQRTSHERILPALIS
FT                   KLTGQSVDRVQTHAAAALVNFSEHATQIILEPYLDSLLTNLLSMLQSSKLYVQEQALTT
FT                   IAFIAEAAEKKFIKYYDTLMPLLLSVLKTDTGKENRTLKGKCMECATLIALAVGKDKFS
FT                   AHSQELIELFISYQNEGVDDDDPIKTYLEQGWSRICRILREDFVPFLPIVLPSLLETAK
FT                   AGQDVSLIDEEEAKNFQQYTDWDVVQIQGKHIAIHTSILDDKVPAMELLQVYATILKNY
FT                   FAAYVPEIMTEIAIKSLDFYLHDGVRATGAGLIPVLFSSLVSATGVQNPNTVALWELAS
FT                   TKLINSIISEPMPEIVRIYHASLVDGLKIMGDNALTNEQLEKYTKGLSANLSDVFERVR
FT                   QRHGQEDEYNEDVDEEYEDFTDEDLLDDINKSLAAVFQTTNGVYLTHFQSVWPLIHMYL
FT                   QDSEVILTLFALVAISDMVHYCGDNAAMFKDSFAGKMKDYLVFPEPSIRQAAAYCIGSC
FT                   AQYAPNTFGEVCMASLDTLFLITTIPDAKSEDNISATENTAAAVAKILHSFGANIPTFE
FT                   TYVVNWLKSFPILQDEEAAAFNYRFLGHLIDSNNPTVHDKEKLGEIVDYVVQALHQKSI
FT                   SGKVATAVVDSTKKLLSAVPQEEALRYFQRYPSSIMQDIQTWFA"
FT   CDS_pept        58874..61063
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18078994"
FT                   /locus_tag="AGL348W"
FT                   /orf_name="AGOS_AGL348W"
FT                   /product="AGL348Wp"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54143.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059812"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000253308"
FT                   /db_xref="UniProtKB/TrEMBL:Q751N8"
FT                   /transl_table=1
FT                   /translation="MSSKAEQFGRIVSKIELLEAAVNGMARKLSEGDASHGKERRQRDS
FT                   SDGHASQKRRKTAYWGLDSSGVYQEDVLGSGKLGPVDMLASASVGNGDSEGGDSNKGCD
FT                   AGPDSAVTELFTSPFAVPEDPLLARDSQSGVGMACTNLILTPKGLEWLKSKCLNSDFDL
FT                   QCLTQCYHAAFQQKDAHICKIPTAPRELPEASILERLLDIYALSGAPVLSVISAQCTIE
FT                   IYAKYKFGGVAAMKATEVMVLNIVFALACLIIKLGVVEEGTISLLALNVSPQELQEYEN
FT                   IFIANALRYTHRTTVVPEGLLSVKAILCLITYTSFSGALHASYILVAIAARLAQDMGLH
FT                   ADIMLEDLTPEEQYNRRSIWWLCRFFDLRLAITLGKPPVIASFDTNTKIPAMNNKIELL
FT                   ESVIYGSSEGVGDYDIDFTRQLYKMVLQSEGFIAIARHYIYKLCLITSQMYEQICASSA
FT                   KMEPKTQLKIATKLIAQLEKYRLSLPENMRPGTKEDDLDAIIANQNLSQNSLFWLVYEI
FT                   QLSFLIDMMMVHRSQYKAQTRLYKQGKIDVEPEYKCVEYARDILLCIVRVKLDYVSIIM
FT                   RSKPWAFLLAFFDIYVYSMVHHTNAKIIEKDMQLLIKAYNSLAQGLTPNSNIENEYQMG
FT                   PSYRDKNSLTQIKNVLLIFKCLLNILRSTLEAKLCIKFNLPGVEQVLQYTELDQNFFQT
FT                   PIVDNVILNSDIMLNPFATGIGFEETAEGYCGFFR"
FT   CDS_pept        complement(61187..63076)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927760"
FT                   /locus_tag="AGL347C"
FT                   /orf_name="AGOS_AGL347C"
FT                   /product="AGL347Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS54144.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG059819"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000253309"
FT                   /db_xref="UniProtKB/TrEMBL:Q751N7"
FT                   /transl_table=1
FT                   /translation="MDGGCADGGQVKRAGRPASVGRQIAMASGTSGHVLAVSALPLDRP
FT                   VFCAEDEGVLEVVRRLQAEGGHCALVGDGGRVAGIITTKDLALRGRGSARERRVRDVVT
FT                   WGAVTVDEHAPVNAALELMVVRRLRHLPVLQAGSREVLGVLDITKCFQLAMAWLEWAAV
FT                   GGTRLQDVLSDVACGAADGRRRALGIARVVQQMEMPTLQWLLASRRYATGLAVASPTTT
FT                   VREALALMRRLDTTAVLVRDVEPLAAGAQGLPSPHVRPGRGADAYTVIGIFTSKDVVCR
FT                   VLQQGLDPETDGCTLARFMTSWPQYAAETEGLHSALLMMHDGHYLNLPVVKTTGAIVGL
FT                   FTVLQLTHAALSWCLEGRLQGDSLHVGGASCAVKKETGDPGAHGRLTRADQWYNLVGEH
FT                   DYIYFLQSFDTSDYACSISSSSSQSPTKMQQSCLVSHRQLDTISNPELEFTNVRLSPQH
FT                   TRFRRPGFCKRQRTLLQKDFFGNCASGTHTCRVAVVLADGDGSNFINSVRVLVRGNGLD
FT                   SFRRLIVKIDATLKLGSAIGDSDMYHINCPDKLIKCEQDFQDILKLHFKTAGYGSDIPL
FT                   ILKLKRYSKPGWGLSLLNWLISRFQALRSVAESSWMKFGVFFMLGVGFGKMLL"
FT   CDS_pept        63491..67693
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749026"
FT                   /locus_tag="AGOS_AGL346W"
FT                   /product="AGL346Wp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54145.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001DB2AAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q751N6"
FT                   /transl_table=1
FT                   /translation="MTAALADEYNEDAKRGTSSIRRSTASFSESGSDFLNSGDREKLGD
FT                   STLQPQRRLFSWVHGKDLPPVPDEEERERYPLYRANPLSRMMFWWVVPVIRVGYRRTLQ
FT                   PNDLWVVDGSLGVDEMYKRFVRHFRRYVQRAEAQYRLEHPEATQEEIRTNARMRNNDLL
FT                   RALCITFRWPLFLALLNAAVTNLLSCAQPLVTRAIIRHLDPHSRESVGVGVAYAICACV
FT                   LLFINGYSFNHMTHQSMRTALQIRTVLTKAILGKALVLSGKARNEWPPGTLISMASTDL
FT                   SRMEFAVFFQPFLLVFPLVLALGVALLLVTVGPVGLLGLAVFIVALGLATLAFRKMVKY
FT                   RVAATVFTDARVTLMREIMNSMKMLKYYCWERAYEERVTDVRYKEVHKVRQMMIFRSIL
FT                   VTTAVTLSTIAGMVCFLAMSHLNSENRNAANVFSALSLFQALSIQLFFIPTALSTGADA
FT                   KIALKRIQKLLWASEQSHRQDDSSDKLGPLDPSVAIQVESASFEWEGQKDSDLKGAQKT
FT                   EDDSVQSDTVTVLSKKREEKQSREEVFKVPFTGLNDLLFSIKKGEFIIVIGAIGTGKTS
FT                   LLNAVAGYMKKTTGSVHVNGSLLFCGVPWIQNATIRDNIIFGSSFDQTRYDEVVNACAL
FT                   EADFKIFPAGDKTEVGERGITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAH
FT                   ITQKCLLDRLQNRTRILATHQLALVQEASRVIFLGQDGSFDMGTPAELHEKNSQFRNLM
FT                   SLSSQTNAEESEMESIRSQSKSKKASTAPVSMPDFNEEIDDGRITSKEERAVNALKFKV
FT                   YKDYLMAGEKSSKMLIVTVLITLVLMTTFFSLFNSVWLSFWTEYRFPGRQDAFYMGIYF
FT                   MLTCLTFIFTNLEFTFLLHIGLSASRRLNLSAAKRILYAPMSFIDTTPMGRILNRFTKD
FT                   TDVLDNELTDSTRMFVFQMANVVGVFILSIAYLPYVAIAVPISVLLLLFIGDHYQSAGR
FT                   EVKRLEAIQRSFVYNNLGEVLDGLDTIRAYNAQSRFLRKSDYFLNRTNEAGYLVIGARC
FT                   WVALTTDLVAIAIALIVTLLCVTRVIHITPSSAGVLLTVVLQMPAYFNMVLRGFTELEN
FT                   NMNSTQRVHYYATALPQEAPQYLPGAAPPAGWPAAGEIVFQEVSFAYRPGLPLALCGVS
FT                   FHVRAGEKIGICGRTGAGKTSVTTALYRLSELESGSIKIDGVDIATLGLHDLRSALSII
FT                   PQDPLLFRGTVRKNLDPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGAN
FT                   FSLGERQLLALARALVRSTRILILDEATSSVDYATDARVQARIAAEFRQATVLCVAHRL
FT                   RTIISYDRILVLDQGRVAEFDTPYRLFAREDSLFRAMCVHTGISASDFAPAADIPSL"
FT   CDS_pept        68224..70116
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749027"
FT                   /locus_tag="AGOS_AGL345W"
FT                   /product="AGL345Wp"
FT                   /protein_id="AAS54146.2"
FT                   /db_xref="HOGENOM:HBG059828"
FT                   /db_xref="UniParc:UPI0001DB2ABA"
FT                   /db_xref="UniProtKB/TrEMBL:Q751S6"
FT                   /transl_table=1
FT                   /translation="MTALESGWLQAKNKDSAAEAYAGGHAWPHAEMTPAEEDEEEDEVF
FT                   SRLNSLSDSEDGTFGLSKVFYGPAAAGAVHGARNITYERGFEPQYALGPTEDQRLSLDC
FT                   ALFQTFADGPSSDTPASSTPASSTPASVGSVPWNAGIFDAWCSSLDSVVADNYAPVPAP
FT                   AAGAGRVYQRSQSVCTAMPPVECARMTGPAVGISPLQRGLSAGRVLKRDSAGSVRRGSC
FT                   SSLYGIPGAPAFPHTTHGTHHPAVYKYVAQAQLSMQCNTTKVEMANKSEWLPVSPMTPE
FT                   RSAHIIAKLQEKNVLLDTAYEVFELFPRQNFLSQKLELLAMEFEPHFAKNRTAEETTAL
FT                   MSEDAVALNKHIWLNQREKRSATQLKQFPRFTVREAPDNRAWPYQIEVRTSSGYNDFTA
FT                   QDERDLQLTHMDFLLMRLRHMNLLRESDDRKRKTKYYEFIEGKMKRPLNSFMLYRSALM
FT                   KALSILKVAKIVTDLVRAVSEELPTLDERAILGLLVETVKSRRGTTYLESPHIPRLSTL
FT                   IDEHLYKQQDARVSGSLSMAGRDPARVPVDPKFSNHTVLAQVITLMWNSESTDCREGFV
FT                   LFSKVEKNHHHLVYPKYKYCPVKKLKLEELERNLNITTFTPDLLDGFKNLHPAE"
FT   CDS_pept        complement(70446..72884)
FT                   /codon_start=1
FT                   /gene_family="HOG000029414" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749028"
FT                   /gene_name="NIP1"
FT                   /locus_tag="AGL344C"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit C"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="eukaryotic translation initiation
FT                   factor 3 complex"
FT                   /protein_id="AAS54147.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005852"
FT                   /db_xref="HOGENOM:HBG354580"
FT                   /db_xref="HOGENOM:HBG608917"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR008905"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000025330C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751S5"
FT                   /transl_table=1
FT                   /translation="MSRFFSRGYHYDTASSSEDEELLTSSEEELMSSSEEEVVSDDSFF
FT                   NDSESESAESDDDSDGKPYGPDWFKKPQFRKGGAPGGSGASRFLKGNADSSDESDDEGK
FT                   KVVKSARDKLLDELNNTYNKIDAAEMTQDWTTILSEFESATKLLVKAQQQNMGTPNVFV
FT                   RVVAQVEDLVAETSQAEIKNKIVAKAYNTVKQRVRKIARENEELLAKFRQHPEAFEKDS
FT                   TVEFGQARDFDASDLTLMGRKVADRSAIVSSPSDFFSALRIVIDSRGKKGTDIQAQIKT
FT                   MEELVSISKSPYESIIAYLNLIPIRFDACANLAYQPLEQWKASHNNVTSLLELLEANIE
FT                   SYHVTELAPRNEFIEEEPQPNENGVRMILGSVFTFVERLDDEFNKSLLNTDPHSSDYLD
FT                   RLRDEQSVYNLILRSQLYLEKVLPEDTASKHLCRSFVRRLDHIYYKTSKLVDIVERAAW
FT                   ASVPANSSSKYITYSDDPDYNFKLVNTLCTVVSSEQEMLKRRATLYQIYYYALNNQFSK
FT                   AKEMLVQSNVRNSINSQDPTIQILFNRVVVQLGLAAFKLCLVEDCHQILNEVSTASHLR
FT                   DIMGQQSLQRVSNNISSNGTVTPTEMLCLPFHQHINLDLIDAVFMTCSLLIEIPHMAAF
FT                   YSGIKVKRIPYSQKSIRRALEHYEKSSFQGPPETLRDHVIHAAKAMQRGNWAQCINYLR
FT                   SISTWTLLGDKMEKVLEQLAERIQIESLKTYIFTYKRFYTKLSVQKLSELFSLPTEQVI
FT                   SVIQTLENTINIKGSLNEAKEMLIFDKGDEITKLEEVAIKLTKETKYQSERLNNVSQRQ
FT                   "
FT   CDS_pept        complement(74634..75557)
FT                   /codon_start=1
FT                   /gene_family="HOG000207150" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749029"
FT                   /locus_tag="AGL343C"
FT                   /orf_name="AGOS_AGL343C"
FT                   /product="AGL343Cp"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS54148.2"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG540127"
FT                   /db_xref="HOGENOM:HBG683366"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000042B7A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q751R4"
FT                   /transl_table=1
FT                   /translation="MRFSATVSAALLGASSVHAMGDLAFNLGVKKHDGTCKYTQDYLDD
FT                   FEALRPYTDTVKVYSTSDCNTLQFLGPAADRAGFKLWVGVWPDDDAHFSMEKDALKTYL
FT                   PWIKSDTVRGFLVGSEALYRDDMPAEDLAKRINEVRNFVKDIKDINGNSFSGKPVGTVD
FT                   SWNVIVDGRSRPVIEASDLVMANAFSYWQGQTMQNASYSFFDDIMQALQTVQTVKGSSD
FT                   ISFYVGETGWPTEGSSFETSQPSLENAKQFWKEGICAMRSWGINTIVFEAFDEDWKPDT
FT                   SGISDVEKHWGVFTADRKPKFNLSCD"
FT   CDS_pept        complement(75751..77025)
FT                   /codon_start=1
FT                   /gene_family="HOG000094052" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622189"
FT                   /locus_tag="AGL342C"
FT                   /orf_name="AGOS_AGL342C"
FT                   /product="AGL342Cp"
FT                   /protein_id="AAS54149.1"
FT                   /db_xref="HOGENOM:HBG059843"
FT                   /db_xref="HOGENOM:HBG756731"
FT                   /db_xref="InterPro:IPR003750"
FT                   /db_xref="UniParc:UPI000025330E"
FT                   /db_xref="UniProtKB/TrEMBL:Q751R3"
FT                   /transl_table=1
FT                   /translation="MPPKRRSSRAEADPVAQAKKKAVLKPAASKVNKKAQKASKPAARP
FT                   KRPKKVLKVSSKTLNYTLCIPTSILDNCANLEQVTHALYQIAKAATLFNVGEIVVLDLG
FT                   TDTDAAAPHLAASELEPRKRKIKFEDVTEKTETSNKKSASRLSGAMLIATLLQYFVTPR
FT                   YLVSSVFKKKYSSYFNCAAKLPRLSALPFMRHLQTDQGRYREGLSVNMAKPAAAKKPST
FT                   RTKYINIGKDTMLELRSQQVPVNVRVTVDTVNKNVVSPAEAYGDYSGANAAYGYSVRVA
FT                   RTFADIFLGAGFAGGYTQSLWVNSADFFFDPAAQSSVRLDSKIPHVQKIIKPSLEELHE
FT                   QPSVQPANLLLVFGKWKHLSDKFQQTKDQFDGASGAHDLFDGRLDLPGAPEGYICIEDS
FT                   CMVALATLATYSVPTWSEPPVNSSL"
FT   CDS_pept        complement(77251..77820)
FT                   /codon_start=1
FT                   /gene_family="HOG000000770" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927761"
FT                   /locus_tag="AGL341C"
FT                   /orf_name="AGOS_AGL341C"
FT                   /product="AGL341Cp"
FT                   /function="protein phosphatase inhibitor activity "
FT                   /biological_process="regulation of phosphoprotein
FT                   phosphatase activity"
FT                   /biological_process="regulation of signal transduction "
FT                   /protein_id="AAS54150.1"
FT                   /db_xref="GO:0004864"
FT                   /db_xref="GO:0009966"
FT                   /db_xref="GO:0043666"
FT                   /db_xref="HOGENOM:HBG059850"
FT                   /db_xref="HOGENOM:HBG397087"
FT                   /db_xref="InterPro:IPR007062"
FT                   /db_xref="UniParc:UPI000025330F"
FT                   /db_xref="UniProtKB/TrEMBL:Q751R7"
FT                   /transl_table=1
FT                   /translation="MGGILKNPLSPHEQETHNAEPESVTEFRQQVLKNTRLNAQMTTRR
FT                   SSDLHNGAHGVPKDTLQLKRMHDEERLQWNQQNLDQNELTKQQFQDIHVDEPKTPYQGA
FT                   IDPEGEYYKHDDDDDDDGDLENFTLGDPEYSVPVPPVAQNGEPEGSQEADDDQAAQRRR
FT                   FEELRRKHYNVREAFSNRQLSEDEEE"
FT   CDS_pept        complement(78229..79149)
FT                   /codon_start=1
FT                   /gene_family="HOG000206959" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749030"
FT                   /locus_tag="AGL340C"
FT                   /orf_name="AGOS_AGL340C"
FT                   /product="AGL340Cp"
FT                   /protein_id="AAS54151.1"
FT                   /db_xref="HOGENOM:HBG016860"
FT                   /db_xref="HOGENOM:HBG388230"
FT                   /db_xref="InterPro:IPR002995"
FT                   /db_xref="UniParc:UPI0000253310"
FT                   /db_xref="UniProtKB/TrEMBL:Q751R6"
FT                   /transl_table=1
FT                   /translation="MSYRGHNYNAMAPGGQTFSNSPYTSNMGSTGARGRSSELFQKFER
FT                   FAKRIEDVTDHPLVQRFVPYTPLIARFFIVATFYEDSIRILSQWPEQVSFLSYYRRYPR
FT                   VFVVLFLMVVAVLMMVGATMILLRKQQLYATAILCACIISQGFVYGLFSGTSFVLRNFS
FT                   VIGGLLITFGDSIVQKRITFGMLPELTSRDGRTKGYILLAGRILIVLMFVTFTFGKSWL
FT                   TVFLTIAGTVCIAVGYKTKFASIILCLILTFYNVTLNNYWLYGYAKRDFLKYEFYQNLN
FT                   IIGGLLLVLNTGAGTISFDEKKKIY"
FT   CDS_pept        complement(79589..80881)
FT                   /codon_start=1
FT                   /gene_family="HOG000171054" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774750"
FT                   /locus_tag="AGL339C"
FT                   /orf_name="AGOS_AGL339C"
FT                   /product="AGL339Cp"
FT                   /function="heat shock protein binding"
FT                   /protein_id="AAS54152.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="HOGENOM:HBG383362"
FT                   /db_xref="HOGENOM:HBG525199"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI0000253311"
FT                   /db_xref="UniProtKB/TrEMBL:Q751R5"
FT                   /transl_table=1
FT                   /translation="MISLPALTGDITIAAAKDAKLSEPVRRPIEPVGKHFLHHAQRILR
FT                   NHTWSEFEKLQAEQNVKQVEDSNVDPDELLFDEELVDEDLLTLEARDWKSADLYAAMGL
FT                   SKLRYKATQAQIIKAHRKQVLKHHPDKKSAAGASLEEDNFFKIIQKAFETLTDPVKRAQ
FT                   FDSCDFNADVQPPKKGSHVDFFEGWGPVFEAEARFSKKQPVPSLGTIESSKEEVEKFYS
FT                   FWNRFDSWRSFEFLDEEVPDDSSNRDHKRYIERKNIAARNKKKTADNARLAKLVERAMS
FT                   EDPRIKTFKEAEKREKERRKWEREAGARAEAEAKAKAEAEAKAAAEAAAANAAAAKADK
FT                   KKAKEAAKAAKKKNKRAIRNAPKDAEYFGDAASAAAIDEQVGHIVDALEDEQLGELVES
FT                   IKADAKAALQGAAKGLADAGKLPASLLSYFL"
FT   CDS_pept        81071..81883
FT                   /codon_start=1
FT                   /gene_family="HOG000248084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749031"
FT                   /locus_tag="AGL338W"
FT                   /orf_name="AGOS_AGL338W"
FT                   /product="AGL338Wp"
FT                   /protein_id="AAS54153.1"
FT                   /db_xref="HOGENOM:HBG059861"
FT                   /db_xref="HOGENOM:HBG397180"
FT                   /db_xref="UniParc:UPI0000253312"
FT                   /db_xref="UniProtKB/TrEMBL:Q751N5"
FT                   /transl_table=1
FT                   /translation="MTGQRQDLLVFSDQSVISRRLLQDGMHHLIMVPHRLGTSPRWLIS
FT                   ALAEAFIFGTPVSLNEQQSAAAKAQRPHNTEATRGPAVTVASFMHDAAHYQNVFSKLKL
FT                   PSQAVRIVDVFTDLVKQNIGKPGAAVLERLLESIPDQRNGGIIIEQPEVLLSLFRLTSD
FT                   ELHLNFINPLMKKCAVLVVVTSVDGFDGGDYERASKDAIEFMRFPTAAFHKSIAVLSLR
FT                   PLDTGRAKDVTGILQVTQGGSLEESDVHVVENEYLFHVQKESIKLFYR"
FT   CDS_pept        complement(81952..83697)
FT                   /codon_start=1
FT                   /gene_family="HOG000208720" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18078995"
FT                   /locus_tag="AGL337C"
FT                   /orf_name="AGOS_AGL337C"
FT                   /product="AGL337Cp"
FT                   /function="GTP binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="AAS54154.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG059868"
FT                   /db_xref="HOGENOM:HBG397179"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniParc:UPI0000253313"
FT                   /db_xref="UniProtKB/TrEMBL:Q751N4"
FT                   /transl_table=1
FT                   /translation="MWVKRYLLVVLYALLNHIPKTVWEVLQVVVDILAFWVRKFFVSLR
FT                   PMSRTMYHNAIAELDRCTTFEEWIEKARVVDEITGADLWRRNFVSKRYDFNSVLNQYGI
FT                   ITEALDDEDLGLLMQKFSTVGPAMLRNFAGILDKRLFTKSLCGTKLLVELYLDKVLECL
FT                   HFMSESRLVPLSFFQRCKLSLGTTALVLQGGSLFGLYHLGVIKGFLLQRLLPNIISGSS
FT                   MGACIASLCTTMTNDELEEVFTGDRLLEMIKEDITLLKKCGYGNIDQNLSLGTLIQNVV
FT                   HKSISKDVNLFIQYVKKNIVKDQTFEEAFQRTGKILNIVVHPTDRNVCPILLNYVTTPN
FT                   VLISSAIDCSLGSDVASSDTKLLCKNLQNEIIDYLPSDKHVTFMAPQNVIATGLVASPY
FT                   TRLTELFNVNNFIVSLARPYLAPLVMGDLKHEIRTSKYYYYKSYPRYDLGSLSPKNLFN
FT                   LEDVEPLAFKLKYHIERKLKHILTLELRHRVDVLGNLGLLSHWIQKFAIDEKIPRSATE
FT                   VTIVPKLKSLSISRVIEGQLDNIPYWIRCGEQSCWPVLSLVKTRCAVEYTLDDIIRQRR
FT                   SSIMA"
FT   CDS_pept        83770..84690
FT                   /codon_start=1
FT                   /gene_family="HOG000091080" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749032"
FT                   /locus_tag="AGL336W"
FT                   /orf_name="AGOS_AGL336W"
FT                   /product="AGL336Wp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="AAS54155.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="HSSP:1G65"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI0000253314"
FT                   /db_xref="UniProtKB/TrEMBL:Q751N3"
FT                   /transl_table=1
FT                   /translation="MRHLGRLQYATEPPINRGDGIIYIPFHEYQISVSNDNTRATSRGR
FT                   VANTAPVQLTSTSKEGGVHEQLGHCELVMFRNNYDGDTVTFSPTGRLFQVEYALEAIKQ
FT                   GSATVGLRSNKYVVLVALKRNADELSSYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQ
FT                   QCNYSQLVYARDLSVVKAGQLLSDKAQKNTQSYGGRPYGVGLLLAGYDNSGAHLLEFQP
FT                   SGNTLELYGAAIGARSQGAKTYLERVMEEYLEIEDADALIKHGVEALKHSLKDETLSTK
FT                   NLSIAIVGKDMPFTLYDGEAVAAYL"
FT   CDS_pept        84899..86974
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774751"
FT                   /gene_name="ATM1"
FT                   /locus_tag="AGL335W"
FT                   /product="Iron-sulfur clusters transporter ATM1,
FT                   mitochondrial"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /biological_process="iron ion transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS54156.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006826"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="HSSP:2GHI"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0000253315"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751N2"
FT                   /transl_table=1
FT                   /translation="MFRLLRFSPSRYYPRSMAPVRWSTHPYHVTAPRMWGTRMPLQLQA
FT                   SLRPNNAVEKGISGDVKVAGAMVKPAASGGESAKSKTPTVSELKILKDLFRYIWPRGDR
FT                   KVKTRVLIALGLLLGSKLLNVQVPFFFKSTVDSMNIEWGDVGTALPIAVTLTVLSYGAA
FT                   RFGAVLFVELRNAVFSNVAQSAITKVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGCK
FT                   GISYVLSAMVFHIIPITFEISMVCGILTYQFGASFAAITFSTMLLYSIFTFRTTAWRTR
FT                   FRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAF
FT                   LNTGQNLIFTTALTAMMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK
FT                   QSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYDPERRILNNVSFTI
FT                   PAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQD
FT                   TPLFNDTIWENVKFGNISSSDDEILRAIEKAQLTKLLQNLPKGASTVVGERGLMISGGE
FT                   KQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTI
FT                   ADADKIIVLEQGSVREEGTHSSLLASQGSLYRGLWDIQENLTLPERPEQSTGSQHA"
FT   transit_peptide 84899..84964
FT                   /gene_name="ATM1"
FT                   /locus_tag="AGL335W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751N2 "
FT   mat_peptide     84965..86971
FT                   /gene_name="ATM1"
FT                   /locus_tag="AGL335W"
FT                   /product="Iron-sulfur clusters transporter ATM1,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751N2 "
FT   CDS_pept        87259..88791
FT                   /codon_start=1
FT                   /gene_family="HOG000033687" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622190"
FT                   /locus_tag="AGL334W"
FT                   /orf_name="AGOS_AGL334W"
FT                   /product="Amidophosphoribosyltransferase "
FT                   /EC_number="2.4.2.14"
FT                   /function="amidophosphoribosyltransferase activity "
FT                   /function="metal ion binding"
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="purine base biosynthetic process "
FT                   /biological_process="purine nucleotide biosynthetic process"
FT                   /protein_id="AAS54157.1"
FT                   /db_xref="GO:0004044"
FT                   /db_xref="GO:0006164"
FT                   /db_xref="GO:0009113"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG392416"
FT                   /db_xref="HOGENOM:HBG410483"
FT                   /db_xref="HSSP:1AO0"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI0000030CFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q751N1"
FT                   /transl_table=1
FT                   /translation="MCGILGVVLADQSKVVAPELFDGSLFLQHRGQDAAGIATCGPGGR
FT                   LYQCKGNGMARDVFTQARMSGLVGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGICMSH
FT                   NGNLVNTMSLRRYLDEDVHRHINTDSDSELLLNIFAAELEKYNKYRVNNDDIFCALEGV
FT                   YKRCRGGYACVGMLAGYGLFGFRDPNGIRPLLFGERVNDDGTMDYMLASESVVLKAHRF
FT                   QNIRDILPGQAVIIPKTCGSSPPEFRQVVPIEAYKPDLFEYVYFARADSVLDGISVYHT
FT                   RLLMGIKLAENIKKQIDLDEIDVVVSVPDTARTCALECANHLNKPYREGFVKNRYVGRT
FT                   FIMPNQKERVSSVRRKLNPMNSEFKDKRVLIVDDSIVRGTTSKEIVNMAKESGAAKVYF
FT                   ASAAPAIRFNHIYGIDLADTKQLVAYNRTVEEITAELGCDRVIYQSLDDLIDCCKTDII
FT                   SEFEVGVFTGNYVTGVEDVYLQELERCRALNNSNKGEAKAEVDIGLYNSADY"
FT   CDS_pept        89080..90195
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749033"
FT                   /gene_name="DYN3"
FT                   /locus_tag="AGL333W"
FT                   /product="Cytoplasmic dynein intermediate light chain DYN3 "
FT                   /function="motor activity"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="dynein complex"
FT                   /cellular_component="microtubule"
FT                   /protein_id="AAS54158.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0030286"
FT                   /db_xref="HOGENOM:HBG059882"
FT                   /db_xref="UniParc:UPI0000030CFB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751N0"
FT                   /transl_table=1
FT                   /translation="MSSGNIWKQLLEENSEQLDQSTTETYVVCCENEDSLNQFLQQCWQ
FT                   IDEGEKVTNLEPLGFFTKVVSRDEENLRLNVYYAKSPLDAQTLQFLGVFLRQMETSQIR
FT                   WIFLLDWLLDDKRLWLRQLRNSWAALEEAQVAPFPGGAVVVVLNPSHVTQLERNTMVWN
FT                   SRRLDLVHQTLRAACLNTGSALVTLDPNTAREDVMHICALLAGLPTSRPVAMLSLQSLF
FT                   IPHGADSIGKICTIAPEFPVATVFDNDFVSSTFEAAIAPELTPGPRVPSDHPWLTEPTN
FT                   PPSEATAWHFDLQGRLATLYRHLGDSNKAISVTQHRFHKPRSEDYAYEFELPSKHPTIR
FT                   DLIRSAAADSPNDVADSIDGLMDGIVQRNVH"
FT   CDS_pept        90637..92646
FT                   /codon_start=1
FT                   /gene_family="HOG000065977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927762"
FT                   /locus_tag="AGOS_AGL332W"
FT                   /product="AGL332Wp"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54159.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG434497"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI0001DB2ABB"
FT                   /db_xref="UniProtKB/TrEMBL:Q751M9"
FT                   /transl_table=1
FT                   /translation="MQTLPVYPASQTASPTKRELAAAPSVPQDGARLPAQLTLVTPPEP
FT                   DIQKKSVRSQVARLSISETDVVKSDIVAKLSGTCAVEWRDTPAATGDTASVPGSKRRRR
FT                   RSSAVTVQQPFGKLKQGNMSTSSLPIPNKKKKSVKPASFKLNEKATQKPLSIKDIRDLV
FT                   QYIFHDTNNSPNWITIENRASLKKVVVLFTPGLLPEDFSLPKDSLFHKNIPKLQDAHLN
FT                   SISENEQMCKQMCILPLSAPGSKNSLFSAYNSFVNVGLSKKEKIAKVEQLNKKEITLLD
FT                   LLMTVDDLLHNEYPIHLNTPGLSEEYQKALLLKYQNKEKYSGWVDTVSFQHDGSHTFAI
FT                   DCEMCLSKNGYVLTRVSVVDFDCNLVYDKFVKPDEPIVDYLTKYSGITEEKLVGVTTTL
FT                   QDVQQDLLRMISATDVLIGHSLQADLNVLKMRHPLVIDTSIIYEHKAGPPFKPALRYLA
FT                   DEYLQKQIQTDDGNGHDSYEDAMTCMELTKLKIVNGLTFGIGINTENLFHRLTRQGVKS
FT                   MTLSDSVLRQAPQPKSPAGLETSLKCDNDEEIVQRILANIEEGNLFVARMRELEYARQF
FT                   VKCKAEDAAAKYADEAVQNLGNRLQRLYAACPASTMLIVCSGNGDPRDWLKLMEEFNEL
FT                   NKEEKASARKERESEIQAAVTKARDAVALVMIKQ"
FT   CDS_pept        complement(92752..93162)
FT                   /codon_start=1
FT                   /gene_family="HOG000142053" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927763"
FT                   /locus_tag="AGL331C"
FT                   /orf_name="AGOS_AGL331C"
FT                   /product="AGL331Cp"
FT                   /protein_id="AAS54160.1"
FT                   /db_xref="HOGENOM:HBG059890"
FT                   /db_xref="HOGENOM:HBG103444"
FT                   /db_xref="InterPro:IPR018304"
FT                   /db_xref="UniParc:UPI0000253317"
FT                   /db_xref="UniProtKB/TrEMBL:Q751M8"
FT                   /transl_table=1
FT                   /translation="MSLIEQANKLSGYAADVRRWRYAWFTPSKNIEDDNNMESYGFEYK
FT                   CWQRVGADEPLDLLDDTDDHVLDLNVFDRTRKNAESKMSQVGSGPSGSGTTGLTMEDIR
FT                   GAVGGVEAIPGFSSSDAIAKKEQEAGGAASPK"
FT   CDS_pept        93334..96369
FT                   /codon_start=1
FT                   /gene_family="HOG000216192" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622191"
FT                   /locus_tag="AGL330W"
FT                   /orf_name="AGOS_AGL330W"
FT                   /product="AGL330Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54161.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059896"
FT                   /db_xref="HOGENOM:HBG398361"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR022591"
FT                   /db_xref="UniParc:UPI0000253318"
FT                   /db_xref="UniProtKB/TrEMBL:Q751M7"
FT                   /transl_table=1
FT                   /translation="MGSGSNKTKSGGANQKDLSNEDEAYSAIFSGEFGALDISNYIGSQ
FT                   GHDSVTEHLPDAIDFEDEDELAEEELPDDYKAGTRQHSPAHGEDDYLTMMEDPTAEYQG
FT                   NNALFMGVHDDSSNGYVNEHGEFNEYTDEQQRELEQRKRLDQERLAQEEQMLVKSYFPQ
FT                   LQKGKILQMTKTAPKPLAEYQWQRNLYLVNRVVKPLLPLKVRFEVQPDSRKVFKAKGKG
FT                   WHTSATLLRSKKKRGIVYTTPDEVYPEHEREVNKVSSDEVIPEDLLMVADEWDYNKIVG
FT                   EVESDADKQSSVGSNIFDSKLQEDPRDWEWDEADLVEGKLTSLHFPLDMNDERLLFAKQ
FT                   PDTGAIGRSSTVLYNDKHLFSKFNISNDDKYRILKENYQTKIRSTISNLSIEHSQPAAR
FT                   LQSPFYKVLLPKEQLRHFHRCHFGKGIRPGTNIVFSKIKVRRRKRDKGKDVREIFSNSS
FT                   DLTIGDSVPVFLMEYCEQQPIALSKFGMASKLINYYRKRSETDTSRPKLPVGETHVLGV
FT                   QDKSPFWNFGFVEPGAIVPTLYNNMIRAPVFKHEVSRTDFLLIKSAGNGTGTRFYLRQI
FT                   NHLFTVGQTFPVVEIPGPNSRKVTSMGKNRLRMVVYRILNKSPEHRLLVKQVARHFPDQ
FT                   NDMQNRQRLKEFMKYQRDGDDQGFWKLKEGEVLLDNENVKKMISPEDVSMLESMYAGQQ
FT                   FQEDTDMFNFNSKLRTLEENLIPWNATKNFLNATQMRAMIQIHGAGDPTGCGEGFSFLK
FT                   TSMKGGFTKSGESEQPQATGGHSYNVAQQQKAYDEEISKTWYKQAKSLSIQNPFEEIDD
FT                   PDVVNKTNKRVKTHRDDEKVLRIIRKTRDENGIIQRQTVIVRDPRVIHAYLRTYEKRRE
FT                   EAERNLGLEELMNDNIDLVTGENNEERQLKQKKLLEEQLAKLEKSKERRQARKAAKEKS
FT                   KDGKVVKVKNTTRRCATCGAIGHIRTNKSCPMYNGGVAANANANANASSAAAAGSSGMA
FT                   SNNSATSKSITPNASIPPTSFD"
FT   CDS_pept        complement(96447..96872)
FT                   /codon_start=1
FT                   /gene_family="HOG000066058" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927764"
FT                   /gene_name="LIP1"
FT                   /locus_tag="AGL329C"
FT                   /product="Ceramide synthase subunit LIP1 "
FT                   /biological_process="lipid biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54162.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0008610"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059903"
FT                   /db_xref="HOGENOM:HBG203528"
FT                   /db_xref="UniParc:UPI0000253319"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751M6"
FT                   /transl_table=1
FT                   /translation="MAIGRYGTLVFYILAGLAFVWSLEYFKHYTKNNYERFHCTAVVEP
FT                   VQGTATVEKLSAVGGPPCDKRAELKLITQKLTQHFDPNKQPALFCIVENTSVESVHYPV
FT                   SRTNKGPAGYIAYAGYEADRAAVHKYCEAHGAAVLHM"
FT   CDS_pept        complement(97285..98976)
FT                   /codon_start=1
FT                   /gene_family="HOG000198296" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749034"
FT                   /locus_tag="AGL328C"
FT                   /orf_name="AGOS_AGL328C"
FT                   /product="AGL328Cp"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="vacuole"
FT                   /protein_id="AAS54163.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG474471"
FT                   /db_xref="HOGENOM:HBG588032"
FT                   /db_xref="HSSP:1BCS"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR008442"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI000025331A"
FT                   /db_xref="UniProtKB/TrEMBL:Q751M5"
FT                   /transl_table=1
FT                   /translation="MRGQSLLAPLMLVPALVAGTSIQGGKAQLEKRQSMPDDLVAAVGG
FT                   HLSKLRSKMNVQQGKFFDARGSLKNIADSLGVSEQEVSSVSAELESVMAEMSELFPQDA
FT                   KQLKFLSEPRGDVRKVREWDNVVRKESLQDYQLRVRKVSDPAGLGVDPDVKQYSGYLDV
FT                   EAEDKHFFYWFFESRNDPKNDPIVLWLNGGPGCSSMTGLFFELGPSSIDQKLKPVRNPY
FT                   SWNTNASVIFLDQPVNAGYSYSSNSVANTVAASKDVYAFLELFFRQFPEYQAGQKFHIA
FT                   GESYAGHYIPAIAAEILSHPDEERSFKLSSVLIGNGLTDPLTQYPYYERMACGGGGEPA
FT                   ILGPEQCSAMNETLPRCLRLIRTCYTLQNVWSCVPASLYCNGNQLTPFQRTGKNVYDVR
FT                   KECEGQLCYDDMKYSEEYLNTPEVIKAVGAEVDSFTSCNFDVNRNFLLNGDWMKPYQRH
FT                   VTEILDKGLPVLIYAGDKDFICNWLGNRAWTDELPWKHHDDFTKQPIKPWNGPSGDQAG
FT                   EVKNYKHFTYLRVFGAGHMVPYDVPENSLDMLNTWLQGDFGMGAQE"
FT   CDS_pept        99454..100020
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749035"
FT                   /locus_tag="AGOS_AGL327W"
FT                   /product="AGL327Wp"
FT                   /protein_id="AAS54164.2"
FT                   /db_xref="HOGENOM:HBG059919"
FT                   /db_xref="UniParc:UPI0001DB2ABC"
FT                   /db_xref="UniProtKB/TrEMBL:Q751M4"
FT                   /transl_table=1
FT                   /translation="MKQLTASEQYLLASKARHKLIYAARAKGQDHQLRVLVGHANMLDR
FT                   ITAALGSGRAAPRSGPAEDAGSHSSGRRHAGELGSDLGTKARSGGSGCASLTRAAEAGG
FT                   EITCTGTKARRQAGSSAYGRCASQAEGGGAAAAAKYPYLHGYAECGSAGSAGRFSAARL
FT                   GAEREGHDDCFSESEELLSLRPICI"
FT   CDS_pept        100362..102053
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749036"
FT                   /locus_tag="AGL326W"
FT                   /orf_name="AGOS_AGL326W"
FT                   /product="AGL326Wp"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAS54165.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG059924"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="UniParc:UPI000025331C"
FT                   /db_xref="UniProtKB/TrEMBL:Q751M3"
FT                   /transl_table=1
FT                   /translation="MMFAAWPLGQPISFATALALLACFSAQTARSAVVSSEVTGASLPS
FT                   CWDVSKPQGGFGDHLQQILHNSTLSNLTVEKLQRAVQIPSAWVVDAADCCTAVKSDTET
FT                   YKQFKRLHEQLSRDFPLVWCKLKVETVNELGLLVTWPGSDSGAKPALISANMDVIVQDQ
FT                   DDLSTSSQFEGKIENEQKQRRTNIHGRGAFDKSHLVGLLEALEYTLETDPSFQPKRTIV
FT                   LALGFDEQLGGELGAAEISKKLESQYGSDSFSVVLGKDVAGVVETYGAYLAPIGVATKQ
FT                   DVRFTFRFNFSDMYRTSPLMPTNEFRIFGNISDALNRFPERYDFTKANPLTSLFQCAAN
FT                   DFKYMPEEQIKDLLAALEDQDANNRFTDFLRSQPTNYAGFAFTTVQQFSFIHGGSIHAV
FT                   RPEYLQFEIKESLTLDTSVELRTELIKAALKEVGPMGLIVNGEVIDAIDSGITCEVLVD
FT                   ADTKDEPSPNSDDLELLASTIKGLYEDSIFPDLPDKPSKLNVGTSFSAIKTDSSHYKNL
FT                   SKHVYYFRPGFFQDFVIPSFNTRKEHVGVQTLLYTVAFFYQYVHSL"
FT   CDS_pept        102465..104183
FT                   /codon_start=1
FT                   /gene_family="HOG000194592" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749037"
FT                   /locus_tag="AGOS_AGL325W"
FT                   /product="AGL325Wp"
FT                   /function="metallopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS54166.2"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="HOGENOM:HBG059932"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="UniParc:UPI0001DB2ABD"
FT                   /db_xref="UniProtKB/TrEMBL:Q751M2"
FT                   /transl_table=1
FT                   /translation="MKALPQNTYCRSRCLSTIAKQCALWLILILPAAYGLGQANSSVTS
FT                   FECNVRKCSFAPWAHIQFILKDTVFRNAITEKLRHAVQIPSEMLDPTPNPVPDPRVQPE
FT                   HDFWDPFRKLHQQLTEDFPRVFSTLQVETINEFSLLITWEGSDSNLKPLMFSSHMDVVP
FT                   VNPETAGEWRHDPYSGDLTWDEELGDILWGRGAFDDKHRIVAHLQAIEYILTFEPKFVP
FT                   KRTIILAFGSDEESGGVYGASFMAALLLSRYGENGLYAVVDEGFTGIRKVEGVLAAMPA
FT                   ISEKGRMNFWCNITMSGGHSSVPHKDSAINLVSKFITEFEREQLPPTFSQNNPAARMYQ
FT                   CIAENSVTLSNSLKTSFASAFNDSEASDHLLEYIFSANDLRTECLFRSVKGVTTIHGGM
FT                   KSNSIADFVAWSFNVRLAMEDDADQMANLVQQMLCRFAQTHGIGLSIQGKQVLTRTKKG
FT                   LLQVRYSAKNAAPISPSNAVWEMFAGTIKGLYEESIFPLRFNSKHTLLVLPSIMTGGTD
FT                   SVHYERLTSNIYRYQPGFYNGRIVDNIHGPNEFIDINTLIETVAFVYAYIHSAQE"
FT   CDS_pept        104372..105103
FT                   /codon_start=1
FT                   /gene_family="HOG000091081" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927765"
FT                   /locus_tag="AGOS_AGL324W"
FT                   /product="AGL324Wp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="AAS54167.2"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI0001DB2ABE"
FT                   /db_xref="UniProtKB/TrEMBL:Q751M1"
FT                   /transl_table=1
FT                   /translation="MMAATTTGSDYANEVHSVPIQHQFNPYDDNGGTILGIAGEDFAVL
FT                   AGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVKRFKNSMKWYRFDHNKK
FT                   MTIKSAARSIQHLLYGKRMFPYYVHTIIAGLDEEGKGAVYSYDPVGSYEREQCRAGGAA
FT                   ASLIMPFLDNQVNFKNQYEPDSNGTKKRALRFLSVDEVVRLVRDAFTSATERHIHVGDG
FT                   LQIMIVTKDGVREEFYSLKKD"
FT   CDS_pept        complement(105260..105916)
FT                   /codon_start=1
FT                   /gene_family="HOG000231400" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774752"
FT                   /locus_tag="AGL323C"
FT                   /orf_name="AGOS_AGL323C"
FT                   /product="AGL323Cp"
FT                   /function="ER retention sequence binding"
FT                   /biological_process="protein retention in ER lumen "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54168.1"
FT                   /db_xref="GO:0006621"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046923"
FT                   /db_xref="HOGENOM:HBG145091"
FT                   /db_xref="HOGENOM:HBG332839"
FT                   /db_xref="InterPro:IPR000133"
FT                   /db_xref="UniParc:UPI000025331F"
FT                   /db_xref="UniProtKB/TrEMBL:Q751M0"
FT                   /transl_table=1
FT                   /translation="MNPFRLLGDASHLASILVLISTIQRTQAIDGISLKTQVLYFVVFV
FT                   TRYLDLFTKWRSLYNTLMKVFFISSSLYVIVQLKQARHKQVVGYQNMVMRDTFKIRYLV
FT                   AASAALALITTRQYKVQQVLWVFSVWLESVAIMPQLFMLSKAGKADALTSHYIFALGFY
FT                   RAMYIPNWIWRYYVENRFDKVAVVAGVVQTLIYSDFFYIYYRKVIREGANFELPV"
FT   CDS_pept        106949..107122
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749038"
FT                   /locus_tag="AGL322W"
FT                   /orf_name="AGOS_AGL322W"
FT                   /product="AGL322Wp"
FT                   /protein_id="AAS54169.1"
FT                   /db_xref="HOGENOM:HBG059949"
FT                   /db_xref="UniParc:UPI0000253320"
FT                   /db_xref="UniProtKB/TrEMBL:Q751L9"
FT                   /transl_table=1
FT                   /translation="MGFFYENPLFDFFHRAVRRPASIAMWLFTGLVVASALASILALPA
FT                   PRRPKRPDGAGP"
FT   CDS_pept        join(107318..107330,107388..107839)
FT                   /codon_start=1
FT                   /gene_family="HOG000263447" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18078996"
FT                   /gene_name="SOD1"
FT                   /locus_tag="AGL321W"
FT                   /product="Superoxide dismutase "
FT                   /EC_number="1.15.1.1"
FT                   /function="copper ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="removal of superoxide radicals "
FT                   /cellular_component="extracellular region"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS54170.2"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0019430"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG297578"
FT                   /db_xref="HOGENOM:HBG609879"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="UniParc:UPI0001DB2ABF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751L8"
FT                   /transl_table=1
FT                   /translation="MVKAIAVLKGDAGVSGVVHFEQEADAAVTTISWNITGFEPNTEHG
FT                   FHIHEFGDVTNGCTSSGSHFNPFKKTHGSPEDENRHVGDMGNVLADANGVAVGSAKDPL
FT                   IKIFGPTSILGRTVVVHAGKDDLGRGGNEESLKTGNAGPRPACGVIGIAN"
FT   mat_peptide     join(107321..107330,107388..107836)
FT                   /gene_name="SOD1"
FT                   /locus_tag="AGL321W"
FT                   /product="Superoxide dismutase [Cu-Zn] "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751L8 "
FT   CDS_pept        complement(107960..109690)
FT                   /codon_start=1
FT                   /gene_family="HOG000077514" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749039"
FT                   /gene_name="URA7"
FT                   /locus_tag="AGL320C"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /function="ATP binding"
FT                   /function="CTP synthase activity"
FT                   /biological_process="glutamine metabolic process "
FT                   /biological_process="pyrimidine nucleotide biosynthetic
FT                   process"
FT                   /protein_id="AAS54171.1"
FT                   /db_xref="GO:0003883"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006221"
FT                   /db_xref="GO:0006541"
FT                   /db_xref="HOGENOM:HBG523338"
FT                   /db_xref="HOGENOM:HBG597806"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI0000253322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751L7"
FT                   /transl_table=1
FT                   /translation="MKYVVVSGGVISGIGKGVLASSTGMLLKTLGLKVTSIKIDPYMNL
FT                   DAGTMSPLEHGECFVLNDGGETDLDLGNYERYLGVTLTKDHNITTGKVYSHVMAKERKG
FT                   DYLGKTVQVVPHLTNAIQDWLERVARIPVDDSGMEPDVCIIELGGTVGDIESAPFVEAL
FT                   RQFQFRVGRDNFALIHVSLVPVIHGEQKTKPTQAAIKDLRSLGLTPDMIACRCSEELDK
FT                   PTIEKIAMFCHVGPEQVVNVHDVASTYHVPLLLLEQRMIDYLGQRLKLSDIKLGAEDKE
FT                   RGARLLDRWRHLTTAIDESFEVVQIALVGKYTHLKDSYLSVIKALEHSSMRCKRKLEIV
FT                   WVEASDLEPEMSASDKEKFQQAWKSLSSSDGILVPGGFGTRGTEGMILAAKWARENKIP
FT                   YLGVCLGLQVATIEFARHVLGIADATSSEFYPEVAEDKQVVVYMPEIDKQNMGGTMRLG
FT                   LRPTIFQEDTDWSIIRKLYGSASSVEERHRHRYEINPKMVQKLEEHGLKFVGRDETGTR
FT                   CEILELVDHPYYVATQYHPEYMSKVLDPSQPFLGLVAAAANILPSLLAAERAVGARADF
FT                   "
FT   CDS_pept        complement(110568..111104)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622192"
FT                   /locus_tag="AGL319C"
FT                   /orf_name="AGOS_AGL319C"
FT                   /product="AGL319Cp"
FT                   /protein_id="AAS54172.1"
FT                   /db_xref="HOGENOM:HBG059964"
FT                   /db_xref="UniParc:UPI0000253323"
FT                   /db_xref="UniProtKB/TrEMBL:Q751R2"
FT                   /transl_table=1
FT                   /translation="MHSALAARQHMDTTDLYADYVDATAALIRALARLYLAQQGCVAPD
FT                   PAQLEHYVRHQLAAAANAATTRLLPGNPLAAQLQALRSESYHADAEIRAQLAAQWRLLK
FT                   VFADQRATYCALAEDTAVIYGQLRARHAARTRRPAHRAPATERLRELLLLLILQGGYHG
FT                   THPRVDAWVQSLTIT"
FT   CDS_pept        111146..111688
FT                   /codon_start=1
FT                   /gene_family="HOG000191978" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622193"
FT                   /locus_tag="AGL318W"
FT                   /orf_name="AGOS_AGL318W"
FT                   /product="AGL318Wp"
FT                   /protein_id="AAS54173.1"
FT                   /db_xref="HOGENOM:HBG059972"
FT                   /db_xref="HOGENOM:HBG512105"
FT                   /db_xref="InterPro:IPR008570"
FT                   /db_xref="InterPro:IPR014040"
FT                   /db_xref="InterPro:IPR014041"
FT                   /db_xref="UniParc:UPI0000253324"
FT                   /db_xref="UniProtKB/TrEMBL:Q751R1"
FT                   /transl_table=1
FT                   /translation="MAMASELPSIYNFPPLYTRQPNSLIRAQQLDAWLGVLKDYARGRR
FT                   VWIMGHDGSAREPKDEGSVFFNVQLQRRVPGPFVDEIWAHALAKGAALRHSADSFYVLW
FT                   RSLDSWSALLLQWFETCGRLNQVVTIYELVAGDESAMWEFHGMHDGLCELALGKLVERG
FT                   RATLISNDGSVVAVKVI"
FT   CDS_pept        complement(111714..112469)
FT                   /codon_start=1
FT                   /gene_family="HOG000248397" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18078997"
FT                   /locus_tag="AGL317C"
FT                   /orf_name="AGOS_AGL317C"
FT                   /product="AGL317Cp"
FT                   /function="metal ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="AAS54174.1"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059977"
FT                   /db_xref="HOGENOM:HBG397438"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="UniParc:UPI0000253325"
FT                   /db_xref="UniProtKB/TrEMBL:Q751S1"
FT                   /transl_table=1
FT                   /translation="MFRFAPRRAVHTVPKLAQLSELHAQGIPKVLSAEGFRRCWTEQQQ
FT                   YLCEKLTLATAGTPLESYLPFHLVLNTAQKTFKSNVFNLASAVHNNHLFVENILPAEGA
FT                   GAKPSIQLLQRIESQFGFGWEELKEEMVRRAETDVVGQGWLFLVENGHKELQILTLQNH
FT                   GSPYYFARGQAFDLNSPITTEIAAQLQTMREAVDAGNDEDWTMPLIAVSLWDHAYLRDY
FT                   GVKGRSAYVRAVLDNLNWTVINKRVYTGP"
FT   CDS_pept        112950..113915
FT                   /codon_start=1
FT                   /gene_family="HOG000203918" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774753"
FT                   /locus_tag="AGOS_AGL316W"
FT                   /product="AGL316Wp"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54175.2"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG021570"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR017390"
FT                   /db_xref="UniParc:UPI0001DB2AC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q751S0"
FT                   /transl_table=1
FT                   /translation="MSSWQTIENDAGVFTQLVKDLGVEGVQFEEVPLVEHLATLNSPLY
FT                   GVIFLFKYERQNYAGEAPVQGEFEQACPEGLFFAQQTIPNACATQAVLNTLLSIGNDHR
FT                   NSIRLGTVLSDFLQFTAGFSDPALRGETITNSVAIRNVHNSFTSPDPFEHEEPSPSAQS
FT                   SEAAFHYSGFVPYNGYIYELDGLHPRPIIHRAYGANNDDPAVFAANLAALLSARMSMVA
FT                   DSSFSVTAIVRDKLEHLTEQLDAPDVDDGRRFWLQDLIQDELRVRDRWAKEIALRRDGL
FT                   VGLVYAVFKQMLGSMSDDEFAQRRAAAAARTNERERRRTC"
FT   CDS_pept        114304..116013
FT                   /codon_start=1
FT                   /gene_family="HOG000184681" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749040"
FT                   /locus_tag="AGOS_AGL315W"
FT                   /product="AGL315Wp"
FT                   /protein_id="AAS54176.2"
FT                   /db_xref="HOGENOM:HBG059990"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="UniParc:UPI0001DB2ADC"
FT                   /db_xref="UniProtKB/TrEMBL:Q751L6"
FT                   /transl_table=1
FT                   /translation="MNNYNQVTPLKLGGGTRARARGDAAIAAGTGSRGAASEAGSQSCM
FT                   YSGKPDEPYPTSKGCSGLPENHHSSFVLLPQYHKGGAGLPQPNSTGTLGVPVNLYVPDY
FT                   SLFFGAQNASCDKPQSLINWIDRQYARGMREKFGQAKMATFVDQASKLVSRAYAAGKVW
FT                   QNDWLRQPDVPVFNRGSNVRPMQLVCEIGTSSVGRKRNSSSSAETLGRGPSWDGSDLHS
FT                   NTTVTLGKQVDSSQAKGKKRKALSEQDRKRLRLERFASNSDAAKRTRRSDDEDYSNLNA
FT                   TSNHSYKFDKNRPVVGRCRTLEKRYLRLTSEPDPEKVRPLDVLEKAYEFIMNKYRSKEA
FT                   TYPYVCDQFKSMRQDLKVQIIENDFTLKVYQTHARIALVNGDLGEYNQCQGSIMELYER
FT                   DNVAKHHFSEFMSYRILYYLLTEDHAAIDELRLKILTEHVDQSADTTIRLAFEMAQAQA
FT                   QGDYHTFMKLYAQTVGPMRALVNEFIKRERLRALKTMCSAYKQLRLTFLVSELSLKDED
FT                   ETFKFLNDFDLFNSVVLPEGDADTMYLNFKECRAKIMDHYNKSMKVDIKGQK"
FT   CDS_pept        complement(116107..116802)
FT                   /codon_start=1
FT                   /gene_family="HOG000182400" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622194"
FT                   /locus_tag="AGL314C"
FT                   /orf_name="AGOS_AGL314C"
FT                   /product="AGL314Cp"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54177.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG020768"
FT                   /db_xref="HOGENOM:HBG436319"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="UniParc:UPI0000253328"
FT                   /db_xref="UniProtKB/TrEMBL:Q751L5"
FT                   /transl_table=1
FT                   /translation="MACCPDSVTPLESSPEVFTDFAHALGLQSDMAFHDIYSLTDPDML
FT                   AFLSRPMKSVILLFPLNAFFRELICPEYHGGDKSPIWFKQTIRNACGMYALLHSLANNR
FT                   ELVMQDSPLDRFLAQNPSADGRYDDQNTVDFLVANGELYQRSSLQGQTEAPDPEEEVEL
FT                   HFITFLVSGGQVFELDGRGKGPYLLGAASDGDVLEQPLVKDRIQWFMDNADDEAKNQFS
FT                   LLGLGPSWK"
FT   CDS_pept        complement(117260..118876)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749041"
FT                   /locus_tag="AGOS_AGL313C"
FT                   /product="AGL313Cp"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="AAS54178.2"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG060001"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0001DB2ADD"
FT                   /db_xref="UniProtKB/TrEMBL:Q751L4"
FT                   /transl_table=1
FT                   /translation="MRPFYTAESPKSRKRPAISKPIDVVGTGVGGLDGAKLYYNVVQDY
FT                   LPNSEEDAAGGRGGFLNVRRGDIVLHLEQAENNLVYVKLMNMLGEGLVPARCLAVNREL
FT                   SVRTEGGEAARAPPARRGTQVRFTAAGASCWCCVTCCGIRESRVWYRIECMLRSGYQRT
FT                   LCRYYHDFYWLHVGLIGRLQQLGLGVDLNQLPKLPAPAGNKLKNSSAEIRMESFNKYLR
FT                   ELFESTHIPGHVRDSLVVDQWLAPRVGDLLRTPRGAIFRVREAAEGSGSQLVWEVISEE
FT                   EAAALVPHTLRLEKPSWVSSNSSTALSTLARSLSAVVPTVSQAGNKMPQLATSAPSTPV
FT                   FKSRPLFQSLSPSIPSLSTTKESGIHTPLMSETSSCASTPLTSPGTGHSSPTETGPVAH
FT                   LPIKMKVFYGEDVYAVICTWDRINDYGSLLHFIKQRLAKELPANACHFQLSRRLCHGPK
FT                   NVSAGKAHEETLLCASNYKKVMSEFEAADAAYMAKHAHSGIGIAFNTTEPVQPTQIAPS
FT                   NVHLGDQAPGKLNILVKVISF"
FT   CDS_pept        119823..121574
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18078998"
FT                   /locus_tag="AGL312W"
FT                   /orf_name="AGOS_AGL312W"
FT                   /product="AGL312Wp"
FT                   /protein_id="AAS54179.1"
FT                   /db_xref="HOGENOM:HBG060007"
FT                   /db_xref="UniParc:UPI000025332A"
FT                   /db_xref="UniProtKB/TrEMBL:Q751L3"
FT                   /transl_table=1
FT                   /translation="MCLGSPRAPGARRAAMELFEMRVERAPARRASQCSLKAGAQLGAM
FT                   AAERPVTCSALVQMTCEYVDSDEPDSSSDSSAERSRTAASAQSLVSYRSRRSETVSMAA
FT                   EGATVYGAREEGHGADQWLLMHVRKMEDMYRVGNAVAGHFSLSRGMVDQGVFRMLQLRG
FT                   FLSQTPAVKIEVVGAPVSPVLEKLTLKKGGSMTVTGDEKVISAPGFAGAGGKASGLRRA
FT                   KTHGSWFGDFIRDPFSRRKKEKTHGVARSASTTMIPQETKIVELPESAEKDAQGPKKVN
FT                   FQAAERGKNGSWLGGLVRSSFSIKRRKSAKLAQRGQGGGAAPAPPAEVMPAVSNSELRE
FT                   QVPVHRHSCITIIGLENLEDTLTNVEDEEEVASDTTASDEELDEIFLDDPLDIKLSEEI
FT                   VQLPPLELESSKSFLREVEAQLRVLSGFEVSPPPEDEDTGNLYGDFKRRSVVSITSANM
FT                   HFSDESDREPKSADTAPRRKPKTRIKRTKSRELLKRVLARNVNRFRSDHDHARFHHGSH
FT                   YSYYHSTLSPKSASKRTIDELEREHVYKNPERIPVARPLLDSFSKHRKADELHRITAPV
FT                   SPKQMQI"
FT   CDS_pept        complement(121903..122991)
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622195"
FT                   /locus_tag="AGOS_AGL311C"
FT                   /product="AGL311Cp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS54180.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001DB2ADE"
FT                   /db_xref="UniProtKB/TrEMBL:Q751L2"
FT                   /transl_table=1
FT                   /translation="MRELLLALRRRQGAGGPPSVPVVYIGARRRSVADPCSAVCQQPYP
FT                   DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTG
FT                   ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGV
FT                   GAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVS
FT                   LTAARQATNQGANFTVYSKLRERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTI
FT                   KTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEF
FT                   VRRHLEGLGLFGSAKPKPKPLH"
FT   CDS_pept        complement(123092..123370)
FT                   /codon_start=1
FT                   /gene_family="HOG000229493" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18078999"
FT                   /gene_name="RPL43"
FT                   /locus_tag="AGL310C"
FT                   /product="60S ribosomal protein L43 "
FT                   /function="metal ion binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS54181.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG128467"
FT                   /db_xref="HOGENOM:HBG610728"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI000025332C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751L1"
FT                   /transl_table=1
FT                   /translation="MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKK
FT                   AVKRGAAGIWNCSSCKKTVAGGAYTFSTAAAATVRSTIRRLREMAEA"
FT   CDS_pept        123397..123978
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749042"
FT                   /locus_tag="AGL309W"
FT                   /orf_name="AGOS_AGL309W"
FT                   /product="AGL309Wp"
FT                   /protein_id="AAS54182.1"
FT                   /db_xref="HOGENOM:HBG060023"
FT                   /db_xref="UniParc:UPI000025332D"
FT                   /db_xref="UniProtKB/TrEMBL:Q751L0"
FT                   /transl_table=1
FT                   /translation="MAGTHAARLKRCFSLRPRRAPCLGCTGGSHTSRDRCVVPQPMSLP
FT                   NRAKPALAIGAPIYASVRRSPDHRLAKGSPRPPARQPRGCHAPQRTIARPLFARPGAPA
FT                   CANRLIRRPPHRTFGAHCSPPAPRPRMPVSRHPQPTAYYLLFATTVPGIVMVARQAPPL
FT                   LQEPQEPMRKRKTIASLYISPSFGWGFLPH"
FT   CDS_pept        124123..124773
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749043"
FT                   /locus_tag="AGL308W"
FT                   /orf_name="AGOS_AGL308W"
FT                   /product="AGL308Wp"
FT                   /protein_id="AAS54183.1"
FT                   /db_xref="HOGENOM:HBG060028"
FT                   /db_xref="UniParc:UPI000025332E"
FT                   /db_xref="UniProtKB/TrEMBL:Q751K9"
FT                   /transl_table=1
FT                   /translation="MAAHTLDSYLQLDGDEPHTPCEDGLAFELDLASQRRLLIHTQPIY
FT                   LINTSKLQTPQQQVVRPEGGTLLDTRQSSIFSAPGLGEDALHVLDAALTPACAEKLRMP
FT                   RIVPREEPDYGALAADELLFELSAPIPLALPAGPAPGLLGPSLDLGRFVQAAHTFHDDA
FT                   TWDSPEQYEFVHALTSKLSRYCGYFVADSKEMEYFDKIRLQEVEYRLSKTYFT"
FT   CDS_pept        125195..126166
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749044"
FT                   /gene_name="FIP1"
FT                   /locus_tag="AGL307W"
FT                   /product="Pre-mRNA polyadenylation factor FIP1 "
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54184.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG060034"
FT                   /db_xref="HOGENOM:HBG272188"
FT                   /db_xref="InterPro:IPR007854"
FT                   /db_xref="UniParc:UPI000025332F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751K8"
FT                   /transl_table=1
FT                   /translation="MQLRAAQHLIAEELQMASSDDEDEKFLYGSEDEADGPRGQQKRKL
FT                   IPQGTAQIQEPDTKRARGADDGDVDMLDDDDEEEDDDEDEDDEDSDSDVEIIIGTGADS
FT                   SKLDSKALTTPSTAATATSAAESAIAPVSEQSAPVAAVQSGDSGAAMDKAVGALDINAV
FT                   GEYEGTPITDIDPEVLKEKPWRQPGANLSDYFNYGFTEETWMEYLHKQEKLRKEYNPRK
FT                   ILMGLLALQQQGKLGDGGAGDGVMLSAGGMAHNDIKSPNKNNGSLPQPPAFPMGMPPMF
FT                   GGFPPFPFPGMIPPNLGAASGNNGSGNHQNMGTSSGNGNNGK"
FT   CDS_pept        complement(126331..130110)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749045"
FT                   /gene_name="BUD4"
FT                   /locus_tag="AGL306C"
FT                   /product="Bud site selection protein 4 homolog "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="cell septum"
FT                   /protein_id="AAS54185.1"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0030428"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG060038"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR012966"
FT                   /db_xref="UniParc:UPI0000253330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751K7"
FT                   /transl_table=1
FT                   /translation="MDEQSSGQDVDQSLDTLLKEIDLKMQLRDGEEGRRASAQSEGSLR
FT                   LPAVRMLERGMVASASHKSVTFDEEPPSVHEYSVVMDSSAGTSECAEEEREGADGYECA
FT                   ADTMRVLYDEDTDSSCMGSERALAGPAAEGIVPEGYKEADLLGTERAGSGTPSLSYDDA
FT                   AGLGSPPHVIFTIKPTSPLNAYDRGSWEPLQSNTAMDTPPRGGTAVSQHGLFAKAPKLP
FT                   AIPSPNSRRRVSYAGSDSYPSDDSATDKRSLTDKTVPDNRGENERGGFGYENSDRNPSI
FT                   ETGTTDEYQSAGEYKSMSSSEANDDSKTEASVEDLRISNKPQRDTTIQDLHATTLPRSS
FT                   STLIPPALPPLDPSFFGRLARSPSYSPIRDRGSSEGSVGEHDSSLEQDHELGMGQQSAR
FT                   TNSSASGNSSDSVMVKPLSLFSNSQVDSLHLGAPAPDNSTPNKEALPSACPPDAMKSIG
FT                   TQTSILEDKAESGPSQSSATSEKSVMLPNFPRFESFFDDSYPFGHDSDRSNNSVSYSKR
FT                   TLKPSNYLSIWHLQEAQMRHDSPAFSANSQFSCKMVGESKRTSLESSRLSAKYESRFKF
FT                   KFKPKLVSRRRIYYNKDQWRNFQEPPTRYYSNCTESDHISSDVPGTPVSPSIKSRNLCH
FT                   GRTRGNMKMVERVNSLCSANERLSSAGNGDETFLSASSNLDVTSRRPSVDIISEISTKD
FT                   LLPKIKQDSDGFNELIKTFVDHDEQSQQTDSTIASYRRGTRDTTIYHIWEHSIQENSIS
FT                   DYGNSPTAGKGTISKLLDNHEVEFDGKNSFVTGLGIIKKTDQDSRVDVLRIDSTQGIEA
FT                   IQSFSPYSYRNAFDPVTPTKSAYHGCEALQASQMGTPFRPAISTTLQAQSGLGHKRPAV
FT                   ERPTTAQLGNYVSAEMSPEVQEPAEETKKRTDLQDNGQLYFVFVGIEQLALRDIERHSA
FT                   ECSIEFDNGNNVVQSEWLPLPKSGSMSLNQEYSVIIAEESLPNMIITLKCRYKSPKKEL
FT                   VEITEKVPLKSKCCGLGKPKYKQVKKLLRREMDFDEWDYKIAQDGSFARCKEQIDEELL
FT                   KNVRYKKQQFRWTLLSEWERDHSKEHKRKRAWELPRLPAHPAGALVVDMCYLPRTSRFE
FT                   KFPKTLQIARRVVNKFKEQKAIAMEGFMWQEGGDTEVLKRRYFTLNGTQLVAHHEITKK
FT                   PKAMINLLRVEKLLTEAEISREMLSSSSRCFTDLVLLHECFVLFFENGEEIMFNPDTKT
FT                   EKLEWIEKLRKVIELNRFHQPWVKKFLNSSENIL"
FT   CDS_pept        130958..134131
FT                   /codon_start=1
FT                   /gene_family="HOG000113136" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749046"
FT                   /locus_tag="AGOS_AGL305W"
FT                   /product="AGL305Wp"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS54186.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG060044"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB2ADF"
FT                   /db_xref="UniProtKB/TrEMBL:Q751K6"
FT                   /transl_table=1
FT                   /translation="MVEKGSRKAGSAGGSGAGASNVAGTAGGKAHARHSLSKIPEVIDP
FT                   GITVPIYEEDIVGDQGGTDVDGQPQKLGSYRARAGRFSNTLSNLLPSISAKLHHNRKGG
FT                   TGKVAPSAADADAGAGSTVVAGEMAGSITPPQDLHNVVSFPEPYGLAQPRTSSESYTYG
FT                   SGYSGHLQPTVSNPATRTRNNTVSSQITSLSSMGQLGTPSTSNIWTNNGSGPADPISNM
FT                   LTTQFNPIPLPDFGQSNYYDVITQQQPPQSTNSLNVPSGGNIFWEKRTRSQSNASSIYA
FT                   DALFDTSGMQQAPPTRSRASTFASTTAHQNMLNTPVMSAPLSAGPIVQDEVDPRSLNWV
FT                   STDPTVPPINQISHLLPSNTISISNIFPLQQQQPHFSNAVNLTSTSLATLCLNFGKVLS
FT                   ARTLKTVNMAIVEFETVDAAMRAKDALNGKEVSLVGAPSAVFFAKVLPMHQQASTLPPI
FT                   QTNPNGPQSLLQEQLFSGAVTFHQQNGISIPVFNASGAGSQHHLASQQSQSQSHVTKHP
FT                   NLTHSFTSLSHTPSEKEHCPFPMPPADIKDQVSLLIDIIRSFGVEHDQDQVQHIVSDAI
FT                   AYNGTSDTADFGPLPEPLPHREFDAPKLRELRKLMDTDNVSDLEIEQLAVAMLDELPEL
FT                   SSDYLGNTIVQKLFENSSTIIKDIMLRQTSKYLTSMGVHKNGTWACQKMTTMADTPRQM
FT                   DLVAKGVYKYCTPLFNDQFGNYVIQCVLKFGFPWNNFIFESIVSNFCTIVQNRYGARAV
FT                   RACLEAHDIITQEQLLVLSAMILLYAEYLATNSNGALLVTWFLDTSSLPNRHSILTEKL
FT                   LPHIVELCCDRLASLTILKILNFRSDEHAKRVILDTIFGALDSDSGPPQTLYQLLSDTN
FT                   YGSTFVYKILSTPLLEGEIRNHVIQQVRHVLMEHSGPQHRRLMEEVGFANSSTTGSSGN
FT                   NSSASSKHRPAVSHVYATDSSGHMRTVSVSSNRSSGSVPRTLTSSQSHSAATSQQSPGS
FT                   SSTVCGYNYPGTFPTNSGSFSMAADDLATQFDILNINNNAQMPLPQISMNQVNTNTNGY
FT                   TTHNGTFGY"
FT   CDS_pept        134484..135362
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749047"
FT                   /locus_tag="AGL304W"
FT                   /orf_name="AGOS_AGL304W"
FT                   /product="AGL304Wp"
FT                   /protein_id="AAS54187.1"
FT                   /db_xref="HOGENOM:HBG060048"
FT                   /db_xref="InterPro:IPR018847"
FT                   /db_xref="UniParc:UPI0000253332"
FT                   /db_xref="UniProtKB/TrEMBL:Q751R0"
FT                   /transl_table=1
FT                   /translation="MEKRPYKRALKQFDVNVQRKRSLRNKNSFMNDSSSVTSPYENDER
FT                   NKENKVPSGREIVRPTLFENSPTTDGNLTEEINECIDKRCADRSGGSRLTKDALVELQL
FT                   LIREFEVQQFAECKHAFCQQGLGIDNLCQCRTNFLFELEFFEGRDKIEAGNLRRQCYCK
FT                   RIYTAIDSSWHVSPADDSAEQWEGLEWLLLPKIEPRSVATAELHGNRVCPDEGVVRQKS
FT                   LPATVLQIRSSHRVFDESVDLSEIFKQWSSSSSVSNWDPPNDSFEHCPSAQAKCALKKR
FT                   ILRPSDIVFPK"
FT   CDS_pept        135708..137318
FT                   /codon_start=1
FT                   /gene_family="HOG000223742" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927766"
FT                   /locus_tag="AGL303W"
FT                   /orf_name="AGOS_AGL303W"
FT                   /product="AGL303Wp"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /biological_process="translation"
FT                   /protein_id="AAS54188.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG000745"
FT                   /db_xref="HOGENOM:HBG395951"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="UniParc:UPI0000253333"
FT                   /db_xref="UniProtKB/TrEMBL:Q751Q9"
FT                   /transl_table=1
FT                   /translation="MLRVHRLYSTRGAAEVLHAAPKYALRCGLEIHTQLNTRNKLFSLS
FT                   TNDPFQAAATPNYHTSFFDISLPGTQPRLNYEAVLYAIKLSLALDCRVNLKSQFDRKHY
FT                   FYGDQPLGYQITQHYNPIAKDGKLCLYGAYDNIPEDEKTIGIIQLQLEQDTGRSLYKDT
FT                   DGMTLIDLNRSNVPLVEMVTQPDFTDVKQVRAFVKKYQNLVRHLNISTGDLETGAMRVD
FT                   VNMSVNGHARVELKNLPNTSSITNAIRYEYQRQVDIIRSGQADKMLKDVETRGWTGSAT
FT                   IKLRSKESTIDYRYMPDPEIPVLLLEPEVVHRVATALPELPDQTLRKLMAEPYNLSLKD
FT                   AKILTTNSNSHGNFYTHHDLRNYFMKTFQLFTAKTGASNSKLPANWIIHELLGIINKLE
FT                   IPLPKILQLLPASHFAEFLALIHDNELSKSSAKLLLFHIINDFKESHCSNLALPDFRLL
FT                   IEQYNLNPLNEVEEHALTELCQYVLRELNDDALVADLVSGKKKNALKFLLGKGMRLSQG
FT                   KVDPALLEGAFKSVLGIKW"
FT   CDS_pept        complement(138217..139110)
FT                   /codon_start=1
FT                   /gene_family="HOG000144379" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774754"
FT                   /locus_tag="AGL302C"
FT                   /orf_name="AGOS_AGL302C"
FT                   /product="AGL302Cp"
FT                   /protein_id="AAS54189.1"
FT                   /db_xref="HOGENOM:HBG060060"
FT                   /db_xref="UniParc:UPI0000253334"
FT                   /db_xref="UniProtKB/TrEMBL:Q751Q8"
FT                   /transl_table=1
FT                   /translation="MPGQIVSIPFISQIEDMDKYLLEYRALKSMPAGAGFGQGGTFRQG
FT                   NRGPVGGRKRAGGYEKRFQVGAGKYGGQPLAGGLQQGYPAATYPQVFYGGKLGSGGSSG
FT                   SLPLMAQQASAQAFLASSSSSGSTSPPRLQSTISGSSTINSLGSDFGEYPSMVNELSKQ
FT                   YDSIGFGQGSGGSPGVSNFNIGSPFTQSSTPLVSTAATNGEFMHALPSSLLGDTSVNSN
FT                   ISLLAGTRSLSTSVFLSNQYPSSSSQSAFTMLPGSSSTWGTSQTVATGTTGANQSNSSS
FT                   TSGSLRIWNNDMSVWG"
FT   CDS_pept        complement(139480..140565)
FT                   /codon_start=1
FT                   /gene_family="HOG000208823" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774755"
FT                   /locus_tag="AGL301C"
FT                   /orf_name="AGOS_AGL301C"
FT                   /product="AGL301Cp"
FT                   /protein_id="AAS54190.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG315851"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0000253335"
FT                   /db_xref="UniProtKB/TrEMBL:Q751R9"
FT                   /transl_table=1
FT                   /translation="MSLYRPTGSASTSSAMATDKELSNDITINNPANDSVSDIAFSPQQ
FT                   DFLFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLY
FT                   DVASGQAQQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYWDMRQPQPISTVAMP
FT                   ERVYALDSKQKLLVVGTAERHIVVIDLNNPAQVFRTSMSPLKWQTRTVACYIEGNGFAI
FT                   GSVEGRCAIQYVDEQEQRKNGFSFKCHRQQQPASGRASSESLVYPVNSIVFHPQYGTFA
FT                   TAGGDGSCNFWDKNQRHRLKGFPSMNASIPVCNFNRNGSVFAYALSYDWHQGYMANRPD
FT                   YPNVIRLHATTDDEVKEKKKR"
FT   CDS_pept        complement(140942..143761)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622196"
FT                   /locus_tag="AGOS_AGL300C"
FT                   /product="AGL300Cp"
FT                   /protein_id="AAS54191.2"
FT                   /db_xref="HOGENOM:HBG060070"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="UniParc:UPI0001DB2AE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q751R8"
FT                   /transl_table=1
FT                   /translation="MVENKQLLNSYIYDFLIKSSLEETAELFKQEAGVPDGQPDMDAPH
FT                   GFLYEWWQIFWDIFNARTHRGGSDLAQQYFQMQLYKQRQEHAYRGIAMHAARVQRKAEQ
FT                   RGEYAQEMFDPVLFSMMAMNSQSAGLRGGSQQAAHAVRSAPYAAPGPHTPQQGMTAHYA
FT                   GGMASAVGQPSGKVPPVVAGPASYYDHTTLSPHQMMGGLAQVPGGMISRPEQLDGQRQG
FT                   DPQPTPTMTVSPSGTMGQGQGQHHGPIFQNQPALYPYNVAGTMYPMQQQSPMAQPFVHS
FT                   QVMPMSMSSGAATPVGRPASATSANPPTQRRRKRSQQQAQQQAQQQAQQQAQQQAQQQA
FT                   QQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQHAQQHAQQHAQQQ
FT                   AQQQAQQQAQHQAQQQAQRQAQHQVQHQVQQHAQHAQHQAQQHAQHPMQPHVQQQHSHF
FT                   PQQQHHRHSQQLPMSHLQHSQSQLQQRSQIHHAPPHQQVSYPPQPLKQQRHASLPQLPE
FT                   AQNLYAQHHPIQQDSQAQDRPDSRHSSMDKDFTNADGLHNYRRQLILLERENKKAISAP
FT                   PRDVQSASSTPLTSPQVLHRFNHSMLPPSSVISPQTSGSPNPVAMQMSAMTGSIGIVGA
FT                   PTAATQSSAGATAVKKRKYTRRKVDSTKRSLSEPNSPATPITPFTSSTLTLASTLTTVT
FT                   EHPQHELSSALLEEDERKKKRPRKSLSVHPTPPFSTDSLMETVPSGNANIKKNSHASSV
FT                   TAAVSGAVSGAVSMNKLRMNGKKAMGVPSNKKAPAPSGTVQYAAPPGVITAAAPFAAVP
FT                   TAEDLLSGSSASTESVAHMLPLGPNSSGLSPSHGTGLDTLHDDPTLSGDVPFQFDQEDA
FT                   DLLASVKKPIDVDVINSAISTDTANPGSAAGSLAASVTNPKDQDTFNLDFSDPNSNYND
FT                   FNFFQFSWR"
FT   CDS_pept        complement(144583..145881)
FT                   /codon_start=1
FT                   /gene_family="HOG000237555" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749048"
FT                   /gene_name="ALG3"
FT                   /locus_tag="AGL299C"
FT                   /product="Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl
FT                   mannosyltransferase"
FT                   /EC_number="2.4.1.130"
FT                   /function="dolichyl-phosphate-mannose-glycolipid alpha-
FT                   mannosyltransferase activity"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54192.2"
FT                   /db_xref="GO:0004584"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG034282"
FT                   /db_xref="HOGENOM:HBG525447"
FT                   /db_xref="InterPro:IPR007873"
FT                   /db_xref="UniParc:UPI0001DB2AE1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751K5"
FT                   /transl_table=1
FT                   /translation="MSAAVPTTRAGTPPTLQCGWRSACGKLLDIANYVIFSPEASAVVM
FT                   PVLVAWECVLLKLIVKHVPYTEIDYLAYMEQIWQINNGERDYSKIEGGTGPLVYPAGHV
FT                   LIHRLLERATDGLQNVARGQDIFTWLYLLTLVLQFGVYRMLRLPPWCIVLACLSKRLHS
FT                   VYVLRLFNDGWTTLMMVVAVFLLLLAARHPRLCLPAALVYSAAVSIKMNALLYLPGVLV
FT                   ALFLLTRGHLLALALCGAVAVAWQVLVAADFLSTHPAEYFATAFDFRRQFMYRWSVNWQ
FT                   LVGEQVFSHPTFHRCLLLSHIAILMLFFFTRYAAPRQPNWFRTAAAALRHPATAVLAAS
FT                   PPRAHVAYVLLVSNFIGVLFARSLHYQFLAWYHWTLPALLHWARMPCLLALLWYVLHEL
FT                   CWDTYPPSSVASATLYALNSALLLLLYINGPPA"
FT   CDS_pept        complement(146168..149515)
FT                   /codon_start=1
FT                   /gene_family="HOG000246583" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774756"
FT                   /locus_tag="AGOS_AGL298C"
FT                   /product="AGL298Cp"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="AAS54193.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG056650"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI0001DB2AE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q751K4"
FT                   /transl_table=1
FT                   /translation="MDQAFVAQLEQTLAAIVSPNASSLKETTKTLQTQFYTQVTALPAL
FT                   VHIMQNSGDDALKQLAGVEARKLVAKHWGKLDGALKTEIKSTLLQTAFTEPKDMVRHSS
FT                   ARVIAAIGSEDLSDDQWPDLVPNLLRAAADENPKTRETSVFVLLSLLESYNDALGKYIA
FT                   EFLTLFSQTINDSASLETRSLSVQALNHVSALIEEQEKINPEHANQFAALIPSVVQVLD
FT                   AVIKADDNVNTKLIFNCLNDFLLLDSQLTGNAVVDLIKLALQIAGNVQVDEEVRVFAVQ
FT                   FVISAVSYRKSKIQQAKLAPEITITALKVASDQVDVEDELNTEEEAGENEENTPCLTAM
FT                   RLIAFCSTEFPPSQVAAPIMEHLPAMLSSANQFERRAILLAISVAVTGSPDYMLSQLDR
FT                   IIPATISGMKDQEPIVQLAALKAVSQLTTELQDEVAKFHEEYLPLIISIIDNSKHVVIY
FT                   RYATTALDGLLEFIAYDAIAKYLEPLMNKLFQMLESQTSSKLRAAIVSAIGSAAFAAGS
FT                   NFVPYFKTSVQFLEQFIQNCSNIEGMSEDDIELRALTFENISTMGRAVRSTTFAEVAEP
FT                   LVNSAYEAIKTDSARLRESGYAFIANMAKVYGKDFAPFLETIMPEIFKTLQQEEYQFNF
FT                   DGDADDLAAFADDADEDDLQNKFTVNTGISYEKEVAAAALSELAIACKEQFLKFVEPSL
FT                   KVLREQVDESYGLRETAMHTIWNIVKAVLLTTNINEDNYPKGVPTGSYVDSSVLSVIQT
FT                   AREISLDGLSEEFETSMIITVFETMAEMIKKFGPIIIMDNGDSTYLEQLCLQVLSVLKG
FT                   EHTCQTIDYEDDVPKDEDMDASETEAALLDVALEVLVSLSHALADGYPKVFEGFKPIVL
FT                   SLFETKSKNKRSAAVGAVSEIALGLKEHNPYVQELLQAMIIRLTADKSLEVRGNAAYGV
FT                   GLLIQYAQFDVSAVYEPVLKAMYQLLNTADQKVLTANDDEATKEIIDRAFANATGCVAR
FT                   MTLRSENLVPLEHTLPALLSHLPLNTGYEEYDPIFELIIKLYQANNSLIIAETPRIIEF
FT                   FAAVFTKDNERIQLEKESTLGREENMDKLKQFQSQEMRQRVVELLKFLNQTYNGIVAQN
FT                   AVLAPVIA"
FT   CDS_pept        complement(150249..153161)
FT                   /codon_start=1
FT                   /gene_family="HOG000141812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774757"
FT                   /locus_tag="AGL297C"
FT                   /orf_name="AGOS_AGL297C"
FT                   /product="AGL297Cp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS54194.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG060088"
FT                   /db_xref="HOGENOM:HBG203685"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0000253339"
FT                   /db_xref="UniProtKB/TrEMBL:Q751K3"
FT                   /transl_table=1
FT                   /translation="MGMSSAPTGVSNGGSTIPIIEIATYAGVDVYECYCRGKESSIVMR
FT                   RLHDDWVNITQVFKVATFSKTQRTKILEKESADISHEKIQGGYGRFQGTWIPLDSAKGL
FT                   VAKYEITDIVVLTVINFQPDPMNMPPRRSKNSIIKKLSPATRITSPSSYNKTPKKKVSE
FT                   LANQSTTGSVSKKTRKRAGAKAAQPSPLQNLVFQTPQQQHRNSQQQTNYTIVGHDQETP
FT                   INSIMVVETTSSMQKRTHRRSASSVMLLPPAPSNKKPEASLPPAPATSSSSKQHRYAAT
FT                   QKPLQFYPFPVPTSTSNNIQDIHIISENPNQKHKTKKSANKPKSKQGAQVVQTPAQTKK
FT                   PPPGKANPKMSSFTILPPITAIHKTSTSSGSNTSHGSSIDCYSSNDNPTPISSRSGSPQ
FT                   SKETFTPSEYKNLILQVLSTEYDSCEPVLPEKMYYPPIGLDVNFIIDKQGHTSLHWAAA
FT                   MANIPLIKILLTLEADIFHCNDKGFNCITKSIFYNNCYRTGAFFLIVELLRMCLVTPDA
FT                   NGRLPLHYLVELSVNKSKDPLVTNYYIDTILDVLSKDDPSVLKMCLNYQDSIGNTVLHL
FT                   AALNMNLALSNKLYYMGSSMEILNSHQQTPASILSKASMTQPIPNVINTPMPTMMPTPM
FT                   TAPISANTGQVSFRKKQSKLNTPLRPRKSNKDDIISATRHKVQLCETTFTETPQNPTVV
FT                   TSATHSTSMPEPSSELAKTPSHHEKLFALDRIAELNSTPVLKVTTPGGTAMKELSVPAA
FT                   SQETISEHRYSVAVDPLMQIQKSTRLTFPNVANTAQEFSELSQSLTEAIEQNFIKLGTE
FT                   IAKATEGIEGIDRSLKFSEKQVADILVKHGVTDTEQLKHKIHDEQNALQAQISRFANSI
FT                   EKSQALTLATLVHDEEEKADADSSHEQSTEGAKQLFRLGLELSLLQLKRKHIIDKVCRA
FT                   KTTINSGTKIYKYRKLIGISSDDIESKLNDIENDLRGAVA"
FT   CDS_pept        153801..154307
FT                   /codon_start=1
FT                   /gene_family="HOG000182713" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927767"
FT                   /locus_tag="AGL296W"
FT                   /orf_name="AGOS_AGL296W"
FT                   /product="AGL296Wp"
FT                   /protein_id="AAS54195.1"
FT                   /db_xref="HOGENOM:HBG060092"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000025333A"
FT                   /db_xref="UniProtKB/TrEMBL:Q751K2"
FT                   /transl_table=1
FT                   /translation="MLPLYLLTNAKGQKLFIELKNGETIEGELVNVDNWMNLTLQSVVH
FT                   AGSDQTLQLPEIYVRGSFIKYIRLQDDIIEKVKQQLNSGKDGSGSNGQQRDRDGRRYNG
FT                   RREGNAGGRFGNQEHQRKRGGGFQRRDGQYGGSRRGRSGQSGGAGFVQYQQSQQWQSSA
FT                   SQVQS"
FT   CDS_pept        complement(154456..156429)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622197"
FT                   /locus_tag="AGL295C"
FT                   /orf_name="AGOS_AGL295C"
FT                   /product="AGL295Cp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54196.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG060098"
FT                   /db_xref="InterPro:IPR004240"
FT                   /db_xref="UniParc:UPI000025333B"
FT                   /db_xref="UniProtKB/TrEMBL:Q751K1"
FT                   /transl_table=1
FT                   /translation="MKVRILWRRLAAAVAAASLALVLLCGHSIWQRWSRPPQPSAYTRG
FT                   ERVQLLVDNIWTDREVWGYYETLFTCPPPAEARAIYGSLGQVFRREMPWESNYVLHVRA
FT                   ETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWTLDGLPAATTYPDRQSSYRYEAGFKLG
FT                   EVDAETGHVRLHNHVMLVVRYRILDDGRYVIVGFEAYPRSVAGEGCTGGQTEYEHFWLN
FT                   PDAQAMIMVPFTYAVYWRYQSAVKWNERWRLYSDLQQLTGIVQSPGSLVLSRGLFAAMV
FT                   GTLVLGMASAYLNKRCPATMHTLVTLLQEDMVGSEFFHGLVGAGLQTMSLAAAYALVEC
FT                   ENDKAHGVTHVTIVLAATICALGAYLAAFYGVWTWATTQSVVVHRYIKRSVICGSAIPI
FT                   LLFVTAAIVHLIVMLSDRTRGIPFATELAVLALYIPASAILSVFGGFTAFSILRTREDR
FT                   VALLDSKGKWASATSEQKTTNENSTGRSRLTRIASVLYSLLAGVPPFILAKSLVQATYS
FT                   TVAVAKSALELDAFIFSALALQCLVVVEVCIGTMLAQIFWSQIFQITGCEYPKPRKGVL
FT                   YSWRWKLFGVGGAAAWYLEAHAIHSIRHAYAHLGSPNIILAIFYATVLNIAYWLVFGAF
FT                   GYLVCSGLMYSIQGRADIYRQH"
FT   CDS_pept        156970..158940
FT                   /codon_start=1
FT                   /gene_family="HOG000214050" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749049"
FT                   /locus_tag="AGL294W"
FT                   /orf_name="AGOS_AGL294W"
FT                   /product="AGL294Wp"
FT                   /function="binding"
FT                   /protein_id="AAS54197.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG124377"
FT                   /db_xref="HOGENOM:HBG397840"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000025333C"
FT                   /db_xref="UniProtKB/TrEMBL:Q751K0"
FT                   /transl_table=1
FT                   /translation="MDRQHSSIQQQPRMSAVLQETISQLKHLIITHIQQLNYDSAEFFS
FT                   ELLYADCSCTNTGNNTGTIDESRERFDSLYYYALTLYLQGDYHSSVHVVKDALSSHLGC
FT                   AYVYARCCLKLGTRYQDAIQALMALRDCWQNGVTNSTDLFMYPDKATVLSVMGQLSLKS
FT                   HREKEAVSFLSQSLSTNSYQLEPLSILFEMRADLQTVKLFKPVKKSWKAKHLRTANIIS
FT                   KPQTPFKIPSRLSTSAVGAAPNPLLSTSSAIVSTSPSMMRRSKFLNSNSNASNATSNIN
FT                   NNNNVNNNGQQSTPPSKLLNIEHNKTTPDDKLSPSQMQLLSHNPLPHKPLDQLMYWMMK
FT                   AYKSYYRYDSYRAIRLLNEQLPSHILQNMPWCLALLSRLHFEIQNHDMSLSYFNKLRRL
FT                   QPTRLKDMDVYSTLLWHLHDKIRLADLCHELMAQDDKNCITWCCLGNLFSLNRDHDEAI
FT                   KALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCI
FT                   KLGQYDEALLHFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLA
FT                   LFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAM
FT                   NLDPNGIQLVKEALEKCHEQG"
FT   CDS_pept        complement(159161..162115)
FT                   /codon_start=1
FT                   /gene_family="HOG000066063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749050"
FT                   /locus_tag="AGL293C"
FT                   /orf_name="AGOS_AGL293C"
FT                   /product="AGL293Cp"
FT                   /protein_id="AAS54198.1"
FT                   /db_xref="HOGENOM:HBG124376"
FT                   /db_xref="HOGENOM:HBG204187"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniParc:UPI000025333D"
FT                   /db_xref="UniProtKB/TrEMBL:Q751J9"
FT                   /transl_table=1
FT                   /translation="MSFSFKKALKLTGMEQGDDSTAAEERPRYGTYIAINEYSKRMEDE
FT                   LDMKPGDKIEVITDDQEYNDGWYFGRNLRTGEEGLYPKLFTQELSVERTPSLMRAKSTR
FT                   RAHSPMSSAPASRNDSNSELPGHMVETAATIRFPPKLPGEGRAISVKSTMSDIDKALEE
FT                   LRGESMGALHFADDVSEVSKPPTSGNTTLNYANSSFPTSNDTSTSNNGHPDEQELNPAD
FT                   AELWTPEQVTAYLLSTGFDEESSNKFQEHKISGAILLELELAHLKELEINSFGTRFEIF
FT                   KEIEAIKETVAKASTSQTKANGEGQKTGGQLMPAAPVSQDHALAGQNLRQNIKDAASLG
FT                   KAVPQQVLYQAPSSPELAIYSGTPTDDTFMSPRKAPEPPSYPSPVQPPKSPSVTLLRHI
FT                   SNSSSLLQNQARNQHITIYEHGPQTLNSPASYTSSRKQSIPQVFMQPAVDEQPDGPDLG
FT                   NPYSNPGISPMQRTFERAIPEESIRARHKKTKSGGSFVELFNRISMLSSPNDYEGLGAQ
FT                   DSLAVPAPTGRPSSSIYGHSRNVSASTNKRASIAGEFEHKHRRNSSILSFLNREKDVVA
FT                   PQAKPELVKHGSLSSLRIDTTRNAHIDDANPVIATQQTPASRLSEFYSPGRVSQDVAQT
FT                   ADGSSDIDFRASSERRSTGLKEPRSPIGAFFDARDDLSSNNSATAIDKNAKNSSKRTLG
FT                   DAVKGKRRGNNVKPISKKQTSAFMEGIRNVTVNDAVQDAACSGWMSKKGAGTMGVWKNR
FT                   FFVLHGTRLSYFANTTDNRERGLIDITSHRVLPAKEDDKFVALYAASIGRGRYCFKLVP
FT                   PAPGSKKGLTFTQPRVHYFAVETREEMRTWMAALMKATIDIDTSVPVISSCATPTVSLS
FT                   RAQEMFAQAMEETSKRDEMLNQADSAEVYWDQHHRNGGEETLNVSKSMTSIPLQAQNSL
FT                   IKSAVHSQATAIPDSPASNATKSSNYGFSFENPNANGNANEYYGLDPKYMGEKI"
FT   CDS_pept        complement(162598..163701)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927768"
FT                   /locus_tag="AGL292C"
FT                   /orf_name="AGOS_AGL292C"
FT                   /product="AGL292Cp"
FT                   /protein_id="AAS54199.1"
FT                   /db_xref="HOGENOM:HBG060106"
FT                   /db_xref="UniParc:UPI000025333E"
FT                   /db_xref="UniProtKB/TrEMBL:Q751J8"
FT                   /transl_table=1
FT                   /translation="MNRSIHSSVTAMASDDASSLRHERSTYSAESEETLVNSYGPYSTT
FT                   GIVMTSVMMNKAQRKGEVSEQWMRLFLDSTPVEDVAVLQRGMSVTGRCLDTLQRILQSM
FT                   HGYRQIVPGLAMFKEAWNLQCYHGNEADFPLLDVPIKVNSLTTLASLLVEHRVSGYSTP
FT                   IEQLTTVLQYLNKLLQASRVDSAHTAPAPGRPRSDSRGSRRSFGHKKPDARLTFTSPPT
FT                   AASLPTDSDSASIFSDQSLTSTVQKAKRGLFNRLMPRRKGSTSIRPAPGSAKRSHSRHS
FT                   SYTPSIFTDDNLSAKNEASFRRQNLEAMAKYQNLVLLLHTELAQLVPSPQTDVLFSFVA
FT                   KSILPFLISDCRTLVRSCVSTLLLEKL"
FT   CDS_pept        164248..165588
FT                   /codon_start=1
FT                   /gene_family="HOG000066064" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749051"
FT                   /locus_tag="AGL291W"
FT                   /orf_name="AGOS_AGL291W"
FT                   /product="AGL291Wp"
FT                   /protein_id="AAS54200.1"
FT                   /db_xref="HOGENOM:HBG060108"
FT                   /db_xref="HOGENOM:HBG204183"
FT                   /db_xref="InterPro:IPR019448"
FT                   /db_xref="UniParc:UPI000025333F"
FT                   /db_xref="UniProtKB/TrEMBL:Q751J7"
FT                   /transl_table=1
FT                   /translation="MSLLFNSKNKSKRPKFLLHLEIKELSNIPQSSGYCYVKWHLKDGT
FT                   GTLSHSVKEVETSDQQHVAVSNQSKGSTAHVLVRAHRARWNHRLEPPVKVKLAVDHERR
FT                   LARKELTLDVYFEFMEGEHMHMRGNCPSPSPSTLSSQSGTITGAGGSGGSVYTKKVSGK
FT                   HLLGSVTTDLADYVNLQQEPITNRLLLQRSKINSILTLSIRLQLIRGHMDDFLLREQQE
FT                   PCSGTGAGWHDVFDDGPPDMPPALVVPQITRTSSPSMNNSSGNSALYHSGLSPARRFTK
FT                   TDGLSMTFTNPVVEKLYQKSVEIPWDPRPGEYSARDCVEDILEGGDGWAKNERGLSLVD
FT                   LQAAHPIEADVGLIQRPRITRSGPSYLLVPPMQLAPAPSSKISIDRRDDWDFLSARQRK
FT                   HIRIKNRKEGTGRLLENREEFESDLSLEGSPRQNSDDRSWRVKHILP"
FT   CDS_pept        complement(165708..166256)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749052"
FT                   /locus_tag="AGL290C"
FT                   /orf_name="AGOS_AGL290C"
FT                   /product="AGL290Cp"
FT                   /protein_id="AAS54201.1"
FT                   /db_xref="HOGENOM:HBG060109"
FT                   /db_xref="UniParc:UPI0000253340"
FT                   /db_xref="UniProtKB/TrEMBL:Q751J6"
FT                   /transl_table=1
FT                   /translation="MSDNKSRRKPFYNNHVRRSRAIGCSAVASAAGVVMRSASQQVYGT
FT                   ETAEALCSNTKLTKRLLDFHLKRGRWKSKKRRPLKIEDFLDNGLKHIRSGIYAGSQDDR
FT                   PIRCSMRGIKHLYYVSPRVLCMCRWCSLRPSPLRSEITTYSDDESMYLQLLGRWNAGYF
FT                   QYCGDEVYGRQHNSLIRML"
FT   CDS_pept        complement(166463..167188)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774758"
FT                   /locus_tag="AGL289C"
FT                   /orf_name="AGOS_AGL289C"
FT                   /product="AGL289Cp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54202.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG060110"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0000253341"
FT                   /db_xref="UniProtKB/TrEMBL:Q751J5"
FT                   /transl_table=1
FT                   /translation="MAGERGGAALGAPLGGDEADGAQAEEWNTDGGTQESGASSESEAP
FT                   ARKRRRVGRNRQMYDSDDSDYDGSPPQVAVGDSAAGRAAAATARADESGDGSQSSVELA
FT                   DEGSAGGGEEPDIVYLEARGPVSGSVVDVEAEARLQQVVEIPDEEVGEEQTRLGGDRPV
FT                   ECKKAMDYKCPICFDPPEAALMTPCGHIYCTVCLFQMVNSSRGYRRNGQCALCRKDVKL
FT                   KEVGLVVLRKKRVRKQSAE"
FT   CDS_pept        join(167484..167525,167733..168104)
FT                   /codon_start=1
FT                   /gene_family="HOG000183703" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749053"
FT                   /locus_tag="AGL288W"
FT                   /orf_name="AGOS_AGL288W"
FT                   /product="AGL288Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS54203.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG384371"
FT                   /db_xref="HOGENOM:HBG594899"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="UniParc:UPI0000253342"
FT                   /db_xref="UniProtKB/TrEMBL:Q751J4"
FT                   /transl_table=1
FT                   /translation="MSGNGAQGTKFRISLGLPTGAIMNCADNSGARNLYIMAVKGSGSR
FT                   LNRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQSKPWRRKDGVYLYFEDNAGVIAN
FT                   PKGEMKGSAITGPVGKECADLWPRIASNSGVVV"
FT   CDS_pept        168267..176573
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927769"
FT                   /gene_name="TEL1"
FT                   /locus_tag="AGL287W"
FT                   /product="Serine/threonine-protein kinase TEL1 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54204.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG124834"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR015519"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR021668"
FT                   /db_xref="UniParc:UPI0000253343"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751J3"
FT                   /transl_table=1
FT                   /translation="MEQYVASAINLLSSPKLKERSQALTDVAAIVKDNPDTLTSKSVGA
FT                   LVQSLIDILDAETRKFDELCRRRPEAGARVELAQGRLNSVVAVLRLVLETIPDRLRAKQ
FT                   FRGLVLSLPELLGWAIREQVHDMLQPLSACLQALTECHTFKLKVDDGQWRTLVRASAED
FT                   LVALFGINCTHKSIAKLAGALTSLIRMDAVGFKDVCEELLLIPVRYYQNTDKETANMRS
FT                   ILQLCNLLVLKGHLIKFHGVQYLIHCTMQHLLQFTLPGTDYILEEIAVFTLFSAELMIH
FT                   EVPYIPGDLESGRYFGKEVLSELYQQFIVHLLENYRPQKLQLKDLEYRLLLDRRQWYQL
FT                   DDFQISPHASHIEWLQLQGISNMLCSYYAFQHRHPVMDISQVKRRRLSDTYNSFLLNSQ
FT                   YGISFATSCIDSNPVSSQLLGLQLAACVTSFHECPKYQLEELLDAILRRFENANLVGWC
FT                   CLAMLPLCSQLDLVISETVLQKLLKLTLPLLKIPTLSAVASALISKLLDYQQRTLTGSN
FT                   MLQQCYDLYELSDIIGPAVVSNESFRLWQSLHIYGGDFRGKDGSSAADRIANWLFAKLN
FT                   TVSPLDESQNSFPHFLGWLAGCQLKDAYEVNRAIHVNSYCLEWEYTSVERTFLLSIETS
FT                   RRLSRNRTTPLQNMNYESSSISELFYRILDKITSQDDIEAYGWMCFGLQLIHHIRELTY
FT                   LVEYVNDLKKAICLRLGKMNFGNSQILLSCIRQTTSLPSCDILPLFFTEREIANIIYTY
FT                   KELKLTEVPEGPAEDDFAGPAKARHKLYPLNHLYAGKQGFEIDYVVSFIIMCSDYETNG
FT                   DAAEKVIELFLQLARSLPTNLIFQALPTLITYIGSNDRENISEDTLLALTEFTGSSLLT
FT                   NEYNTSTLSITYLSLFLKSISRYWLSDTHMPSLTADCNDILEWIFSRLGDSSCIGCEAI
FT                   MAILDMTLHMLKNYNRSNSKFTFDKQHLFHVLTTCLGRLPKFYICKVVHELNSYVVRLG
FT                   LKNQSIIFSEFAGLFDPPQRDAETAAYYSLTLAGLGTISHMHLSNAILHVLPNLQHKHV
FT                   SQYALSFLKSVAGFHKLSGIRALFHLCRFEILDIWSNKCAGLRDFSPIWNTAIFQFESF
FT                   EQFINEYKHEVAAYYFAKLSPYHYLKSTLVNDDKELPQLLEISLQYAIPLAYIPGGIGD
FT                   AIFDICADQWSATNHTNVLKQQYLLIFDRLLHFADLTVFMEYFESLQKVYTNSELIHKM
FT                   KKYTYNLHPKHLLSYSLRTALKVIHSKVLLGKLSIQELRFLLTLNLQYLQESTLPDDRS
FT                   QILRKIQIILVAYEQQLEDASSVSDLLEILTDYLDDPLLGNEVGALIGSIVALGFNVKY
FT                   TESLFLCIFAKLLPQLHEAKTANLSILLNDISNTLTINNSNIIHGKWWHACIDALAGTS
FT                   LFENTIYHDDSLLDTELLDHRALNLYSEILSFLPPFTGFPPNFVPKERVLRHLISQTTT
FT                   FKLHDNFLLWKGHYIGMYHKFHGTIPQLAPNGPNQKLSIDKLVKNYGLLNGIFELLEAI
FT                   EKTTHARIKFICQCINAVSLSHKDSLSTFTADTQQFFGQLSSKSVPLDLALFFYMFPIS
FT                   NPSESMETFCRLHYPALTSDYSSWLVKLTMFALDMLGRYIPVVKCFEVLATAITSRVEQ
FT                   LLNYWLLLLLYCDPNNGIRLLCTLISNIGLLKSTKEGILKIKYMLNLLLIVRSFHKLGY
FT                   KEFDTIYDRISLQDAYKVAAEVGEKYIACLLFEEFHMPNLARLDVTYMKEIYKQFDDVD
FT                   MIYGIPTTASLASAIELINQTQATSLKSFMMNNGNFDAQYATHFTGNIGNLVNSASNNG
FT                   FTGLAYALQNISSSKNTSATYNWCIELDKWDLPTPDILDSTAKSIYSIIKKTDINTGTA
FT                   EAAFKSTMLNALQFLEKTGVNEDNVSQLGSIVTMVQLYNNNAEKLVKSLHAQDRKILKV
FT                   KDFNDYYMDIKVRHVFLDHLIDSHKNRLSEEQSICLRFASICELSHLSEVARGASDFQR
FT                   SLDAVLLLEKSVLALPTNSSVEHYGLFKTFARRMSTIQSAKMLWSQNETVMSIDMLKDL
FT                   LHTPLSSNLIARARKQPFFQQMAILDINVKAQLVQWLSHSRQDVPERIFKNYIGTSLQD
FT                   IENYGDNPSRTEIVHTFGKFCYDQAKRFSETNEVDIMARRVSKNKEELAALYQLYHDRS
FT                   LPERERKEAKRHYARLLVRNQQETETYNQLRDQRELFVTNALLFFTQTLQYDDLYDGEV
FT                   IDQFCGLWFEYSNDDNVSGKLLSNLQNIPEYKLLPWINQMASKLADDESPFQKTLRAAM
FT                   VRILLKLPYDSLYVLIGMSLTGSRQNAKDSGSQSRLVAVESLLKEVSKHDYGSYATKYL
FT                   LPVREFCEMSVSLASQKFAQNTRKIHLNNLKIGTYWLKELKGRKLPLPTAQSRVSDRCG
FT                   NSVSRSYITQVDPDVRIASSGLSLPKIVTFTLSDGTRHRALLKAGNDDLRQDAIMEQVF
FT                   KQVNKILTSNKRTRKLKLRIRTYEVIPLGPQAGIIEFAPNSKSLHEILAGYHKDDTISL
FT                   EQARKAMKAVQGKSKEQRIAVYVKITESVKPVLRNFFYETFLDPEEWLLAKATYTKGVV
FT                   TNSIVGHILGLGDRHLNNILLDKFTGEPIHIDLGVAFDQGKLLPLPELVPFRLTRDIVD
FT                   GFGVMGVEGLFRKNCEKVYGLLRKERERVMCVLNVLKWDPLYSWKMTPLRRQKLQGKLV
FT                   DGDSPSDSLVTSLPDSSDNDESRRALKGVEDKLLGNGLSVEATVQELVHRATDVSNLAV
FT                   IFMGWSPFY"
FT   CDS_pept        complement(176794..177786)
FT                   /codon_start=1
FT                   /gene_family="HOG000174182" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622198"
FT                   /locus_tag="AGL286C"
FT                   /orf_name="AGOS_AGL286C"
FT                   /product="AGL286Cp"
FT                   /protein_id="AAS54205.1"
FT                   /db_xref="HOGENOM:HBG060111"
FT                   /db_xref="HOGENOM:HBG395758"
FT                   /db_xref="HSSP:1A0N"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI0000253344"
FT                   /db_xref="UniProtKB/TrEMBL:Q751J2"
FT                   /transl_table=1
FT                   /translation="MTLRATKARQQRVSPHIGHTFSFGNLVGDPFAISTLSISTIAWLI
FT                   TLGGGIATKKMPHFSWWGIAFQFVMMVCFVVIYLWDLVDYYRGFLAAGVGVAFVYSTNS
FT                   CSQLIYQEEPQQAAGSAGFMMLSIVNMIWMFYFGADNAAPANRWIDSFSIRGIRASQVE
FT                   SSLALARSQKAVASPQPAATAFYGGLEGHSQKYVSSTALNGFENTDPHTSTAFALGPEG
FT                   PTQRNLDTHGTSTYVTDTTNGNTETTMGDTLGLYSDMGDELVNFPYTAKALYAYEADAS
FT                   DAYEISFQQGEILRVGDIEGRWWKAKKANGETGIIPSNYVELVDDPAAL"
FT   CDS_pept        complement(178090..179412)
FT                   /codon_start=1
FT                   /gene_family="HOG000173527" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749054"
FT                   /locus_tag="AGOS_AGL285C"
FT                   /product="AGL285Cp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54206.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG210671"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI0001DB2AFC"
FT                   /db_xref="UniProtKB/TrEMBL:Q751J1"
FT                   /transl_table=1
FT                   /translation="MSSSVQSGVLTLLHTACGAGVLAMPYAFRAFGLLAGGAILACCGA
FT                   SAMVGLVLQSHVAQYVPPRQASFFSLAQISNPELSVVFDCAIAVKCFGVGVSYLVVLGD
FT                   LMPQLAGTVTAAPWLLDRNVQITFWTAAVIAPLCCMRHLHSLKYASMVAVAAVAYLGAL
FT                   VAARAAWPSPELERLRGPVSLGLPPGTSGGAMLSSFPIFVFAYTCHHNMFSIVNELRDN
FT                   SLGACLRVVVAAIALAVALYATIGGAGYLTFGDHITGNIIAQYPPAPATTLGRAAIAVL
FT                   VMLAFPLQCHPARASINHIWHYCVPSHTAAPSEASALIRGGSPPADAAEGPADEPAAVP
FT                   LGPRRFAAITAALLIASYAVAVSVTSLARVLAVVGATGSTAISFILPGLFGYQLIGSES
FT                   RADQLPPRTRFLRLLSLLLAAWGLVVMCAGLSAALLFDPTH"
FT   CDS_pept        complement(179597..180031)
FT                   /codon_start=1
FT                   /gene_family="HOG000066065" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079000"
FT                   /locus_tag="AGOS_AGL284C"
FT                   /product="AGL284Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS54207.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG060112"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniParc:UPI0001DB2AFD"
FT                   /db_xref="UniProtKB/TrEMBL:Q751J0"
FT                   /transl_table=1
FT                   /translation="MLRLLAPRPLTARPFSSALRALQQPAFDPTLLDAASAVGARAGDP
FT                   ALHAASMLSPREDAFRSRLTGVRAGRTVSVFNGNTSQALQRQNMLLRSARIAQDRREQR
FT                   FYLKPGKVKEQQRSRKHRREFMRAFKGLIEVVKDAKRKGY"
FT   CDS_pept        180323..181372
FT                   /codon_start=1
FT                   /gene_family="HOG000226278" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749055"
FT                   /locus_tag="AGL283W"
FT                   /orf_name="AGOS_AGL283W"
FT                   /product="AGL283Wp"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS54208.2"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG008278"
FT                   /db_xref="HOGENOM:HBG318153"
FT                   /db_xref="HSSP:1B6A"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018349"
FT                   /db_xref="UniParc:UPI000042B7AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q751I9"
FT                   /transl_table=1
FT                   /translation="MDYGQDFNVARVTDAERRYEERDRARAEEWNDMRKGAEIHRRVRR
FT                   HLQNRLRPGQTLTEVVELVENATRKFTGTDEHGRFAATPKAQGIGFPTGVSLNHCAAHF
FT                   TPNAGDTTVLRHEDVMKVDFGVQVNGHIIDSAWTVTFDPRYDPLLEAVREATYTGIREA
FT                   GIDVRLTDIGEAIQEVMESYEVTLGGQTYQVRPCRNLCGHNIVPYQIHGGKSVPIVKNG
FT                   DETKMEEGEHFAIETFGTTGRGYVVQSGECSHYAKNPGALPAPTLSRAKALLRTIDANF
FT                   GTLPWCRRYLDRLGEDKYMFALNHLVKQGIVQDYPPLVDVEGSYTAQFEHTILLHPHKK
FT                   EVVSKGDDY"
FT   CDS_pept        join(181606..181642,181934..182541)
FT                   /codon_start=1
FT                   /gene_family="HOG000066066" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749056"
FT                   /locus_tag="AGL282W"
FT                   /orf_name="AGOS_AGL282W"
FT                   /product="AGL282Wp"
FT                   /function="structural molecule activity"
FT                   /protein_id="AAS54209.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="HOGENOM:HBG060113"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016763"
FT                   /db_xref="UniParc:UPI0000253348"
FT                   /db_xref="UniProtKB/TrEMBL:Q751I8"
FT                   /transl_table=1
FT                   /translation="MIEIVPDVLEYKPPFTVSSTEYVTIKNNSNETVAFKVKTTAPKIY
FT                   CVRPNAAIVEPGKEMQIQVILLGLSEEPASDFKCKDKFLLITLPSPYDLGETTVAEAWP
FT                   QLEAEFKQQAVSKKIKVKYLLDSEPRDTSVAETATADYTAVQADTTDKMSDRAPAAKPA
FT                   ASVGSGSAPASASEKGRPAPVSRTQESGPIFNPALLLLVALIALVLGWLYY"
FT   CDS_pept        complement(182863..183258)
FT                   /codon_start=1
FT                   /gene_family="HOG000231288" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774759"
FT                   /gene_name="RPL32"
FT                   /locus_tag="AGL281C"
FT                   /product="60S ribosomal protein L32 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS54210.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG069834"
FT                   /db_xref="HOGENOM:HBG497568"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR018263"
FT                   /db_xref="UniParc:UPI0000253349"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751I7"
FT                   /transl_table=1
FT                   /translation="MAASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRR
FT                   RFRGQISEPTIGYGSNKKTRFMTPSGHKTYLVSNIKDLEVLMMHTKTYAAEIASNVSSK
FT                   NRVSILARAKALGIKVTNPKGRLALEA"
FT   CDS_pept        183784..184407
FT                   /codon_start=1
FT                   /gene_family="HOG000000709" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927770"
FT                   /gene_name="ROX3"
FT                   /gene_synonym="MED19"
FT                   /locus_tag="AGL280W"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 19"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS54211.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG060115"
FT                   /db_xref="HOGENOM:HBG204148"
FT                   /db_xref="InterPro:IPR013942"
FT                   /db_xref="UniParc:UPI000025334A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751I6"
FT                   /transl_table=1
FT                   /translation="MGTVHDDATMPSYYYYVDPAGPAYEPQQPNPIDDLISVYGLQDIS
FT                   RQVARTNADGTKAVKLRKSYKNQIQDLSGKFSVIPTRENGKGGEISPIVFQNTDGDAVR
FT                   ERGMGPEEWRRAQVFRDQALFEAPTMDWDMCAEVISQFERSYPGEFKNQGFEVEDLAFD
FT                   LDGSGANGAALGGKAKKRKSRSNGSSMATPNSDLQEDIKRRRLE"
FT   CDS_pept        complement(184446..185801)
FT                   /codon_start=1
FT                   /gene_family="HOG000162970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749057"
FT                   /locus_tag="AGL279C"
FT                   /orf_name="AGOS_AGL279C"
FT                   /product="AGL279Cp"
FT                   /function="ARF GTPase activator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of ARF GTPase activity "
FT                   /protein_id="AAS54212.1"
FT                   /db_xref="GO:0008060"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0032312"
FT                   /db_xref="HOGENOM:HBG177666"
FT                   /db_xref="HOGENOM:HBG736886"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="UniParc:UPI000025334B"
FT                   /db_xref="UniProtKB/TrEMBL:Q751I5"
FT                   /transl_table=1
FT                   /translation="MSEDAGEVYVDKAVSDEIFSKLNSKPENRTCFDCGNKNPTWTSVP
FT                   FGIMLCIQCSGEHRKLGVHITFVKSSNLDKWTINNLRRFKMGGNHRAREFFLKNNGKQL
FT                   LDYKADKQVKYTSAVAKNYRARLDKLAAKDREQHPAELVLATDEEQGSSGSSGASSKNN
FT                   SVDDFFASWEKKSASTPPPKILTPNPTGSSAGAARSSILSAPGRRRTPLAGGGSTGKKH
FT                   SILSSKRTARPAAKKADADLFDEFEKEAQREQEESAAAVSTETVRTSSNAYVQQKPIKM
FT                   HAASSSDDDLADNPYNDGTRFDQVRPAPTVEDVQPKLAKLGFGMVNNNASSLMEEARQS
FT                   KLAAAAPKYTGDVVAKFGAQKAISSDQMFGRGSYDEDSSREARDKLKSDFHNATAISSS
FT                   SYFGEPEPPALPQPAPFRMDLLGSEEDFELAKQALERSAQKLGNYLRDYIRK"
FT   CDS_pept        complement(186323..187015)
FT                   /codon_start=1
FT                   /gene_family="HOG000246617" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749058"
FT                   /locus_tag="AGL278C"
FT                   /orf_name="AGOS_AGL278C"
FT                   /product="AGL278Cp"
FT                   /protein_id="AAS54213.1"
FT                   /db_xref="HOGENOM:HBG060116"
FT                   /db_xref="HOGENOM:HBG396275"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000025334C"
FT                   /db_xref="UniProtKB/TrEMBL:Q751I4"
FT                   /transl_table=1
FT                   /translation="MVYRLIHKTFVLPLAGLTAGFLTFGQTWPATETPGERTAKRPLSG
FT                   QRVEVLEELEQLEEFRRLVREHGGVSHSEIIPAGHRNNNVMQGLLFGDAHMEIDPVMFY
FT                   DKENMQFTAFYHLGHKLADEKESVHKGVLALMMDEALCFCGFPTLPHKMGVTARLAIDF
FT                   EREVPVNSTVVLRAAVQEAKGRKCVIRGTLEAVPRRGETEPPAVYARAECVLVEPKWFK
FT                   YAIRMGFM"
FT   CDS_pept        187329..189344
FT                   /codon_start=1
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749059"
FT                   /locus_tag="AGL277W"
FT                   /orf_name="AGOS_AGL277W"
FT                   /product="AGL277Wp"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54214.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG060117"
FT                   /db_xref="HOGENOM:HBG324208"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000025334D"
FT                   /db_xref="UniProtKB/TrEMBL:Q751I3"
FT                   /transl_table=1
FT                   /translation="MTPLARTRHAGDLRTPEQWNARGRGAGCYKVAAGRGCAAASAPSD
FT                   AGAMTETHATCSGVSSRGASDNADKCDARASDTENALAQWPEDEVAAMGRAFAAKYGLP
FT                   NDEDIFGRAAALARAPRRFGTIGLLTEADRAACAEEVEHPWRIPRKLVHVVAASAMSAA
FT                   VQGMDETVINGANLFYPKALGLGGGTVREDWLIGLVNGAPYLCCAVAACWLTDWANNVL
FT                   GRKRVIFVTCFLSGLFCLLQGVGPAGPAGWRYLFAMRFLLGFGLGIKSATVNVYLAECA
FT                   PKELRGIVCMNWQAFTAFGVMWGYVASLVFYRVGDAGIGGGLNWRLMLASAALPAVFVL
FT                   FQLPHCPESPRWLMGKGRYPEAYAALLQLRKHRLLACRDLFYQHVLLVQESTLQLSYFT
FT                   RLKEIFTVRRNRNAFVAAFICAFMQQFCAINVIAYYSSVIFLQAGFSEIASLCSSLGFG
FT                   IINTVFAIPAYFMIDRFGRRFLLLSTLPWLGVFLLVTGFAFWIKDTKASIGVISFGIYI
FT                   FSAIYSFGMGVVPFVYAGEVFPLYVRAIGSSLFAVVLWGFNFILALTWPSMLRAMKPQG
FT                   AFGFYAAWNFIGYFLVYFFLPETKQLTLEELDEVFSVPLMKRADYYLSQMWPDFQETVL
FT                   RKKNVSRPPPLEYERVQLLDSAGSTRKPSFDHVEHV"
FT   CDS_pept        189590..190990
FT                   /codon_start=1
FT                   /gene_family="HOG000251788" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749060"
FT                   /gene_name="BNA4"
FT                   /locus_tag="AGL276W"
FT                   /product="Kynurenine 3-monooxygenase "
FT                   /EC_number="1.14.13.9"
FT                   /function="kynurenine 3-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="pyridine nucleotide biosynthetic
FT                   process"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS54215.1"
FT                   /db_xref="GO:0004502"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0019363"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG119430"
FT                   /db_xref="HOGENOM:HBG430104"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000025334E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751I2"
FT                   /transl_table=1
FT                   /translation="MGEKGESVAVIGAGLVGCLAALAFAKKGYEVSLFDYRSDPRLATT
FT                   TDRNLRSINLAISARGIEGLKAVDDELAARVLRDMLPMHGRMIHNLAGKQEPQEYGLFG
FT                   ESVNSIDRGVLNNALLDEVSAQEHIQAQFGHKLVKANFNHGATQQLLFAVEGKTVQLEF
FT                   DFVVGCDGAYSTTRQQMQRFDRMDFSQEYMDCFYLELYIPPTPEFSERFGGPFAISPQH
FT                   LHIWPRHNFMLIALPNKDGSFTSTFFGPWSLLDRLDTREQLAAFLTTNFADAMELIGLD
FT                   NAIRAFQENTKGALMCVECRPYHLPGGKAILLGDAAHAMVPFYGQGMNCGFEDVRVLMG
FT                   LLDDYAGDRTAAFAKYTASRHRDLVSIIQLAKNNYRDMSHNVVSSWHRAKRSLNNVLGR
FT                   TFRGTWLPLYTMVSFRADIPYHKAVEVDRRQAAILSLVQSALLSLAALGGFKGLLLLYR
FT                   WIKQVRRV"
FT   CDS_pept        191193..193457
FT                   /codon_start=1
FT                   /gene_family="HOG000246707" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927771"
FT                   /locus_tag="AGL275W"
FT                   /orf_name="AGOS_AGL275W"
FT                   /product="Condensin complex subunit 2 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome condensation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54216.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0030261"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG060118"
FT                   /db_xref="HOGENOM:HBG396937"
FT                   /db_xref="InterPro:IPR022816"
FT                   /db_xref="UniParc:UPI000025334F"
FT                   /db_xref="UniProtKB/TrEMBL:Q751I1"
FT                   /transl_table=1
FT                   /translation="MAPQSRYDDDDQGIFMNKSTMLANFEEWIKMATDNKINSRNSWNF
FT                   ALIDYFHDLNVLKDAEDNINFQKASATLDGCVKIYSSRVDSVANETGKLLSGLAERRNK
FT                   EAAEGADGGADGGEREDEVEIDPESGMPIARDLLDVGKRRRNYNRVLETTLVEFSTIRA
FT                   KELDQELHIDPLFKKTLAAFDEGGAKSLLLNTLNADNDLRVVFDATSADAEGGRSAASA
FT                   GMATAEAGGETETPSCTEDEESEASDRLEPSLRADDEEMLDAETSICPSDAPLAAELSV
FT                   ISETDSVSSIVVEDEILALGIQFLNFDLINAAELCPSMSQLKAAVQDGDHAKIFMDANH
FT                   KFDNFLTEEDMQEAIPASGDCADGDDFGYVLPGQDDEESYNASNDDMQHGDSLGPDESP
FT                   SNMVASVMDQDLLAYFDDVFTKSWRGREHWKVHNYKNKLLKHKEKLSLDPKQRADSAAS
FT                   SNDDKEPRKKARKDNTVDFFDLESSAEETIFAASKTSIELPEKHREDPSHYLLPDDYHF
FT                   SAAKVTKLFIKPKQHMSFFAQRKRPSVAAAPRLPPVGPIEPSAPPQLADENFWADRYKE
FT                   QELQDSQLQDASPDTGTAADPTVSDDECVDFNQAFDADGLDDDDHDAVALTPLAKPDAK
FT                   VPYSRTAKKVDVRRLKNNLWKALSARLAAEKSAAAEESAAAEESAAEESAAPAPRPLCI
FT                   KFTDIAADIAAMYSDKTRKDLSTSFCFICLLHLANEHGFSISHCDRYDDLNILFDLDAA
FT                   A"
FT   CDS_pept        193740..195938
FT                   /codon_start=1
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622199"
FT                   /locus_tag="AGL274W"
FT                   /orf_name="AGOS_AGL274W"
FT                   /product="AGL274Wp"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54217.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="UniParc:UPI0000253350"
FT                   /db_xref="UniProtKB/TrEMBL:Q751I0"
FT                   /transl_table=1
FT                   /translation="MGLPSVLVSESGTLSARFAAKMISSQLGILGPALRRSGVQLRHNH
FT                   MSRLASMRRGMHITGAARNKQEEGASAEQGQGASGISHAMLAAKEQEANRDLLDAGAQA
FT                   ALYRLLLAANYPQYVVSRFETPGIASSAECVSLYSEALQKVGRQADADAVRRSVGAPAG
FT                   AEAAAAVSPAGASAGSGYGGPVFPGAGMYGAGQGTRKEPLHVVVTESTFTVISRWIKWL
FT                   LVFGLVTYGVSEGFRYITENTTLLKSAETADKSVDVAKTNVKFEDVRGCDEARAELEEI
FT                   VDFLKDPAKYESLGGNLPKGVLLTGPPGTGKTLLARATAGEAGVDFFFMSGSEFDEVYV
FT                   GVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKDQAYAKQTLNQLLVELDGFSQT
FT                   SGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDVRGRADILQHHMRKVTLAPDVDPS
FT                   IIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMTHFEWAKDKILMGAERKTMVLTEA
FT                   SRRATAYHEAGHAIMALYTPGAVPLYKATILPRGRALGITFQLPEMDKVDVTKKECLAR
FT                   LDVCMGGKIAEELIYGKDNTTSGCGSDLQNATSTARAMVTQYGMSEQVGPVNLADKWES
FT                   WSGKIRDIADNEVVEILKASEERARNILREKQKELNRLAQGLMEYETLDSVEIQKVCKG
FT                   EPISKAKMSTNKIVEGPDSDDRKEIGGDKSKIPVLINA"
FT   CDS_pept        complement(196274..197473)
FT                   /codon_start=1
FT                   /gene_family="HOG000247914" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749061"
FT                   /locus_tag="AGL273C"
FT                   /orf_name="AGOS_AGL273C"
FT                   /product="AGL273Cp"
FT                   /biological_process="cell cycle"
FT                   /protein_id="AAS54218.1"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG395456"
FT                   /db_xref="HOGENOM:HBG435957"
FT                   /db_xref="InterPro:IPR005258"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="InterPro:IPR015432"
FT                   /db_xref="UniParc:UPI0000253351"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H9"
FT                   /transl_table=1
FT                   /translation="MDHASTPTSKLGTPRQDSTKPPGSIPSKQISDDDLYRASTQYRLW
FT                   SFRPEQLRQIREELNLRVAKVVEQRVDQYKASHPELLEEERTALEQMAVPLTADEELKL
FT                   VNFYAKKVRHFGNSLELPTEVTATAISFFRKFFLTNSVMELHPKNILWTTIFLACKSEN
FT                   YFLGIDSFSKATTRKELILKYEYTLLESLKFTLMNHHPYKALHGFFLDIQSVLKGKVDL
FT                   DYMGLIYTSAKKKITDALLTDAVYMYTPPQITLAVLAIEDEALITRYLELKFPEQANAE
FT                   QEQTQTDSTNAPDPSPTKNVQDKGETSGTQKKPVPENAKQETDKEAMQFSLERLKKLIE
FT                   DCQTIISRKEPVTRDEVTKIDEKLHYCLNPALVLQRLKKKQSSVSVSPPEAKRQKLNET
FT                   "
FT   CDS_pept        complement(197944..199587)
FT                   /codon_start=1
FT                   /gene_family="HOG000130111" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079001"
FT                   /locus_tag="AGL272C"
FT                   /orf_name="AGOS_AGL272C"
FT                   /product="AGL272Cp"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="AAS54219.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG389886"
FT                   /db_xref="HOGENOM:HBG565875"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR017458"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI0000253352"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H8"
FT                   /transl_table=1
FT                   /translation="MLSRTVIRSARSLAAVQLGRTVARVARPAVMIAGRRFASAKAQPT
FT                   EVSSILEERIRGVSEEANLNETGRVLSVGDGIARVFGLNNVQAEELVEFSSGVKGMALN
FT                   LEPGQVGIVLFGSDRLVKEGEVVKRTGKIVDVPVGPEMLGRVVDALGNPIDGKGAIKAS
FT                   GTSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTI
FT                   LNQKRWNSSNDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSVIVAATASEAAPL
FT                   QYIAPFTAAAIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYL
FT                   HSRLLERAAKMSEKNGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKG
FT                   IRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLA
FT                   RGERLTQLLTQSQYSPLAAEEQVPLIYAGVNGYLDNIELSRIGEFEKEFLAYLKASHEE
FT                   IVSAIREKGELSKDLLAKLKSATESFVATF"
FT   CDS_pept        199995..203537
FT                   /codon_start=1
FT                   /gene_family="HOG000246546" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927772"
FT                   /locus_tag="AGL271W"
FT                   /orf_name="AGOS_AGL271W"
FT                   /product="AGL271Wp"
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS54220.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG059737"
FT                   /db_xref="HOGENOM:HBG395886"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI0000253353"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H7"
FT                   /transl_table=1
FT                   /translation="MADTASLPPQRDSALGMHGPHGGLYMPVAQGPLQAHASPRLVSVR
FT                   MVLSSITALALVAVVTVLGTAQPARPTAPLAAADEQFWVAQHRSASKQLYQLVHGSELS
FT                   FYDEGRDVLGTTELSRNMYSRQPYVANGYIGSRVPNVGFGYAADEENIWTDASVPGALN
FT                   NGWPLRNPRYAGSFVSDFYSLQARLNSTNFPELDEEGYSTVIASIPEWTDLRVRADGAE
FT                   LGAETVALEDMGGYVQNMSLADGVVTTEYVWRGLSVRATVAAHRSEYPLGLVQLEVALC
FT                   GDTEPREVEVRDVLNFTTSHRTVLREAGHDEDGIYMRVEPENVPYSEAALYSVFEVRGG
FT                   EGSVQPERAAAGATVAQWVRVRLTAAQPRVVVRKYVGVVSSEYNTAGGSNLEAARAAAL
FT                   AHYGAFDGALVSHRAAWSALYGNASIEIPSDFLLELAAKSSMFHMLANTRAHNVSATRG
FT                   LPVPVTGLSSDSYGGMVFWDSDVWMLPGLLPFFPDIAREISNYRNATHAQAVANARHYN
FT                   YSGALYPWTSGRYANCTSTGPCVDYEYHINIDIAMSSLSIYMNGADGIGEDYLRYTTWP
FT                   LLRDAALFFTEYVRYNETLDAYTTHNLTDPDEFANFIDNGAFTNAGIKILLRWAIDVGT
FT                   HLEEPVDTKWQEISDKIHIPTSETNITLEYTGMNATVDIKQADVLLMVYPLGYITDESI
FT                   LNNAIQNLYYYSERQSASGPAMTYPVFAAAAATLLNHGSSSQSYLYKAVVPYLRAPFFQ
FT                   FSEQSDDNFLTNGLTQPAFPFLTANGGYLQSLLFGLTGLRYSYTVNPETKKMERLLKFS
FT                   PVRMPLLPGGIRINNFKYLGQVLDISIDDHNATIAHKQGNTPIHIKVPDRSILRDRDVP
FT                   VYKGSALQARDVIPYHELSNSNYFTVNPGETLTLPVYEPELNIQGNIVEGRQITNLTQG
FT                   VPGDVPISILDGNNYTHWQPFDKSERALLLIDLGSEEEYEITTGKILWGARPAKNFSIS
FT                   ILPNSKHITEILTKLTAMMDGRNTDLVSCSKCHAVSSSQHLLGGLANVTDSKGLAAIDG
FT                   ETVDMGIREIFRWNLFDLPTISSIIPEAANISESFVTVLENYQVTPSEPYYEEVVRKSQ
FT                   IVILPSNETDFCIDYAAVPKLNPTYTAVNLSADDTNWRKTRFVIVAVEGSYDDDDDQKG
FT                   GTIKEIALMVAPKN"
FT   CDS_pept        204088..205182
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927773"
FT                   /locus_tag="AGL270W"
FT                   /orf_name="AGOS_AGL270W"
FT                   /product="AGL270Wp"
FT                   /protein_id="AAS54221.1"
FT                   /db_xref="HOGENOM:HBG059738"
FT                   /db_xref="UniParc:UPI0000253354"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H6"
FT                   /transl_table=1
FT                   /translation="MSTSPRASAIQEVPVVILRTQAGQEKAAQDPAAPALDKHTREAAT
FT                   RLRNFSFPNTGDGTAAAQMPRTAPGGGRQSFSGKHSRVNSLIEKSINMEESQSEALFNH
FT                   LKAYTIGDAGEQDNSYSRLKTTFWLHSRKSSDESPRMSVLSTQHRNSLFSTGNTEEQSS
FT                   TGSVSSSSSFRRTNHRRSREYIPLQQLERLSIVDVRPVVGKDDPSARRGSSALANAIAR
FT                   DTSEQIRRNSTGVFASLRDFAAKTGAPTKGRVFAHCPETGDASTPVIDLEPASDTTTPP
FT                   RTSSPTAVPDSAQSPEPLAYSHVQESPKVPLLAAPAHSSSLRKSLSRSSGEDETLVVGD
FT                   ECYGVPELHKTRSTTSFRSFLDKY"
FT   CDS_pept        205353..208007
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622200"
FT                   /locus_tag="AGL269W"
FT                   /orf_name="AGOS_AGL269W"
FT                   /product="AGL269Wp"
FT                   /protein_id="AAS54222.1"
FT                   /db_xref="HOGENOM:HBG059739"
FT                   /db_xref="InterPro:IPR005635"
FT                   /db_xref="UniParc:UPI0000253355"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H5"
FT                   /transl_table=1
FT                   /translation="MHWLPTSVRPRGCHWRGLHHAQEAAAPPRVSTLANAAGLVGRFFV
FT                   CSAMPKYKCEKRMVIKLSPMESKTTTSAGTEVECMDWAIKAVKKRMNSRPGDSRSVIES
FT                   LNRFNDAIIEGHDEVNGLLHETNDWLNAEMRRAGFHEGRLEPLQRGGTAEEAEEAVLAT
FT                   VREAAPLAAETRPESAVERGETSGLGPSAEGGGGGPGEKAGEGEAAAGEADAWEAGTVE
FT                   LLAATPKPSGPVLAKGELVSSPWSPYKVAKTLKESTNAAAPEAERTQEREQTTVQEVDS
FT                   EKSINETKVSMSKSPENTFTFRTAAVIPPSRDRTLRRSNMFVPLPNKDPLVVQPMMTKT
FT                   SLLKQSPVLAKAAVLAPAASAASTGEKLPAALERPSFQSQISKGRSASIFERLSSVPTK
FT                   SFEKKIALRSPQYISRSPIRAPFHSRPPSPERLKAHNSGSPLRRGSTTEPSDRSDDHIQ
FT                   ATLKSIFDTQVPELSNDQPAGRSSLAAKRKTSHASSIHLQRRSLIPRIDRAAIISSNNP
FT                   SLDKRGRSMTPIKKAEVSLKAKKMNLNPSPHRVMKPRNQKALGTSQNASQQTPPKSEFR
FT                   QQLHRTSVAHGSISETQMTPSAKTTKSTAKTPLTRTPGLFSAKLAPVKKTPVKMGTSVT
FT                   SLVDDQLQQTALESPAGIRPTIHFVKPSESSPQNKDPSIHFKGARDRLTKFQLLPQAGS
FT                   EKQDLKKKLDKRLSEVMRNQQEQQLLRRRQEQQKRKSQLEDGKKHRPRIFSEISDNTSA
FT                   ARQKTPANPYLSKLPNQSVLYDLHTADHRANAEPVPGLHLINGNYGGDTTLPDIGSDSE
FT                   NESGSHKVLAAWAQSPFLEEQLLRQGSWDVEQIFGPIPPLHIDEIFHSSRLSKLKSRQS
FT                   LPRVSVGNNMELR"
FT   CDS_pept        complement(208130..209269)
FT                   /codon_start=1
FT                   /gene_family="HOG000216688" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749062"
FT                   /locus_tag="AGL268C"
FT                   /orf_name="AGOS_AGL268C"
FT                   /product="AGL268Cp"
FT                   /function="binding"
FT                   /protein_id="AAS54223.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059740"
FT                   /db_xref="HOGENOM:HBG395515"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000253356"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H4"
FT                   /transl_table=1
FT                   /translation="MSSYKKPQRYKAGPGDPVLPPQLSEFQGKTTDEVLGELNRMPFFM
FT                   TKLEPGDAASGENVELEALKALAYDGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGI
FT                   EVKCDDAGISELLLLNRAACELELKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQLD
FT                   KLEEAAEAVDFGLRVDTENEALLSLLSAISKKQKARHEHEQKLESRRKEMERLASILEA
FT                   AMAIRNIHMIASKQRPDLLEAAKIKLDNPEDIESQLIFPAMIMYPTTGEFDFIASVSEL
FT                   STPSELLELVLQRPREWFEQPGHEAFSTTSLVAYMETESGGLIKVGKKAKFHDVLKMET
FT                   PVVPLFDDALRVYFVPKVESEAWLKKWDKVKALENRKTC"
FT   CDS_pept        complement(209407..210690)
FT                   /codon_start=1
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749063"
FT                   /locus_tag="AGL267C"
FT                   /orf_name="AGOS_AGL267C"
FT                   /product="AGL267Cp"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54224.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI0000253357"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H3"
FT                   /transl_table=1
FT                   /translation="MAVLLSKKVIRVALLSSVVLLFLGLLSGHQDVQEYMPDSVRDMHS
FT                   SVKGSLTGVWGGRTEAVVEETKSDAGVAHADSGAERSKAPAKAKEPAEEWMRKPAPVQA
FT                   DGKVRASFVSLVRNSQLEGIIPAIKLVEQRFNHKYHYPWLFLNDEPFNEEFKTEIRKVV
FT                   SSEARFETIPKEHWSFPEWIDQDKAAETREKMKGIIYGDSVSYRHMCRFESGFFWRHPA
FT                   LEDYDWYWRVEPDTKLFCDIDYDVFRWMQDNDKVYGFTISIHEFQATIPTLWETTTNFI
FT                   KKHPEYVAKDNMQGFISDDNGKTYNLCHFWSNFEIASLNFWRSKPYREYFDYLDQAGGF
FT                   FYERWGDAPVHSIAASLFLPKDKIHFFNDIAYYHGPFTHCPIEKDVFQKGNCDCNPDDD
FT                   FTFQGYACGHKYYEVNSMKKPPGYERFQ"
FT   CDS_pept        complement(211090..212013)
FT                   /codon_start=1
FT                   /gene_family="HOG000171289" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622201"
FT                   /locus_tag="AGOS_AGL266C"
FT                   /product="AGL266Cp"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54225.2"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059741"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR012269"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="UniParc:UPI0001DB2B11"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H2"
FT                   /transl_table=1
FT                   /translation="MSELPQDVEPQVLHTQYVAPREAQTQYVAQEAHPHVQDSYYTNSV
FT                   TTKTHSTRTHDTHDELDGSEDFGRNLLTAALGEFFGTIFFLWPAFVIAQIANHDETTAG
FT                   PGSHPGQLIMISLGFGLSVMVAVFIFYRVCGGNLNPAVTLTLILAGAVPLVRGLVMMVA
FT                   QVLGGMVAAGLVKAMTPGPVLFSNALGGGCSRSRGVFLEAFGTAILCTTVLFLAVEKHR
FT                   ATYMAPFGIGMALLVAHLVCVFYTGAGLNPARSFGPAIAHLSFPNYHWIYWIGPFLGSL
FT                   IAWGVWKLFKVLHYETCNPGQDSDRE"
FT   CDS_pept        join(212408..212596,212598..213176)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /ribosomal_slippage
FT                   /gene_id="IGI19774760"
FT                   /gene_name="OAZ1"
FT                   /locus_tag="AGL265W"
FT                   /product="Ornithine decarboxylase antizyme "
FT                   /function="ornithine decarboxylase inhibitor activity "
FT                   /protein_id="AAS54226.2"
FT                   /db_xref="GO:0008073"
FT                   /db_xref="HOGENOM:HBG059742"
FT                   /db_xref="InterPro:IPR002993"
FT                   /db_xref="UniParc:UPI0001DB2B12"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751H1"
FT                   /transl_table=1
FT                   /translation="MMEQLRKKEQHIAKVVGECSTQGAVSVSFSTVQLAKGTCLEKLRP
FT                   WMLRYRCSSRTGYAEWLADRAGAQSVRMAELLELYWDLIAVVEARFAVVPSEVEEERFY
FT                   RRFQAHVVRRVGRRITCTARGRACAEDKYPDFQQIGDMYGAVGDEQGVHLYKWVQSSRR
FT                   LLVLMDERAAGRVDLKRWLVMMMELVDGARMLRGCQALQVYVSREDLVNVKDLLKNLNW
FT                   IGGELVQNVGDRWSDDEAMVWSDERYVVIRFDC"
FT   CDS_pept        214287..215660
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927774"
FT                   /locus_tag="AGL264W"
FT                   /orf_name="AGOS_AGL264W"
FT                   /product="AGL264Wp"
FT                   /protein_id="AAS54227.1"
FT                   /db_xref="HOGENOM:HBG059743"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniParc:UPI000025335A"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H0"
FT                   /transl_table=1
FT                   /translation="MPIFAAKKRQATLKKKLVLQQGDELKKESLNIPSWAPFKLIDHGQ
FT                   AANDQVLIPQKPEVPGDALKDHWTPKTVRIYPTSKQKEILHLWLTATRHMYNLAVAERI
FT                   RLGKEAKENGTKVKMKLKHLREVMPLKKNFDYERDPKLTYLKNVPFLIKDNGLRDFDKD
FT                   YRTNLAKSKNTLRPFKIHFKKIKDKQSMTVEKKVWGLSRGIYHDVFRKGAFRSTEPLPE
FT                   QLPHDSRLIREHGKWFLVIPYETSGLMPKKEAINAVAVDPGVRTFLTTYDSSQRVLEIG
FT                   EDGYLKLQHLDRRLRSLQSEIHKLRSKGIVLSKEDRKRKIRNRRTVISRLYQRKKNLAN
FT                   DVHRKASHLLASKYNYILIPVLNFHNFKKTNRRVKANLANMKHCLFVQRLKNKASHFEN
FT                   TTVIEVDEEFTTKTCSLCGVRSNIGASKVFKCDNCDATFDRDHNAAKNILLKYLGEID"
FT   CDS_pept        216980..217357
FT                   /codon_start=1
FT                   /gene_family="HOG000065927" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622202"
FT                   /gene_name="CWC21"
FT                   /locus_tag="AGL263W"
FT                   /product="Pre-mRNA-splicing factor CWC21 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS54228.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG059744"
FT                   /db_xref="HOGENOM:HBG203319"
FT                   /db_xref="InterPro:IPR013170"
FT                   /db_xref="UniParc:UPI000025335B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751G9"
FT                   /transl_table=1
FT                   /translation="MSYNGIGLKTAKGSSTSGHIQRSLADNQAGNVKNFSSRKEESQGR
FT                   VARASRERKLDGSMAAHADRREIEVRVSELRDELEDADIDAEEIERRCEQLRRQLQSEA
FT                   AERARVAQAYTPRNARSAGAT"
FT   CDS_pept        complement(217491..218468)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079002"
FT                   /locus_tag="AGL262C"
FT                   /orf_name="AGOS_AGL262C"
FT                   /product="AGL262Cp"
FT                   /protein_id="AAS54229.1"
FT                   /db_xref="HOGENOM:HBG059745"
FT                   /db_xref="UniParc:UPI000025335C"
FT                   /db_xref="UniProtKB/TrEMBL:Q751G8"
FT                   /transl_table=1
FT                   /translation="MSSFSSSDKYIRKGIFPVQQQAGASSARTLCQSSCSHHSAANVAA
FT                   PCLTTSAAVEYMSVVAVPAATPAAVPRIHAKSHQRAASTPDGMYVQYRRISISELLNSE
FT                   ASGGRTRNKEAAAHPTAILTTGLSTPVTTLSSPSSLAPTGTPNFYVPPRTATPSPNSIM
FT                   KRPQGRPITQKLIGKFTIYDCKEDLILDLIRTECLQLLQGPSVPIVKRPNMSCLQKVVD
FT                   LKEPSIYDQLKVQFQTGDTLQFIKLIRDHKGKLLRLETVPCNESQINIDFIKRNVCYPR
FT                   YKSNMKFYLIRSDSLQKKFIYYHDRITFERERHLIDSNIEVWVR"
FT   CDS_pept        220470..221066
FT                   /codon_start=1
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622203"
FT                   /locus_tag="AGL261W"
FT                   /orf_name="AGOS_AGL261W"
FT                   /product="AGL261Wp"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54230.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI000025335D"
FT                   /db_xref="UniProtKB/TrEMBL:Q751G7"
FT                   /transl_table=1
FT                   /translation="MFHLAQGLYRNWNKKEHYSVLILGLDNAGKTTFLEQLKAVYHLYA
FT                   KPLEKIVPTVGQNVATVPLDKTTLLKFWDVGGQEALRAMWSEYYVQTHGIIFIIDSTDR
FT                   ERLQECCDSLRSIVTDDGVEGVPILMLANKQDREDKMELHDIKQVFNKLALHLEARDSR
FT                   VLPISALTGEGIQSAAEWLLVRLKRNKQTRPPIYK"
FT   CDS_pept        221933..223474
FT                   /codon_start=1
FT                   /gene_family="HOG000099116" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927775"
FT                   /locus_tag="AGL260W"
FT                   /orf_name="AGOS_AGL260W"
FT                   /product="AGL260Wp"
FT                   /function="phosphatase activity"
FT                   /protein_id="AAS54231.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG237270"
FT                   /db_xref="HOGENOM:HBG617166"
FT                   /db_xref="HSSP:1AJC"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniParc:UPI000025335E"
FT                   /db_xref="UniProtKB/TrEMBL:Q751G6"
FT                   /transl_table=1
FT                   /translation="MATDEHTGLLPRVGGRSSKQRAVWGSLVALLVLATVVLRFDIVPR
FT                   RAVAGGKRNVIFFVTDGMGPASLAMTRAYAQAQETDTQLRLPTFQMGSMQTRSSSSLIT
FT                   DSAAGATAFSCAMRTYNSAVGVGPDGRPCGTILEAAKLQGYMTGLVVTTRLTDATPAAF
FT                   SSHVDHRWYEDLIAEHQLGTYPLGRVVDLMIGGGRTHFYGSQDTKYGDGGSRKDGRNLI
FT                   DKAVEDGWQYVGDMEGFKRLQGGHNASLPLLALLADYDIPFDMDRDDAVHPSLEQEMMT
FT                   AINALTDATKDSDRGFFLLVEGSRIDHAAHQNDPAAQAKEVLAFDRAFMSAVEFAAKSD
FT                   VETVLISTSDHETGGLTVGRQVGTAYPDYVWYPDVLRNATHSAEYLAHKLVNVPANERE
FT                   DYIREKVLEKGLGIDYYSEEDLQELVVSRTTDQILDKLTRMVSLRAEIGWSTHGHTGVD
FT                   VNVYAFANTGPSWKSVQDALYGNHANVDIGSFLALYLDLDLEKVTDLIKDTKHSP"
FT   CDS_pept        complement(223704..224873)
FT                   /codon_start=1
FT                   /gene_family="HOG000167461" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749064"
FT                   /locus_tag="AGOS_AGL259C"
FT                   /product="AGL259Cp"
FT                   /protein_id="AAS54232.2"
FT                   /db_xref="HOGENOM:HBG435756"
FT                   /db_xref="InterPro:IPR005109"
FT                   /db_xref="UniParc:UPI0001DB2B13"
FT                   /db_xref="UniProtKB/TrEMBL:Q751G5"
FT                   /transl_table=1
FT                   /translation="MYLSLFLARLKRTPLAVVFPILSLIMVYFLFFPRHGSMLGTDGSV
FT                   TNHKWAHELEKTYYFTHSSKYKKPKYTYNSKYNRLYSDKADEKVPDDRLREYDLNTLQS
FT                   TAMAAANGEQVLILTPMQIFHQQYWDNLLLLTYPRKYIHLGFLLPRTSSGNTALRKLEK
FT                   AVRKVQTGPKDQRFGKITILRQDSPSFNKLSQSARHRFHVQKERRSAMALARNELLFST
FT                   IGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQRYVENGEPAIRAYDLNNWA
FT                   ESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCTLV
FT                   KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYHNDK"
FT   CDS_pept        complement(225123..225806)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749065"
FT                   /locus_tag="AGL258C"
FT                   /orf_name="AGOS_AGL258C"
FT                   /product="AGL258Cp"
FT                   /protein_id="AAS54233.1"
FT                   /db_xref="HOGENOM:HBG059746"
FT                   /db_xref="UniParc:UPI0000253360"
FT                   /db_xref="UniProtKB/TrEMBL:Q751G4"
FT                   /transl_table=1
FT                   /translation="MTSSPTSAEAAASESKLQRLGIECISPGLSSENMDNKMLSTIRRS
FT                   KTIAREQRQHIEKLGEAQHTLARPRGKSLRRTRVPSPLNIGAGGGGPAGVASAPANITH
FT                   FRQAARPRVQYVGRRRRPGASPLVPCYDPYVAYAQPPYMVVPVPPVYPRMALRPARDER
FT                   ADDDDDDDADDDAAHAPGERVRGEITLLDDTFAFEFAPTRDQIDKKMFMSICDKVWDEA
FT                   KKIKS"
FT   CDS_pept        225947..226603
FT                   /codon_start=1
FT                   /gene_family="HOG000141905" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622204"
FT                   /locus_tag="AGOS_AGL257W"
FT                   /product="AGL257Wp"
FT                   /protein_id="AAS54234.2"
FT                   /db_xref="HOGENOM:HBG059747"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI0001DB2B14"
FT                   /db_xref="UniProtKB/TrEMBL:Q751G3"
FT                   /transl_table=1
FT                   /translation="MQATLYANHRIRTLVPRALVRHLGLDVALRDPDADPRWARLFPLK
FT                   KVPCFVGPRGERLTEVIAIMVYLVGQAPDPAVRAALLGHDTFHRARVLAFLELANSPLC
FT                   DNMAVLLHQVRGLAPPCDATWRAAAAALAGLTALYEARLERHPYLATDTLSLADLFTAA
FT                   IMRRCFEAFYGADWRAAHPAITRWFEEVTGSPILREHFADYVPAEVTPSGPPEAR"
FT   CDS_pept        226711..228234
FT                   /codon_start=1
FT                   /gene_family="HOG000087852" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622205"
FT                   /locus_tag="AGL256W"
FT                   /orf_name="AGOS_AGL256W"
FT                   /product="AGL256Wp"
FT                   /function="catalase activity"
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="AAS54235.1"
FT                   /db_xref="GO:0004096"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052085"
FT                   /db_xref="HOGENOM:HBG339355"
FT                   /db_xref="HSSP:1A4E"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="UniParc:UPI0000253362"
FT                   /db_xref="UniProtKB/TrEMBL:Q751G2"
FT                   /transl_table=1
FT                   /translation="MAGNNDKTNSAEVREDRVVTNSVGNPINEPFATQRVGQHGPLLLQ
FT                   DYNLLDLLAHFNRERVPERNPHAHGSGAFGYFEVTDDITDVCGSAMFGEVGKRTRALVR
FT                   FSTVGGEKGSADTVRDPRGFAVKFYTEEGNLDWVYNNTPVFFIRDPSKFPHFIHTQKRN
FT                   PRTNLKDANMFWDFLTTPENQVAIHQVMILFSDRGIPASYRHMNGYSGHTYKWSNKQGD
FT                   WRYVQVHIKTDQGIKNLTAEEGAKLAGEDPDFCQQDLVQALERGEYPSWTVYIQTMTEE
FT                   QAQKLPFSVFDLTKVWPHKDFPLRRVGRLVLNEVPTNFFAQIEQAAFSPATTVPYQEPS
FT                   ADPVLQARLFSYADAHRYRIGPNYHQVPVNCPYASKFFNPAIRDGPMNVDGNLGSEPNY
FT                   LATNNNYRFLGADRPIQQHQETWQGPAQPVHWATTGDIDFAQATALYHVLGRTPGQQRN
FT                   LAHNVAIHVASADPPIQERVFQMFSRVDKGLGEAIRSEATALSQKKPKL"
FT   CDS_pept        228399..228716
FT                   /codon_start=1
FT                   /gene_family="HOG000154306" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079003"
FT                   /gene_name="SGF11"
FT                   /locus_tag="AGL255W"
FT                   /product="SAGA-associated factor 11 "
FT                   /function="metal ion binding"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54236.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG059748"
FT                   /db_xref="HOGENOM:HBG203920"
FT                   /db_xref="InterPro:IPR013246"
FT                   /db_xref="UniParc:UPI0000253363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751G1"
FT                   /transl_table=1
FT                   /translation="MTLGRDAMTPLTILSVSETIYHNLLTSMVQDIVSRTTSRQQLQDA
FT                   RYPGLAPLHHDQRGALDVYGRPKPQEASVYFRCPNCSRDLSANRFAAHLERCMSRGARR
FT                   G"
FT   CDS_pept        228794..230089
FT                   /codon_start=1
FT                   /gene_family="HOG000001048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774761"
FT                   /locus_tag="AGL254W"
FT                   /orf_name="AGOS_AGL254W"
FT                   /product="AGL254Wp"
FT                   /protein_id="AAS54237.1"
FT                   /db_xref="HOGENOM:HBG059749"
FT                   /db_xref="HOGENOM:HBG203227"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0000253364"
FT                   /db_xref="UniProtKB/TrEMBL:Q751G0"
FT                   /transl_table=1
FT                   /translation="MGKGMLTTTTHGPSRAGWQCANGAMSQLLRNLETEFGRLRTGNGE
FT                   ADHGLKKCADETHEFRVQLKKLKAHLAKQAQERQAGEVVDEAGFERKRELIVEKLRRTH
FT                   TSWSGAVRRTCRGAVAAQGRFEKHAVQRLFEFELDKVYTHRLPAHAREQVARAIGKHLS
FT                   RYNISNIPVREHDDILRYMRAIYGVDEEVTEDYVEMSQIIQDMRKGDISGCMAWCEPGS
FT                   NLQFELYLLKAKQLLLEGDRLLTYNYVMNNIPGLMLQTRKYGIRRDIGTLLANIAVGDA
FT                   AKFESLESEIRVQLDKCVALFTRDYCRKNNLLYNSSLFLILLSGIISFQFFIKYQTIRA
FT                   ASHVDWTTEDELPFSVKLPDFLSDFHPIFICPVLKEETTRENPPYSLPCHHIISKKSLD
FT                   KLSTNGTCNFKCPYCPIMASKSKTHKVNFAKL"
FT   CDS_pept        complement(230112..230414)
FT                   /codon_start=1
FT                   /gene_family="HOG000216525" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749066"
FT                   /gene_name="ELC1"
FT                   /locus_tag="AGL253C"
FT                   /product="Elongin-C"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54238.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG317170"
FT                   /db_xref="HOGENOM:HBG360223"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="UniParc:UPI0000253365"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751F9"
FT                   /transl_table=1
FT                   /translation="MTPTSHVTLVSSDGKSFEVPRERAMLSPTLAKMLDSSFAEAKEAK
FT                   VTLPTIESSMLAKVVEYLEYLEEYKHKDDGEDIPQFEVPPEISLELLLAADYLQI"
FT   CDS_pept        230549..232936
FT                   /codon_start=1
FT                   /gene_family="HOG000141904" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749067"
FT                   /locus_tag="AGL252W"
FT                   /orf_name="AGOS_AGL252W"
FT                   /product="AGL252Wp"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54239.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="HOGENOM:HBG145239"
FT                   /db_xref="HOGENOM:HBG203921"
FT                   /db_xref="InterPro:IPR006925"
FT                   /db_xref="InterPro:IPR006926"
FT                   /db_xref="InterPro:IPR016534"
FT                   /db_xref="UniParc:UPI0000253366"
FT                   /db_xref="UniProtKB/TrEMBL:Q751F8"
FT                   /transl_table=1
FT                   /translation="MNPSLGWEKLSDVYYRNRPLCTWDWSHASDLNYSFSLTFCALHHD
FT                   QKIHCYNYVGELQWSIDCSGLPSEIVNFEFAKNETFILVLEDRIRRYTGWYPLQWEDTM
FT                   LPDSVSDLIWDYKSGVALLQSSQDIYYYHDSRLELIYQNDDRFTLSTKHHWHTNGGLVV
FT                   LLDTRVVLHLDIPTRKLSHAVAGSWQEVRISPKGFVCLYSMRENSIAIYKDPSRFLLEH
FT                   SLDVIPDALEWCGSDTIAYCNYKNEEVKLIGPNGSYVAFWFPNPIIALRTEVDGVKVLT
FT                   SASINFISKVENYTARIFSIGSTESSAILLDSLELLSNHAPRAIENLKVINLEQAVLEC
FT                   TQAARDEFAPYWQKRLLSAASFGKDSLSNAEFNSQAFVQTCDLLRVLNMLSQMGLPLTA
FT                   KQFDDITIDGVLEILMRLHKFHKCIQICSFLNYEKKLGNVFKEWAVAKIKLSPDVDDSA
FT                   LYQSIITQMTNQGLVPGTSLIQIARAAFLEGRFHLAKKLAVESPLPRSKLQLLLDMDEN
FT                   ELALSEAVKLLDPELTLTLLLLLRSRLTNAQFTKVLVLVLKDNTLLQFYERNNMVFLYD
FT                   FYRQTDRYQELAMLIFNDGKKRNALLSFLPQVQNLYGIIDTPLAKENKELISRHISLVK
FT                   HQQNLTSLLNYDFTDLTLDATLTQLIEMGQERHTSTLVKTFKISERKYYRIKCRTLVKA
FT                   GRFDELNKFAKERKSPIGYKPFYEAVFNHGNPREAAVYVSMITGISNYEKIELYLKCGS
FT                   FYDAIQLASREKDIALLQRIKEQLPDNQPQLMVVLKESIAKL"
FT   CDS_pept        complement(232942..234138)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749068"
FT                   /locus_tag="AGOS_AGL251C"
FT                   /product="AGL251Cp"
FT                   /protein_id="AAS54240.2"
FT                   /db_xref="HOGENOM:HBG124262"
FT                   /db_xref="InterPro:IPR007902"
FT                   /db_xref="UniParc:UPI0001DB2B15"
FT                   /db_xref="UniProtKB/TrEMBL:Q751F7"
FT                   /transl_table=1
FT                   /translation="MFIDDNLIHPSGTSEAALKLNKLEGPEVKKLVRSWLVKFPPANGT
FT                   IELGNIDCDAKKLIDIATGHLWPGGLNCYQIAQLDVACLVADKTQMSWAVSAVHDKDGE
FT                   EAVLALDFKRFGADLRTQVGHVHMCHVYSEMHAKLPLVLYRVQLFDSYGSQMVTHKAFF
FT                   AVLPLRYKVVLHSAQKDVHSRYIFQCVTQALQASRPGVQLQLMAGPVKDILTNVDRAYG
FT                   TSILPDVQGVWSSYLYDDIEPSPLHSPTKHPVVVGKRKREDDDKLRDIQRCAMMRFKGT
FT                   TSGVKSLVRYLDKRHRQRVYSVSDGQVDDPSTDEEEINKYQSLVPVRKVEYTVKNTTSL
FT                   GFKLKLRGKDVFAGLHELCDKQILDINRLPGWLTGENGADSGIVEDGNFKRIKRGGLI"
FT   CDS_pept        234339..236528
FT                   /codon_start=1
FT                   /gene_family="HOG000187841" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749069"
FT                   /locus_tag="AGL250W"
FT                   /orf_name="AGOS_AGL250W"
FT                   /product="AGL250Wp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS54241.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG324361"
FT                   /db_xref="HOGENOM:HBG338863"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000253368"
FT                   /db_xref="UniProtKB/TrEMBL:Q751F6"
FT                   /transl_table=1
FT                   /translation="MSKQVNDTSKNGLDLKTLFVRNIPFDATDAELTDFFSQFAPIKHA
FT                   VIVKDNAGSSRGFGFVSFAVESDTQAALDKGRKTQFKGRLLRVDVAKRRERSKKGDEAE
FT                   AQTSAEDAEKPTTAPEGDEALMRGKPKLIIRNMPWSCRDPTKLKKIFGRFGVVAEASIP
FT                   RKADGKLCGFAFVTMKKLSNCRKAIEECKGLKIDGREVAVDFAVQKSKWEDYKKTHPES
FT                   DEEEQVDEGEESEAEGDEDGSDAEGDVAEASDEESGEESESGDTSAAETDSVSRPQEAP
FT                   RNRRENFSVFVRNVPYDATQETLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAFKDES
FT                   TFDTCVANAPVVDSKSLLISDDVAPEYVYEGRILAITPTLDRETANRISEKNAVKRKEA
FT                   LGIAPSERDKRNLYLLNEGRISTNSKLAQLMSKTDLEVREKSYAQRTEQLKKNPELHLS
FT                   MRRLAVRNIPRAMGEAALKILARKAVVEFAKEVKEGKRHSLSKEEISRSTWDKYRSMTE
FT                   EEIEAQKKKDKKRGLVKQAKIIKEVKGSVVGRSKGYGFIEYRDHKAALMGLRWLNAHQV
FT                   TQEEILEGMTEEERKAADDDGQTKRRLLVEFALENANVLKTRKERVQRSRDFAPRGSEG
FT                   GDAEEHKREKRPRDFNSRGSQGGHFEDRKRVKRSREFTSRGSKGGYADDRKRDAPANKK
FT                   HKPQDNNEKANKSGLSDDVKRLIGIKRRRKHGKRS"
FT   CDS_pept        complement(236606..238351)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927776"
FT                   /gene_name="SSN3"
FT                   /gene_synonym="CDK8"
FT                   /locus_tag="AGL249C"
FT                   /product="Serine/threonine-protein kinase SSN3 "
FT                   /EC_number="2.7.11.22"
FT                   /EC_number="2.7.11.23"
FT                   /function="ATP binding"
FT                   /function="RNA polymerase II carboxy-terminal domain kinase
FT                   activity"
FT                   /function="cyclin-dependent protein kinase activity "
FT                   /function="metal ion binding"
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54242.2"
FT                   /db_xref="GO:0004693"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0008353"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1V0B"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001DB2B16"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751F5"
FT                   /transl_table=1
FT                   /translation="MGIRLQSSDSMNNQHQTQQNKYFNVSNQASTRSLWSQQQQQQLLD
FT                   TKGSASTSKSPMLMANNNVFSIGPYRQRKDAGRVSVLEKYEIIGYIAAGTYGKVYKAKA
FT                   KETQEEQENSIHTHNQTLGSVSVAGIDGGMASREVENGGDDPLRLDGHGGIAVAPAAGG
FT                   GLSSAAAHRARSNGAVKALPKKSAFTPFYAIKKFKTEREGVEQLHYTGISQSACREMSL
FT                   CRELDNKHLTKLVEIFLERKSIYMVSEFAEHDLLQIIHFHSHPEKRLIAPRMLKSIMWQ
FT                   ILDGVSYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLARKFYNLVQTLYTGDKVVVTI
FT                   WYRAPELLLGARHYSPAIDLWAVGCIFAELIGLRPIFKGEEAKMDSKKSVPFQGNQLQR
FT                   ILEVLGTPTHHTWPNIHKYPEYEQLSKFSKYRDNLSVWYHSSGGRDKAALSLLYSLLKY
FT                   DPITRIDAIDALEHEYFTNNDPPVSSDVFEGLSYKYPPRRIHTSDNDIMNVGANKNKSG
FT                   FNHHPPQQQTVNNNGVTNSSIGGLGVNRRILAAAAAAAAAVQVNGTNIVSGSSSSNGPI
FT                   RKKKR"
FT   CDS_pept        complement(238591..239208)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749070"
FT                   /locus_tag="AGL248C"
FT                   /orf_name="AGOS_AGL248C"
FT                   /product="AGL248Cp"
FT                   /protein_id="AAS54243.1"
FT                   /db_xref="HOGENOM:HBG059751"
FT                   /db_xref="InterPro:IPR018811"
FT                   /db_xref="UniParc:UPI000025336A"
FT                   /db_xref="UniProtKB/TrEMBL:Q751F4"
FT                   /transl_table=1
FT                   /translation="MLPHLGPQLSLVPGRGVAASFRLHLASRGGASGVRARLPAFIARA
FT                   YGSPPGDARQTRAWTYLARSRLFQRLYARPSFAAYIDRLLANGPVPTLAAFLLLHEATA
FT                   IAPLALLWWGLYSCDVVALLPQGLLDYLADAAHPAVERFVGDRAPACDRGKLLVSGALA
FT                   YGLVKLLYPVRILASLWAAPYLARGLLLPFRRLKQWWKGPSC"
FT   CDS_pept        complement(239304..242270)
FT                   /codon_start=1
FT                   /gene_family="HOG000246402" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774762"
FT                   /locus_tag="AGL247C"
FT                   /orf_name="AGOS_AGL247C"
FT                   /product="AGL247Cp"
FT                   /function="ATP binding"
FT                   /function="isoleucine-tRNA ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="isoleucyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54244.1"
FT                   /db_xref="GO:0004822"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006428"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG379584"
FT                   /db_xref="HOGENOM:HBG577712"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000025336B"
FT                   /db_xref="UniProtKB/TrEMBL:Q751F3"
FT                   /transl_table=1
FT                   /translation="MLRCIRQYSAHAYQKTVRLPRSQFSPRSDLRKTYEQILPQACDQL
FT                   YRDQYQELLQKVQELPDDTDKANFVRDRVFVLHDGPPYANGDLHVGHAMNKILKDIMSR
FT                   YQLTKGRYVFYRPGWDCHGLPIELKALRSLDYDTAAISPQQVRAMAAQHAEGAIAAQRK
FT                   QFQQFGILTDWQDTYRTMDPGYEIQQLRLLQGIFARGLIRRQRKPVYWGTETRTALAEG
FT                   ELEYRDDHISKAAYVYFPLTEGASATLRERLGTSLPEQPIVCLIWTSTPWTLLSNRAIC
FT                   FHDDHAYLLLQWKGMLVVAERTELADFKWSGDTPVVVTSFRGSDLRGLYYTNPLLGDAV
FT                   SRPLLHGDHVTADTGTGLVHTAPGHGQEDYLVGQAHGIEVYSPVDHEGRYILDDIPPHL
FT                   RDMLREESGKPLKVTDQKTAGVIIKLLEEHKMLLHSHEYTHSYPYDWRSKKPVILRATP
FT                   QWFADLSDMKHHAVESLENVEFFPARGKKRLEAFIKSRNEWCISRQRSWGVPIPALHLR
FT                   SNPDEVLLNNETLAHIIETISKVGINSWFEESNAENMKQWLPEKYHDVAHLYYRGRDTI
FT                   DVWFDSGSSWNLLEKWYTETLGLKKPLQPLADVYLEGSDQHRGWFQSSLLTKVAASGTV
FT                   GAPFGKIVTHGFTLDEAGLKMSKSLGNTIAPSSIIEGDQKLQLPRLGVDGLRLLVAQAD
FT                   FTKDVAFGPLIARHVADSLKKVRLTFRFILGNLQDCPSVASAGEQASLAPGDCAQLRRI
FT                   DWYILDKTQKLTAKCQGLYESQNYSNVISLVLYHMSNDLSLYFDASKDTLYMEPPHNKR
FT                   RLAIQTTLFHILDAYRSILGPIMPALVQEAWNCLPREWLRGDTTPALRRPWPALPALAD
FT                   RIRDCETTDLALVTAFRQALARLPHVRKPEQCRVIIYMPDSALYTVEDVMELTQAGEVI
FT                   IDGSKDRVLALPHVSKLDANNDILLAVKESPNHKCPRCWKHASPEADALCNRCARVLQ"
FT   CDS_pept        243116..243799
FT                   /codon_start=1
FT                   /gene_family="HOG000000993" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749071"
FT                   /locus_tag="AGL246W"
FT                   /orf_name="AGOS_AGL246W"
FT                   /product="AGL246Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54245.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123999"
FT                   /db_xref="HOGENOM:HBG203925"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000025336C"
FT                   /db_xref="UniProtKB/TrEMBL:Q751F2"
FT                   /transl_table=1
FT                   /translation="MSEDRLFFERAAEAIMQTSINRDKVDPTIRELLNRIKYTNPDKIG
FT                   TDGFTRQSDSATGYADTRDCGAGLPTLVGSEKSSVLNYFDKLLTAGRPPSAPGVARPER
FT                   AREASLAYLSEDELLTKKRKTSPGAALEVSGGPEETVNDGKRFHCTKCELVFRRSGDLR
FT                   RHEKVHLPILPNICSLCGKGFARKDALKRHFGTLTCKRNRQKLLSIGGDINEILEKARQ
FT                   NGAKV"
FT   CDS_pept        complement(243975..244460)
FT                   /codon_start=1
FT                   /gene_family="HOG000261245" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749072"
FT                   /gene_name="EGD1"
FT                   /locus_tag="AGL245C"
FT                   /product="Nascent polypeptide-associated complex subunit
FT                   beta"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54246.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG244178"
FT                   /db_xref="HOGENOM:HBG629031"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="UniParc:UPI000025336D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751F1"
FT                   /transl_table=1
FT                   /translation="MPIDQEKLAKLQKLSANNKVGGTRRKLAKKSGTASANKDDSKLQA
FT                   QLAKLKAVTMDQVEEANFFKDDGSVLHFNKVGVQVAPQHNTSVFYGIPQEKSLQDLFPS
FT                   IIPQLGSESIDALTQLATQLQNAQAAAPATEGHEAGEKKDNDIPELIEGQSFDADVE"
FT   tRNA            244823..244896
FT                   /gene_name="tRNA-Ile"
FT   CDS_pept        complement(245009..247537)
FT                   /codon_start=1
FT                   /gene_family="HOG000115436" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749073"
FT                   /locus_tag="AGL244C"
FT                   /orf_name="AGOS_AGL244C"
FT                   /product="AGL244Cp"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS54247.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059752"
FT                   /db_xref="HOGENOM:HBG203928"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="UniParc:UPI000025336E"
FT                   /db_xref="UniProtKB/TrEMBL:Q751F0"
FT                   /transl_table=1
FT                   /translation="MSQLKVLTVGENPNVLLYTWRLQEAKAVELWHVSGHRVGGKFGIS
FT                   TQLYGEASFSVQRHYETLDALKQAVGQGAFDMVILSAPSLQEMSSLAYQLNTLVDATTK
FT                   IFVESSGFVLLEPFVKMSVEFADLQVLSIVSDYDIRQTGETTFEQFNARERQTIYIGKS
FT                   GVKGKNTATRYSKDVASLLETFQSFFRKLFSRDAIDICNCSYVEFLSQQWRLAIPQICF
FT                   DPLLILMEELRPQQLQEHILAKPLISGFVTEIITVSRSMGAKLLYPFDSENDLFNHWVT
FT                   INNQDLPKMVYHFMQRTASLDIDMLLLQPILLADDHGIKTPYLEFLYSMMCQFQKINNG
FT                   HSRWFTRVSAASQMQINIQNVTAERDALNTELELLKQYMVEKENTMNEAQRSQEQLFLA
FT                   QVGELKSEVARLKDDLGLEKRKNTELLMDLQRSKVNKTPAANPPPMAPPPRAQSPVIPP
FT                   PKSVYEQHDSDGGTPDMADIQEFAMYGITYDDEPEKKDTPPSGANNEAQPDEANNEAHP
FT                   DGQGSPSMSAFSQRDRDPRSRDLDQQRRGYPPGVPYQGHPGMPPQMMYNGSSKPHMYPP
FT                   AAMKAARAAAMVNYRPVANNSRANSLVDPYPPPQLGQAASAYPQTFKKTDRKNRQSHMP
FT                   SLRNASSTGFDDFSVPQGVPHGMPRIHQRGYGNPAHRMTLQTPLNYQQKLNSMHGSHAQ
FT                   QKQIQRQISAASALDDGNTITAMVQHLMPKKKDQPPQQQGPYGSPPNSGNSSTYGGSPA
FT                   ATAPSASVNAPAADDGQNAVPQPHSAPALSANGNTAPMSGNSVSLSNGSSAGPGLSQQS
FT                   NSLDWKQTPPSSGGSVTERKPKLALFAKKK"
FT   CDS_pept        248087..249076
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749074"
FT                   /locus_tag="AGOS_AGL243W"
FT                   /product="AGL243Wp"
FT                   /protein_id="AAS54248.2"
FT                   /db_xref="HOGENOM:HBG059753"
FT                   /db_xref="UniParc:UPI0001DB2B17"
FT                   /db_xref="UniProtKB/TrEMBL:Q751E9"
FT                   /transl_table=1
FT                   /translation="MGYVLAGYATKRLRRYENTVVYYPPRKRAQVARAARLEDLPAELL
FT                   QYIFVLSGNAALAECSRTLWAVLRPTAGLVRVYIGAHYVHSAHTGSGRRVRVLAAEVFK
FT                   SRARLAHLAAHPEELDAVAGVMGPAALRAWQRACEAGRATAAVELDADGRPVEDYPAVF
FT                   YARPELFFGGRTAGRLPAASEFLEKLHRFFSVLQPECLAERIMQWFFYESGGRHDADHF
FT                   MHAVNLVLKLSRLPQARFASVDPLLELLHCLFIDSVPGLDRLLKASGTRLDDLKRALVG
FT                   TFIDSFYRNNVALLSEDSLWRLLIELRDDRLKQLLVDQGARPSFHILE"
FT   CDS_pept        join(complement(250103..250119),complement(249161..250049))
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079004"
FT                   /gene_name="PHO85"
FT                   /locus_tag="AGL242C"
FT                   /product="Negative regulator of the PHO system "
FT                   /EC_number="2.7.11.22"
FT                   /function="ATP binding"
FT                   /function="cyclin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS54249.2"
FT                   /db_xref="GO:0004693"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001DB2B18"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751E8"
FT                   /transl_table=1
FT                   /translation="MTSTSQFKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEG
FT                   TPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRG
FT                   LELSLVKYFQWQLLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVN
FT                   TFSSEVVTLWYRAPDVLMGSRTYCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIF
FT                   ETMGTPTEQTWVGVSQLPKYNPQIPLYPNKDIKQLLQATTKEQISDVLVNLIQGLLQLN
FT                   PSMRLSAQQALSHPLFEEYH"
FT   CDS_pept        250644..252239
FT                   /codon_start=1
FT                   /gene_family="HOG000248551" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749075"
FT                   /gene_name="TRM44"
FT                   /locus_tag="AGL241W"
FT                   /product="tRNA (uracil-O(2)-)-methyltransferase "
FT                   /EC_number="2.1.1.n2"
FT                   /function="methyltransferase activity"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54250.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG059755"
FT                   /db_xref="HOGENOM:HBG396007"
FT                   /db_xref="InterPro:IPR011671"
FT                   /db_xref="UniParc:UPI0000253371"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751E7"
FT                   /transl_table=1
FT                   /translation="MTFEFCGGESSILGGAWVCIYQTAEDVGFQREHFEQAMDNVIRHP
FT                   NINSTVLLRADIVAEREYDCRTGEAVRDGNCGAAADVAEGMLSVGLEDVAARSVHTELD
FT                   LAVKLEFVRRLVPRNPYKDALINQTCLVLNTREPSETALVVYLPHFSEREDCPFYIPPV
FT                   AAVGILLHGGRLSVHYIPFAGEGAALADEGQRAVRTARRLLQTAEKHSKGCMNGYTKRV
FT                   EHDVVVDKVLFQERYIQLKKKYSQWLVDNWAESTDPRKHVFEDIAIAAFLIELWSKIYG
FT                   QHAEDKFRFCDMGCGNGVLCYILLMEGYAGEGIDARRRKSWGMFPENVRSCLKEQLVIP
FT                   SLLLRPHPEIRKMASHMEHNGGFFPVHVSSSQLMAPATIVYSAADLITSPQVNIAEFPP
FT                   NTFLIGNHSDELTCWIPLLGQPFMVIPCCSHNFHGARVRYRPSRESATRLGNSTYAGLV
FT                   DYVEYLAKAVGWETEKEMLRIPSTRNAAIIGYKNPALGQFPTQQVYDEVLKNGGAEGWI
FT                   QSATALLKGTPKSH"
FT   CDS_pept        252458..254584
FT                   /codon_start=1
FT                   /gene_family="HOG000248220" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749076"
FT                   /locus_tag="AGL240W"
FT                   /orf_name="AGOS_AGL240W"
FT                   /product="AGL240Wp"
FT                   /function="ATP binding"
FT                   /function="helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAS54251.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG059756"
FT                   /db_xref="HOGENOM:HBG396235"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="UniParc:UPI0000253372"
FT                   /db_xref="UniProtKB/TrEMBL:Q751E6"
FT                   /transl_table=1
FT                   /translation="MHSRWLRYPISRLQIVRYKSSTRVCPLLPFRREDWLVDAKSIKHP
FT                   PQAGGQCDRRSVHLKLAELAKNNIDAKFQSTLERAIRGLQGQALRSETPAEQPMRKEAW
FT                   ARLQDELVQQLQSYRPQESYRMTVADVLQPKHISTLLPQLLHVDGLTQQQWEGILEVPE
FT                   AQKVMKLRHILDTHFKLLYHEEVLPKRVGSLSFSKRTLDISNPAEWFPEARKLRRTIVV
FT                   HLGPTNSGKTYHALEKLKKCDRGYYAGPLRLLAREIYDRFQKDNIRCNLLTGEEVINDL
FT                   DTLGNRAGLTSGTVEMVPLNQYFDMVVLDEIQMLADEQRGWAWTNALLGVQASELHLCG
FT                   EPSVLPFIQRLVAMTGDKLVINEYQRLGKLEVESKPLPERFHGLKKGDCLVSFSKRKTL
FT                   DLKLQIERAKKCKVAVIYGSLPPETRVHQATMFNRGEADILVASDAIGMGLNLSIKRVI
FT                   FTSAMKWNGAELIPLTDSQTKQIAGRAGRYKVAGESDDAAGGSVGKVTALDMETLEMIQ
FT                   NSMKAPVKYIPSAVLWPPDRILAQILTKYPPGMKITTLLEHFDRDIKSNPDSLFILPNI
FT                   ESRIEVMNLIEGMDGLSLEDMMTLSNAPLRDLPIPKKAFINFCETVAKKETRSIFDFKI
FT                   PLNFLNAKAVTDEDLKLDLYEELHHVLTLYMWLQIRYPDYFVDLESVKSLKHHCEYIIF
FT                   EKLKFLKRNPYKKS"
FT   CDS_pept        complement(254740..256080)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749077"
FT                   /locus_tag="AGOS_AGL239C"
FT                   /product="AGL239Cp"
FT                   /protein_id="AAS54252.2"
FT                   /db_xref="HOGENOM:HBG059757"
FT                   /db_xref="UniParc:UPI0001DB2B31"
FT                   /db_xref="UniProtKB/TrEMBL:Q751E5"
FT                   /transl_table=1
FT                   /translation="MFTLGRYLRRRHTSYGSLRIQRLSYGRSIGHKLYQLSSRPRHVTR
FT                   TLWRYFNAPGNVLFVTTNVVALTGMYAYSSLCAQPRHTELQVLQRDRVGRDEVVRLEGS
FT                   PGQELAARASAGTLRDGKDIIGEQPWAQYTDVGEWAHVPPVSMESRTMKMSLFYMFYAY
FT                   YLYRDAGPWPKVPPSNPQANNTYWQQTVDALKRRVDRLCEGSSLPEEKPRDSPHAALFY
FT                   SMWRAEFMGVFSNLNRAQQFHIPKHLRVHSDLHALSYKLEQNGLDDITEFLDFYRTRQS
FT                   KEEKHLLQMWFFDFGHHLNSSSKVDTERLYRSLIGNWSTDERSFERHMRAFLSPDDPRR
FT                   KIYFRNHIPEGLETASVDTVLKLLARLNKCQHIDKNDYVIRLISILRKNIYYSESTDSI
FT                   RVYLPSPKLQELTGSMDLTKRKKALEVLSRDPNTLKVLSQLSHSPTS"
FT   CDS_pept        256249..256809
FT                   /codon_start=1
FT                   /gene_family="HOG000167115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622206"
FT                   /locus_tag="AGOS_AGL238W"
FT                   /product="AGL238Wp"
FT                   /protein_id="AAS54253.2"
FT                   /db_xref="HOGENOM:HBG177042"
FT                   /db_xref="InterPro:IPR008584"
FT                   /db_xref="UniParc:UPI0001DB2B32"
FT                   /db_xref="UniProtKB/TrEMBL:Q751E4"
FT                   /transl_table=1
FT                   /translation="MLYLVVSARLSDNIKAIYPKDSEESPAEYTFQVVCTNCREPHPAP
FT                   IRVNRFEKHAKNVARSEASFVMSCKFCGKECSIILERTEEQLYNEADESCSEALARAAM
FT                   QRKKLGLRNVNTGSAVWLKMDCRGLEVTAYETADTVFVVELSSGSTMECTFEDGEREWF
FT                   DYDDNAGEEVSIEEVSFQIIKGK"
FT   CDS_pept        complement(256901..258637)
FT                   /codon_start=1
FT                   /gene_family="HOG000246671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079005"
FT                   /locus_tag="AGL237C"
FT                   /orf_name="AGOS_AGL237C"
FT                   /product="AGL237Cp"
FT                   /function="actin binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54254.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG192718"
FT                   /db_xref="HOGENOM:HBG397083"
FT                   /db_xref="HSSP:1K76"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="UniParc:UPI0000253375"
FT                   /db_xref="UniProtKB/TrEMBL:Q751E3"
FT                   /transl_table=1
FT                   /translation="MHPVAPLERTVAHSQYTRKSLAMALEPIDVTTHSSDIEAAYQKVV
FT                   RGKDSDTTWLILSPGDKRAYSAAKTGSGFGEFLGSFDESKVEFGLARVSPPGSDVEKLL
FT                   LVGWCPDSAPLKTRASFTSNFAAVADRILKAYHVQVTARDEDDLNERELLMKISNAAGA
FT                   RYSIQQDSHSPKPTKTTTAPRPRPGDVPKPRPGSMPVASSAQSTPAAAPAKPAKPSKPA
FT                   APARKVEPAAKASEDGWGDEPEVKERDLMKEPVKPTKSSWKPIGKVDLQSVISEEKAKA
FT                   DPRLVNALPSEKTGKKLNPSDDIAKLKAESKQKREYEYEQVLKAKGSASPSRGSPDKKT
FT                   VDEHEESSDSDQDQTFQVEDAKAKFEKMEISGGPTIIKPKPASRPAPAASEEKTHIPVS
FT                   SHKKFGMPLPGMHTEEKSIENDTEDDSWEEEEEKAPAAAPLPPPRRAAAPAQPSRESPE
FT                   QSSRETSEQPSRETPELPRRDTPEPTEKADDKAPSGTPSRTASQPPPPPARRAVEAKKE
FT                   PAAPTAIAEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVEL
FT                   QQ"
FT   CDS_pept        258797..259279
FT                   /codon_start=1
FT                   /gene_family="HOG000246865" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622207"
FT                   /locus_tag="AGOS_AGL236W"
FT                   /product="AGL236Wp"
FT                   /protein_id="AAS54255.2"
FT                   /db_xref="HOGENOM:HBG059758"
FT                   /db_xref="InterPro:IPR014898"
FT                   /db_xref="UniParc:UPI0001DB2B33"
FT                   /db_xref="UniProtKB/TrEMBL:Q751E2"
FT                   /transl_table=1
FT                   /translation="MVTFNCEVCNDTVPKKNTEKHYYRCPDAYYTCIDCSTTFHDGVGY
FT                   QKHTQCITEDEKYQKALYKGKKRKGSGPAESSAGKTGKKPAEKPAEKPAEKPAEKLAKP
FT                   AKTKGEKAPAPGKVTKPALVPGQTLHSALKALPSRSDRKALLKRLRVASDGTVHLE"
FT   CDS_pept        complement(259316..259873)
FT                   /codon_start=1
FT                   /gene_family="HOG000000914" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774763"
FT                   /locus_tag="AGL235C"
FT                   /orf_name="AGOS_AGL235C"
FT                   /product="AGL235Cp"
FT                   /protein_id="AAS54256.1"
FT                   /db_xref="HOGENOM:HBG059759"
FT                   /db_xref="HOGENOM:HBG204066"
FT                   /db_xref="InterPro:IPR020981"
FT                   /db_xref="UniParc:UPI0000253377"
FT                   /db_xref="UniProtKB/TrEMBL:Q751E1"
FT                   /transl_table=1
FT                   /translation="MDPLSRYKQAVQQRLDSAERAVSKVVHENTVLAQQLATREKEVAA
FT                   LQAQVAEAEEARARAQTRQATLEEEVEILKDLFEHLCGVRVHKSYEDDTGLWFDASQGS
FT                   RHGVMDYKLGFVKNGDSGETEVVYVPLLKRRRAGELRQLQAQLPAYLFDTLSFPLKSLH
FT                   QFYGKLARCLSRSDVKTGTTVP"
FT   CDS_pept        260233..262122
FT                   /codon_start=1
FT                   /gene_family="HOG000200558" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749078"
FT                   /locus_tag="AGL234W"
FT                   /orf_name="AGOS_AGL234W"
FT                   /product="AGL234Wp"
FT                   /protein_id="AAS54257.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG395537"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013890"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0000253378"
FT                   /db_xref="UniProtKB/TrEMBL:Q751E0"
FT                   /transl_table=1
FT                   /translation="MSSSVSASQAKVNELLEAIRQEFQSVSQEATSYRLQNQKDYDFKI
FT                   NQQLAEMQQIRNTVYELELTHRKMKDAYEEEIQRLKVELEQRDRQLSQYAQGTAVPLAA
FT                   PAASVVTASPAPAVGTSGAAASNTLPSLSEGALAKSKSLSSPHHQVVGGGAMVPQSLGP
FT                   TPMPPIGSHQHLPQPLAAVAPSGGQPVVPLGAQAQPEQAPVDSAVHGQASEHYLVPYDQ
FT                   RPVHAKPIPPFLVDLDSQLVPTHLKKQTSEYYVLYNPALPRDLDVDLHHSLDHSSVVCC
FT                   VRFSNDGEYLATGCNKTTQVYKVSTGELLARLSDDSVAGVNNEASTGPANNGTADNGGE
FT                   NSATIQPASSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYS
FT                   LDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDR
FT                   TVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGL
FT                   NGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHR
FT                   NSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKYTKKSNPTATGAKLQELKE"
FT   CDS_pept        complement(262678..265296)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622208"
FT                   /locus_tag="AGL233C"
FT                   /orf_name="AGOS_AGL233C"
FT                   /product="AGL233Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54258.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059760"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000253379"
FT                   /db_xref="UniProtKB/TrEMBL:Q751D9"
FT                   /transl_table=1
FT                   /translation="MAESDGKIVKTRRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGLP
FT                   ECVYLSEFTHDVNSRELFSSTPNVELLRRIDELETELARMKSEMVPQLFMQKHVMGTVS
FT                   PVNRLSQFHLVIEKQGRTIFYGPTSFRAVVASVSPRFYHYFTVILTKLRHVRLSWKKDN
FT                   NYSAMMELDLIETPFMSEHEQTLLGGLLLRLPSYETTLKILEKGLNSPLSKNFPFLDSS
FT                   KIMQDFLESFQKGEEDPTTRQSPIVRLIPAGKKNYYGIGVIVMLLCILHYGHSPSKEVE
FT                   VFLKYLSTSFNGKVFYVERIEFFVLRFIYRSMFGKDGGDCIHTVLFAEEAVSTAIHMGF
FT                   HKDIKDLYKNHPVYKDRIVYLENLWHLVLFIDIEVSLSLGVPLHVSESYVSQESILDRD
FT                   TGSLYFLKKVVAKFRSILLAIHSPLCTPDIKALIEDIRQFIRHNYKPLDFYLNHQNLNG
FT                   QEYVEIESLMFFMSTMYHMGMVNLILNNDSSPANIASIVQYVLFTLKLTTVVIQRYYDL
FT                   DSVYYPERVANHETQPLWYLQLGIALMSKMSTRSIAEYYTLLFDRAISADGLTKGKYYN
FT                   NLPVSDVFDLDIHTIEVPTDHYISLSSASMELHNIFGDFLKSLGPKLLSVLNKIYPFTV
FT                   ITSLQNICHVVLQSAFDSNEETVVNTRNSPLVYETVPNFQAMPPRQRLPYQSFTLGTSL
FT                   QPNYYPHHMPFHPLQQSLQYKFPHAIQRIPPHIRQHFAQRLAQPPVTEILPQGPVHTSQ
FT                   KASYAPNSNIIRSYNPGDGYVNPSLIKDSPSVSTASQGNSSQAQNTPHSSSVCSHVPVS
FT                   STFTPCLYPMPNGDLQASRSIADEFWNNIENGLEDWITTTNSSLNQLTNVFKAADSPEE
FT                   S"
FT   CDS_pept        join(complement(268994..269038),complement(267782..268930))
FT                   /codon_start=1
FT                   /gene_family="HOG000081923" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749079"
FT                   /gene_name="MVD1"
FT                   /locus_tag="AGL232C"
FT                   /product="Diphosphomevalonate decarboxylase "
FT                   /EC_number="4.1.1.33"
FT                   /function="ATP binding"
FT                   /function="diphosphomevalonate decarboxylase activity "
FT                   /function="kinase activity"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /biological_process="sterol biosynthetic process "
FT                   /protein_id="AAS54259.2"
FT                   /db_xref="GO:0004163"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="GO:0016126"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG089900"
FT                   /db_xref="HOGENOM:HBG502799"
FT                   /db_xref="HSSP:1FI4"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001DB2B34"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751D8"
FT                   /transl_table=1
FT                   /translation="MSIYVASTTAPVNIATLKYWGKRDSMLNLPTNSSISVTLSQEDLR
FT                   TLTSAATGPELAEDRLWLNGKPESLGNARTQQCLADLRALRRALETEEPDLPRMSEWKL
FT                   HIVSENNFPTAAGLASSAAGFAALVVAVAKLYGLPQDYSEISKIARKGSGSACRSLYGG
FT                   YVAWEMGAEADGSDSRAVQIADVEHWPEMRAAILVVSADRKDTPSTSGMQQTVHTSDLF
FT                   KERVATVVPRRYGEMAAAIRARDFATFARLTMQDSNSFHATCLDSFPPIFYMNDTSRRI
FT                   VKLCHLINEFYNETIVAYTFDAGPNAVLYYLAENEARLCGFLSAVFGANDGWETTFSTE
FT                   QRATFAAQFDECVRGKLATDLDDELHRGVARLIFTKVGPGPQDTKSSLIDPETGLPR"
FT   CDS_pept        269216..270286
FT                   /codon_start=1
FT                   /gene_family="HOG000003697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749080"
FT                   /locus_tag="AGL231W"
FT                   /orf_name="AGOS_AGL231W"
FT                   /product="AGL231Wp"
FT                   /function="prenyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54260.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG007607"
FT                   /db_xref="HOGENOM:HBG324383"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="UniParc:UPI000025337B"
FT                   /db_xref="UniProtKB/TrEMBL:Q751D7"
FT                   /transl_table=1
FT                   /translation="MLLSSGLCGLRSTGSGAGLRWGTAALSSGAATRQAVFSAEQLAKA
FT                   REDRQRALGPYLSRLPARVVPYAELMRLEKPVGTWLLYMPCSWAITMAATQTAAPLAST
FT                   AAMLGLFGAGALIMRGAGCTINDLLDRDLDNKVLRTVERPITSGRVSAGRAVAFLGAQT
FT                   AAGIGILACLPAGCWWLGLASLPLVATYPLFKRFTYYPQVALSACFTWGALLGFPAMGV
FT                   LDWGTMVPLYLSSFLWCMTYDTIYAHQDKAFDIKAGIKSTALRWGDRTRGICAGMATAQ
FT                   IGLLALAGANSGLLLGPGFAAGLGIFAYRLYAMIRNVDLDSPADCWRWFQSNIRTGLYF
FT                   SAALFCDYLLTIFGVM"
FT   CDS_pept        complement(270296..271057)
FT                   /codon_start=1
FT                   /gene_family="HOG000057129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079006"
FT                   /locus_tag="AGOS_AGL230C"
FT                   /product="AGL230Cp"
FT                   /protein_id="AAS54261.2"
FT                   /db_xref="HOGENOM:HBG059761"
FT                   /db_xref="UniParc:UPI0001DB2B35"
FT                   /db_xref="UniProtKB/TrEMBL:Q751D6"
FT                   /transl_table=1
FT                   /translation="MSVLFSSRIAALVARAQPTTLYSYRPGRMLRFGPWGLCAVFSAYG
FT                   ASFALSSSEATRVLYAEEEERERAAAGPWYMAPTLLLFGRGSLSIVLSALPFAVAAGAL
FT                   YVPTRVVLRLEYLPGKVPQCRVTRWGLFGRGRTDVVPLQQLRLRTRRPVYTGVGRQGVE
FT                   DTATSSFALSNSGAGALRRHYLCNRNGDFWGGDGRVIDALFGGVAPRELDGAEAPAAGS
FT                   ASSGELQELLGRADQRAKVGSRAAKNIVRQK"
FT   CDS_pept        complement(271118..271465)
FT                   /codon_start=1
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749081"
FT                   /locus_tag="AGL229C"
FT                   /orf_name="AGOS_AGL229C"
FT                   /product="AGL229Cp"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="AAS54262.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000025337D"
FT                   /db_xref="UniProtKB/TrEMBL:Q751D5"
FT                   /transl_table=1
FT                   /translation="MLRLLGGAKRMQSSVSVLRTAAELQAATARPRAVVNLSAAWCGPC
FT                   RGMAPVYKRLSEEHRDISFYKVDIDELPDAARHFGVTGVPTYVVLRDGREHARVVGADP
FT                   RALEQALTLDG"
FT   CDS_pept        complement(271543..271926)
FT                   /codon_start=1
FT                   /gene_family="HOG000000913" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927777"
FT                   /locus_tag="AGOS_AGL228C"
FT                   /product="AGL228Cp"
FT                   /function="coenzyme binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="AAS54263.2"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG124508"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="UniParc:UPI0001DB2B36"
FT                   /db_xref="UniProtKB/TrEMBL:Q751D4"
FT                   /transl_table=1
FT                   /translation="MHTLSSVRDSVTKFQAEPLHDNPDYVVLQQARRHADRRLAEVRYV
FT                   AKQMQQLYQQLDKTRNYQEFVDVLMNNRALLREVFTLEKNTARRVATPRVQWSKYGVDV
FT                   EAYVIERGRSAVGAACGWGFEDE"
FT   CDS_pept        272146..273705
FT                   /codon_start=1
FT                   /gene_family="HOG000057080" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749082"
FT                   /locus_tag="AGOS_AGL227W"
FT                   /product="AGL227Wp"
FT                   /protein_id="AAS54264.2"
FT                   /db_xref="HOGENOM:HBG059762"
FT                   /db_xref="UniParc:UPI0001DB2B37"
FT                   /db_xref="UniProtKB/TrEMBL:Q751D3"
FT                   /transl_table=1
FT                   /translation="MRPGRERADGGDHGRAMKRIEEEPASLYSAVDASTSSSSLVAVPG
FT                   FTFGDGVTCAEQKRHSGVGPQAWKYVPQPKPPARSRSPSRGNAPARTPSPGGRSARTSV
FT                   VGDSPFNFASATLQPPAGSRTAFRKGHRYKHSSVSMNFFPEPEARPALRLARALPVPDV
FT                   RDIWHNLTRPRHHVTLALVAAQAVACVLLLHRAERREWTNFGTLAHFVLYDMLGTLTVV
FT                   LVEVLPRFEVWGTGTLTYPFGLKRLDVLLSFGFAVSLCFVGLDLVFHVLEELVVLFVES
FT                   ADSGQHTDIVGSIPHSHHTQVDADALAEWYTVVALCGILSAAVLRTAFASREGVERRYK
FT                   TKTPIITLAYTVYLLVFPVLSRYTEVGDYVATVSIALFVMMYGLRVARWTGTVLLMGFS
FT                   TSALDFPGLTLLSDDNGAEAKTPAPQEQPLISVNHLYEPTIVKSRLGEMIEKLPQFRSN
FT                   CSFKYTDLVLAKVHFEMFILLLKLNMKGGSDEEELDLRLAIDRCVKSVLPNVETTIEIE
FT                   RV"
FT   CDS_pept        complement(273788..277864)
FT                   /codon_start=1
FT                   /gene_family="HOG000057136" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079007"
FT                   /gene_name="SRB8"
FT                   /gene_synonym="MED12"
FT                   /locus_tag="AGL226C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 12"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS54265.2"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG059763"
FT                   /db_xref="HOGENOM:HBG204064"
FT                   /db_xref="InterPro:IPR019035"
FT                   /db_xref="UniParc:UPI0001DB2B38"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751D2"
FT                   /transl_table=1
FT                   /translation="MSSSRYILIPPEDLHPLTSNTGNEQNIYPDFDPWAHTEIEDKILL
FT                   SFVAKGHYTSAKVNFESISARSSLQESLPKVAGMLAEQFSKVVHLREQTINKVSGESEE
FT                   SIRGKAKFTDLAGPGFSLPNRVTLTDQRRTQWLQELSSPNVSLSKLAKSIPHGFKRKQI
FT                   LEQCYMRQLPLQRAIWLIKSSYSIEWKSLTSKLKPGQTNEGVVSQLYNLWTNSMVSIME
FT                   RLLFEMPKYYNDTAQAKIWKPRVSYYINLLGNCYNMGLMDRGVFNHWLVEFVEKVENFE
FT                   FLPLSLHLLNIFWSGICPPTHGIEAPDNSFLISKITVVLLHKHHMILQNKSMINDENYI
FT                   INDLQRNARLKESLLLRLKAFILDIFHHQSLEAFIMPNQNWDLYKNCLYEIVTMDKTSN
FT                   EQAMVIKRKLELITYRNDSLQFNLLKQYKMKSSSLYESDGVEIDNLCDMQSILNVPFLD
FT                   PEMTKILDNATPGYDWTLFVQQRFTCIEKVAQMIMWATNPSRKARYDGAHLVAKLLLLK
FT                   TTSQENLPDYNMEDMIWKLVFHFSKLSERELSNIVELPSLYELLNIFIGYGIIKVPTYI
FT                   RKLISSGIMYISDSKDKFFHCELLINLKISPLMKNQYNMMLKNIMEYDATYYVRYNYEQ
FT                   LQIQLNTAKEQMLQEQFEHISCLPISVKIWVSEWYLSYVCSPVDNVLKPVDKGTVIKNF
FT                   TIFGLYLKEIFHFYKWVEFIVYHQLLADINALSALIDVLLYYENLFPLLINDQILFMKT
FT                   LIHIYSKGLKNKDNLSYNITEFNPFWKFFMKHFPYLVEIDSDLQLQLGEVYESEKIRIE
FT                   KLTKSSVDVITLYCNINQVNEESFKFGTHNFPGIFQQNLKILLKTESADACERARKGLS
FT                   LLMLANLGDYTKFMSIFLKRKDYTIEQLVKLISVKLLTLDQIQKIIGDDILREILSRNN
FT                   YGEGLWYELHKRNFIKKNFKIVLSMYRNSTSLDDRKLFLDLLVFYGPNSRLQEQVTTII
FT                   CNCLRESNEDYSLILSLLRYGTKNIDQGTQETINIAKLYENLNFTNLWIFQAFTNYYTE
FT                   ALFNGATSDGQTITNFVFELIDLTRYNVLCSHLFDRVANFDVLEKLLEVFEADFFKKCL
FT                   SEDPDDVHFLAVMIETIMNLSRKMNQSSAVISMNNESFRLLQATMLKFTSMNKTALCNS
FT                   EMKLSIYLKIFIVHQKFIFQKVCDSLRQDRYDAEADLVKSLRLLFENTGFKLKLRLLLY
FT                   DILSSLKSFVIYECTKKSESKRETRKLQISEALQNLPPFHISSFLDDMSISAHGDFDFL
FT                   GLTEQPTPAEPEEGSQFFLYNKRTREYECGLNIEPFQLLPNHQSREPGSSCHFFNDTAL
FT                   SLSLFDARFDKKNPT"
FT   CDS_pept        complement(278091..279914)
FT                   /codon_start=1
FT                   /gene_family="HOG000203294" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622209"
FT                   /gene_name="DBP6"
FT                   /locus_tag="AGL225C"
FT                   /product="ATP-dependent RNA helicase DBP6 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS54266.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000253381"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751D1"
FT                   /transl_table=1
FT                   /translation="MFAARFDPSRHYEEGDTAPPAPSLPMKRSRDAQQDESESEMSSAE
FT                   SEDEAMQLDDEEEVVDSKGKENHGSDSIGTGEADKRHQSVLSRFQRTISVQDKLDSDAI
FT                   VGSDSEEEPAKMHGLVPIAQPAIVRDTLAQDSRKERKLLAWSNTTKIHYDSTMTKPFAA
FT                   YKDILSTSLLANVEGGFSRTAFPIQTALLDSVLPLMSQAYSVSKRYYTRKVGDILVNAS
FT                   TGSGKTLAYAMLLIHILSRRTVNKLRAVILVPTKLLVHQVYDTVQALAKGSSVVVAVSK
FT                   MDTSLKEESAKLKAQEPDVLIITPGRLVDHLNMQTFSLKNLKFLVLDEADRLLNQSFQN
FT                   WCIELMTRLNAERPFKGPGNVIKMIFSATLTTNTERLHDLQLHNPKLFLMGSQLYHMPA
FT                   QLQEYNLPIPTSKSYAKPLILLRLLPLLSTESLRILVFVKSNEASIRLAALLTAMVGNG
FT                   LSAVSTTVGSINNNNSKATNRKLIEAFAAGASGHCSILVSTDLMSRGLDISGISHVINY
FT                   DLPISSQQYVHRCGRTARANTSGTAVNLLVGKGEQNFWKDHIDSDISRAPDGSHLFFDE
FT                   EQREQLVSLSEEDTATYKKCLEELKKSVLGR"
FT   CDS_pept        280112..280387
FT                   /codon_start=1
FT                   /gene_family="HOG000111560" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749083"
FT                   /locus_tag="AGL224W"
FT                   /orf_name="AGOS_AGL224W"
FT                   /product="AGL224Wp"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS54267.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG307515"
FT                   /db_xref="HOGENOM:HBG382195"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="UniParc:UPI0000253382"
FT                   /db_xref="UniProtKB/TrEMBL:Q751D0"
FT                   /transl_table=1
FT                   /translation="MFSSLRLLSRSVWKGPNVVPLPIKEALAKGTPIRTNARSATVLPQ
FT                   FVGLKFQVHNGKDYVAFEITEDMVGSKLGEFAPTRKRFSYTQTKNK"
FT   CDS_pept        complement(280474..281910)
FT                   /codon_start=1
FT                   /gene_family="HOG000000910" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749084"
FT                   /locus_tag="AGL223C"
FT                   /orf_name="AGOS_AGL223C"
FT                   /product="AGL223Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS54268.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG059764"
FT                   /db_xref="HOGENOM:HBG398156"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI0000253383"
FT                   /db_xref="UniProtKB/TrEMBL:Q751C9"
FT                   /transl_table=1
FT                   /translation="MGASQAYIHLRPTNMLVKHGRTGAAASVTGAAGGAGSNHMLRIHL
FT                   ERFPSLIGHSSSRINRRYNEDGYSMRVLKLPSAAAEQQCLSSPEIRHKREHWRTKLPLE
FT                   RSVLNISIFDGHGGGRVSKLLATCLHEWLVKTYPSKRDLFSVLKAYRDRVGGRYWSTIY
FT                   ARRELFYDRFIRSCNTKQEQVLQGGAAPGKILDRSGNIIDKTSLLTELERLRIYLTFLK
FT                   YDLEQVSGFKATENDMEVTEAAYAGGSTATSIFLTTYDGEPHDESFFVSPESLLKLVVT
FT                   QVGDTKVVLCDKNGIAHSLVRVHHPDSPRESDRLSGNFQTDSFGDVRFLNNFANTRAFG
FT                   DRGGKREGLTCEPDIYSYLIGSTRRLPRSEHSKLPFGGDECFLCLITDGVSDLMSDQEL
FT                   VDLITSTVNNRGLKVATPQYCSDEVIRYIMAIGSNTADNATCIVLRLSNWGNWPVIDRT
FT                   GAIREEKLMASSSGSDRNNV"
FT   CDS_pept        282235..282717
FT                   /codon_start=1
FT                   /gene_family="HOG000040063" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749085"
FT                   /locus_tag="AGL222W"
FT                   /orf_name="AGOS_AGL222W"
FT                   /product="AGL222Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAS54269.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG046904"
FT                   /db_xref="HOGENOM:HBG747181"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0000253384"
FT                   /db_xref="UniProtKB/TrEMBL:Q751C8"
FT                   /transl_table=1
FT                   /translation="MFLSKLSPLHALFPRASYSPVSWATRLFSQSAPACATLNQIKRGV
FT                   EPPRRKKVTESPALEGCPIRKGVVLRVMVLKPKKPNSAQRKACRVRLTNGNVVSAYIPG
FT                   EGHNAQEHSIVYVRGGRVQDLPGVKYHLVRGAGDLAGVVNRISSRSKYGVKRPQKD"
FT   CDS_pept        282863..283876
FT                   /codon_start=1
FT                   /gene_family="HOG000212535" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749086"
FT                   /locus_tag="AGL221W"
FT                   /orf_name="AGOS_AGL221W"
FT                   /product="AGL221Wp"
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="AAS54270.1"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="HOGENOM:HBG340103"
FT                   /db_xref="HOGENOM:HBG591001"
FT                   /db_xref="InterPro:IPR007188"
FT                   /db_xref="UniParc:UPI0000253385"
FT                   /db_xref="UniProtKB/TrEMBL:Q751C7"
FT                   /transl_table=1
FT                   /translation="MHGPQRPRTHKRVTGLDTSSMLHLQPHNLLIEKTLVEALEAFRKG
FT                   TPLTLDRVVSDFDYATFHISNADQTGVTLNVSMRTKAWQSVAAAGPGLLAYLQDKYDRL
FT                   PGVSTASAPETGYDHTLLIQLDALAPESVMQVALLKMTTMAYVFQLAFDESLRLAQLPE
FT                   DRQEAAGVHLIQYRDDENIYIKPSGDRVTVIFETMFQGETDKVFGKVFLQEFVDARKRN
FT                   RSIQSAPQVLVSHEAPLEIASAVPRRTADRSKRFVTFVLFPRHFVTRDLQFSSVCHLAL
FT                   FRNYFHYHIKCSKAYMHTRMRRRVDSFIKVLNRAKVDAEDDDDDNRRTISGKKMVY"
FT   CDS_pept        284326..286968
FT                   /codon_start=1
FT                   /gene_family="HOG000246501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749087"
FT                   /locus_tag="AGL220W"
FT                   /orf_name="AGOS_AGL220W"
FT                   /product="AGL220Wp"
FT                   /protein_id="AAS54271.1"
FT                   /db_xref="HOGENOM:HBG190380"
FT                   /db_xref="HOGENOM:HBG396972"
FT                   /db_xref="InterPro:IPR019167"
FT                   /db_xref="UniParc:UPI0000253386"
FT                   /db_xref="UniProtKB/TrEMBL:Q751C6"
FT                   /transl_table=1
FT                   /translation="MSFFGFDTSMPPKGAQDSKKQKELDFEETYQGLGDYEQEEDDYLN
FT                   AETFGDGADLGNDFDFGYGKGALEGGPAYGAVSYAPTMSYAAAASGAPKKFDDNVDLQP
FT                   MESLWGSGQTAPGSATFPEQAIGMQDTARSPEQMVMPPPGFMAVPQGVPQGVSQGVPQG
FT                   MPQGMPQGVPQGVPQGVPQGVPQGVPQGMPPQGYAFAPQGYVQAPQQYQYAPQGMPAQF
FT                   SQGLPQQFQQIPIMMGQPQTSSPDVNPLQQQPAQGHIDVPLGMPSMPPGMQQDMGVPQH
FT                   AIIASPQQVQAQLAEQQLSPVQNSTSLMQRGPASPSAQNRIPTPPHTPRDFRRGSTRRH
FT                   HEPLTEEEQKRLHIRQAKVDKILKHSGVMTPRDKDFITRYQLSQIVTEDPYNEDFYFQV
FT                   YKIIQRGGAVGESNKGLIARAYLEHSGHRLGGRYRRADVALQRMQSQVEKAVTVAKERP
FT                   QKNKDLDSAKEGVLGKISSTMNSRAPRRQLQLPTHKDDESGYDDSSAVSSSALDEVAHT
FT                   LEGVEIAKSKGRRRSSYMFSSMDHHSVLSRSGGRKFVLSLIESIYEEVLELEAVLRNGK
FT                   QPDVTKLWEVLHIDDDSHEVSPFISILSFDKGVKIMPRIMNFLSKEQKMKLFSCFFNEL
FT                   SYLNIIMKSSYKTNPNPTDSQLKKIELFQSAFLKIIVSFLSNHAEFIEVVTLLLCLIKN
FT                   NNISFISTSKIGLNLITVLISRAALIKQDISIGNGSSNVEISTWNDVYVKLFTALETKL
FT                   LAIFPPKAYMDKVIAMTVSQQNQAMSALSSGGASQHPPHLASPFYDLSYIWQFFASLAL
FT                   SGKLNHQRIIIDEIRDEIFGTISKAEELEKQSQDPAYLYQRNKMYQDLNLFLNVIGLVA
FT                   RDGEISELK"
FT   tRNA            287167..287240
FT                   /gene_name="tRNA-Asn"
FT   CDS_pept        287393..289045
FT                   /codon_start=1
FT                   /gene_family="HOG000142019" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079008"
FT                   /locus_tag="AGOS_AGL219W"
FT                   /product="AGL219Wp"
FT                   /protein_id="AAS54272.2"
FT                   /db_xref="HOGENOM:HBG059766"
FT                   /db_xref="UniParc:UPI0001DB2B39"
FT                   /db_xref="UniProtKB/TrEMBL:Q751C5"
FT                   /transl_table=1
FT                   /translation="MLDKNEQEVIFRNVAKFLTQNDLTSLALVNRWFNAKIAIPGLYKN
FT                   IIICRDPVLRSGEWFLDCGTSYIAGFRAVSKTFDQNDIFVYDRVRRLTGSSHLDKIRTL
FT                   VIESDTFHDMENGRIVLQELLDAVIETGVIEHLYIRDPVLFEANYCQLFSLSRLQHLEI
FT                   TNMKDLARISDASIKTVKSLQLTLREPSFESGAVPPEVTRAFFPKIEKLTIQDNEYSSL
FT                   RVLQYFDSEGITFCNLKALKFNHVHGLHDYNKTLRELTSSYIIKTIPLENIQRLEIEVS
FT                   CCIKGCECFDNFLVELASEPLNLRELSFIEKRFGAITHLEAENWDLAVCKFLLSLPSIS
FT                   VNLKALSIRHSAPADGIIEDAVEGNYLRRRTLYAEVLPHLRALTTLIAPTILHTLSAYE
FT                   TLVCDLLWNGCECHFCADVLGVFDRYLMNHQYYSRSAGTYKDITPSIFFAFASDALSRR
FT                   CSPASGWDLDVLTQAPFGHLWDMHGYQNIAHFPDFDCLYDVSTFGYLAVCITHFLNQYM
FT                   DDITGCLPSLRSCYLTGIYYTCNKSTKYKSIYE"
FT   CDS_pept        289549..292029
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774764"
FT                   /locus_tag="AGL218W"
FT                   /orf_name="AGOS_AGL218W"
FT                   /product="AGL218Wp"
FT                   /protein_id="AAS54273.1"
FT                   /db_xref="HOGENOM:HBG059767"
FT                   /db_xref="UniParc:UPI0000253388"
FT                   /db_xref="UniProtKB/TrEMBL:Q751C4"
FT                   /transl_table=1
FT                   /translation="MLNRSRSSMLGCVRLWPRSVVLVMNMRQLQQSVVCTVYNGVRRTS
FT                   RQLPRWINDKEPQKAKNGQLKATSNGNRLGWSKQRQVSFITEEEFKAAWSVRFMYGELE
FT                   TVNEVIDILEKKSQAFQPAHLLTLLETLYKLHDLHDIARIYQVYGPLLKNMDSYPGYCE
FT                   LLHLLVKTQFQLQDYPITELLFRLYASCQKPDGKLFMYGLRSMLENNNAVSAKEFYCRF
FT                   VKTCKELHSSDHILQLMTSYAIKKGDMQGLSDIFQLWLYNSHITPSYVTLARAQLDFER
FT                   FDTMEGKYYWYQILHHPQVVKSGYHQSDYYLIARFMKRIDRLKLPPASVQKEMQENNAY
FT                   ANISCDAKSLLYKHLLHTYMKANDFASLKDMLRIIQQDSEVSISMDFHLVICKYFSKNG
FT                   LLGDLTSYLKDVIVKIPHTEKPVFDSRLLSIIWRSAMTAYPMLLREYENEFQVLLNHEE
FT                   YFYCFPWLQNCVKNLLSLDVLEARGDGIFSVRTATSSETKKLYRAAKHLKRHDAGKVCF
FT                   MIRKHMDASMRPAFDLYYSLMKYCVNHRQFNTMNFLEANLRPTYRYIPLKVDILTLRAK
FT                   IYQLLDNQNLNPGEAKGNSQVGTMIKSFITTNEQRLNFQNRLQLGTLASKFGLFELAEE
FT                   QFAHAKRLMRPTERRELYMYYKSLSAFYSLAKMPTCLIDTLRAFNNEPHSSLVTHYWLR
FT                   SIRTHIHWLRRNNAEEEVIDELTKQRSKMVLHYANSKMEGLHSISALTTLLRSWLNHLC
FT                   EADRAAMHLRREALKKSIDIAFTARTHAASSSAAVSCALASGLPSTQPLSQPNFYTYPY
FT                   KECEQSIGMHAELP"
FT   CDS_pept        join(292270..292305,292368..293552)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622210"
FT                   /locus_tag="AGOS_AGL217W"
FT                   /product="AGL217Wp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54274.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059768"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0001DB2B3A"
FT                   /db_xref="UniProtKB/TrEMBL:Q751C3"
FT                   /transl_table=1
FT                   /translation="MSGVLHKAVPKVSGRKHLIIIRKLLETTICTICHDYMYVPVMTGC
FT                   GHNYCYFCISNWLNNTSSTELNCPQCRSSITSMPSLNVTLQQNLDALIEVLDKAEPEVI
FT                   ALLDAKRESLKEYKDDVAGNRLYQKVFENTAVAVVDEDDGVARCSNCHWEVEGSVCPHC
FT                   QARMRNRVNETEFNSDEYSESELAELEQTLDEYRVRSAELMQDLGSADGHSSDGSLADA
FT                   LNRRFPIRQPRDFLHDDISGSSDSHYDEDKYYPDRRSASRSADADTPSDLEGFIVDDED
FT                   PAAHESEGSSTYNGSQPSSPASSFTRHRQRSPHITTRVARDSTDDSIVEVVRDLSTSGG
FT                   GSSPSVNGSRATDTSRDSDYYENNEVDGFVSGDSLDDTEHKHAVTSSSAEEPARKRRYM
FT                   VLDSDDD"
FT   CDS_pept        293900..294085
FT                   /codon_start=1
FT                   /gene_family="HOG000248810" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749088"
FT                   /locus_tag="AGOS_AGL216W"
FT                   /product="AGL216Wp"
FT                   /protein_id="AAS54275.2"
FT                   /db_xref="HOGENOM:HBG059769"
FT                   /db_xref="InterPro:IPR014367"
FT                   /db_xref="UniParc:UPI0001DB2B3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q751C2"
FT                   /transl_table=1
FT                   /translation="MAVNKVIQYQKMFQASTKPLWKRHPRSNFYLYPFYGLFALSLLVP
FT                   IAHIPNAIMGIKAKRS"
FT   CDS_pept        294460..295461
FT                   /codon_start=1
FT                   /gene_family="HOG000142018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749089"
FT                   /gene_name="AIM39"
FT                   /locus_tag="AGL215W"
FT                   /product="Altered inheritance of mitochondria protein 39,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="AAS54276.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG059770"
FT                   /db_xref="HOGENOM:HBG202767"
FT                   /db_xref="UniParc:UPI000025338B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751C1"
FT                   /transl_table=1
FT                   /translation="MIRLLGLTTRRVAVRTPVTALYSTGKPIDPKHIFTDPQTNRIRDP
FT                   PNYFQKGRGRGTEDAPLPADMHYGMGAQEAVSEAIGASIRQQRARKRRGILLALVVAVF
FT                   GTVFGYSIGYRVFYKHSESFLPLWPAKRSRPLSEKDAANLRVAEVKRMAEFRVFERLSM
FT                   HKMIKEQFGVPLHTQDGKKPETNVFVLWCEDQDPCITGLLFRPSGSHAPDHGHTWHDFL
FT                   GLVQWRVTHRPVSIRNAAERVLNFIGLGTSDLFQMVDPSKVYGDFKYEFPLPKRNDNDH
FT                   AMHICFLGEMPLGPDSLVVYRGKYHVGVRLDQVDLFRREDGKLIRYVLYKNS"
FT   transit_peptide 294460..294717
FT                   /gene_name="AIM39"
FT                   /locus_tag="AGL215W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751C1 "
FT   mat_peptide     294718..295458
FT                   /gene_name="AIM39"
FT                   /locus_tag="AGL215W"
FT                   /product="Altered inheritance of mitochondria protein 39,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751C1 "
FT   CDS_pept        complement(295561..296241)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927778"
FT                   /locus_tag="AGOS_AGL214C"
FT                   /product="AGL214Cp"
FT                   /protein_id="AAS54277.2"
FT                   /db_xref="HOGENOM:HBG059771"
FT                   /db_xref="UniParc:UPI0001DB2B50"
FT                   /db_xref="UniProtKB/TrEMBL:Q751C0"
FT                   /transl_table=1
FT                   /translation="MPLDSKWARVPAEDGKASPAQTANTGKKKPAARSEERRSSHGAVK
FT                   PQEEGKTKDSKRWPRKKGANSSARVNSAGSGGSASSAEQLDSRPSTSGSQSKSRIFDKA
FT                   AGRGPNPLAVRLGITDESARSKRDGERRAAGKGAAKRASRTNAPAHRQVKGDGRGQAPR
FT                   PLKDDPATVSELERRIFEQRKLLAMRQHQAEQERLLQDFLCDDFPLEWDENELVGQLDK
FT                   LATR"
FT   CDS_pept        296681..297058
FT                   /codon_start=1
FT                   /gene_family="HOG000142017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749090"
FT                   /locus_tag="AGL213W"
FT                   /orf_name="AGOS_AGL213W"
FT                   /product="AGL213Wp"
FT                   /protein_id="AAS54278.1"
FT                   /db_xref="HOGENOM:HBG059772"
FT                   /db_xref="HOGENOM:HBG203505"
FT                   /db_xref="UniParc:UPI000025338D"
FT                   /db_xref="UniProtKB/TrEMBL:Q751B9"
FT                   /transl_table=1
FT                   /translation="MWRRVARTVTCRRWAHGGSYKQWHELGLDEQQRFARDFVENYRAQ
FT                   YPGSKTNVSLRGLTLNMEEHGDAPAVFGIFYNDIWRLRQQREAALYGAGQRVPAGSAVR
FT                   EHGRFAHESFHDLLVEIESAE"
FT   CDS_pept        298073..300784
FT                   /codon_start=1
FT                   /gene_family="HOG000204521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774765"
FT                   /locus_tag="AGOS_AGL212W"
FT                   /product="AGL212Wp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="AAS54279.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG522470"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001DB2B51"
FT                   /db_xref="UniProtKB/TrEMBL:Q751B8"
FT                   /transl_table=1
FT                   /translation="MSNGLSLPKYANMPFRPPRMAKQGDKRRGGDSTAGGETAVVREGG
FT                   LGKSVKDQEQTGDGLKRPKRETKIFMVTYRKASNKKNKTWDGDGYGVLRSGEQLRVYNG
FT                   DGKALGTYHWQADRAMSDVVFRCGAGWECQLDYEIKDEREFSAALDTVKGALAPEKKSP
FT                   CRTTVQPGPGAGGNNTPTRVPLSKLFVGAKNTKFKPVMRSADAAIAAGSAASGRHCALF
FT                   DKTQIDDPLVMNKAGDDEVEVVVDPILSKKLRQHQRTGIKFMYDCVRGLARSEKDDDRT
FT                   VMILEYDSDVKGCLLADEMGLGKTCMTIALIWTLLKQHPRPSSVPCSQLGVALQGICQK
FT                   VLVVCPVTLIGNWKKEFIKWLPMNRIGILTLSSKNTPEKDKNDVRNFLRVQRTYQVLIL
FT                   GYEKLLNVFSELDQAKSKLDLLICDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQN
FT                   DLNEFYTIINFINPGILGTFAHFKRVYITPITRARDVNNKHNDQIVSLGESRSQDLIEI
FT                   TKKFILRRTSSIIADYLPPRTDIVVFCKPTQHQLDAFNQVLVGTRVDFQNMSFNSSLGL
FT                   ITLFKKICNSPSLVSSDSYFQSKVNGGTPALRIAQSTTSGKLKVLMSLLHQIAHRSDNE
FT                   KVVVISNYTQTLDIIGNLMSSASLSYLRLDGSTPTKERDAIVNDFNRSQTIFGFLLSAK
FT                   SGGVGLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKIFQ
FT                   RQLMKNNLSKKFLDDHCDDKSSDNVFEQEDLKDLFSVQSGTLSNTHDLLCSCEGSGEEF
FT                   EDTNTPPPSSENTEGGKAKMTGWMRALDVKNIMDNSQKQQSALKATIMKKCLVGYRHIN
FT                   PRLMSDFGDHILERTLEEYPDSVTFAFVKRNK"
FT   CDS_pept        complement(300831..302669)
FT                   /codon_start=1
FT                   /gene_family="HOG000174514" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749091"
FT                   /locus_tag="AGL211C"
FT                   /orf_name="AGOS_AGL211C"
FT                   /product="AGL211Cp"
FT                   /protein_id="AAS54280.1"
FT                   /db_xref="HOGENOM:HBG055252"
FT                   /db_xref="HOGENOM:HBG396510"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000025338F"
FT                   /db_xref="UniProtKB/TrEMBL:Q751B7"
FT                   /transl_table=1
FT                   /translation="MADTVKQQDLYVYELLPELLTSLEVVVFDECVSEVTDGARPEQIA
FT                   SDRKPPSSKEDAMRCTACDLQISSANFVRDHYKSDFHKYNLKRKLNQLAPVSLEEFDRL
FT                   TENDDIESISGSEAESEDDEKPGAGSALRRTRLDAVMEEELGKISPSVEISASRPTHLN
FT                   TRSPLIYFNSKYLPEGSVFGVHKCLFSATGVEDPLGSMREWQKATQGERVSALFMMGGG
FT                   HFAAAIVSHQRIDISGNAKRHGESLQEQAVHFLEHKTFHRYTTRRKQGGSQSVMDNAKG
FT                   KANSAGSTLRRYNEAALRNDVQDLLKKWRPYLERCEHIFIRAKNVADRSVFFTENTPLT
FT                   KVDPRIRTFPFTTRRPTTNELRRAWCEITYLKRTLKPKPITSERQYLPKATNDSTANKA
FT                   SVVRELSPAAKHTQELLSFVRKSKAPQLIAYIKKHNLSPNLTLEPSEEYLQTPTLLHYA
FT                   SNNGLKNMVLILLSNLKCDPTLTNHLGRTAWDLTKRKDVKQAFQIARHNLGEGFTNWED
FT                   SHIGVPLSREEVTEINTKEVEAANKEREKAVEEELQEARERQKQALEAKRGPGKILVPQ
FT                   LSENARNLNSLTDEQRRRLMREQRARAAEARMGLGK"
FT   CDS_pept        complement(302861..303964)
FT                   /codon_start=1
FT                   /gene_family="HOG000253896" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749092"
FT                   /locus_tag="AGL210C"
FT                   /orf_name="AGOS_AGL210C"
FT                   /product="AGL210Cp"
FT                   /function="uroporphyrinogen decarboxylase activity "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54281.1"
FT                   /db_xref="GO:0004853"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="HOGENOM:HBG090899"
FT                   /db_xref="HOGENOM:HBG628392"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="UniParc:UPI0000253390"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Z7"
FT                   /transl_table=1
FT                   /translation="MQAVDRTQFAPLKNDLMLRAARGEDVERPPCWIMRQAGRYLPEYH
FT                   DVKGGRDFFETCRDAEIASEITLQPVRRYAGLLDAAIIFSDILVIPQAMGMRVEMLEGK
FT                   GPHFPEPLRTTEQLMKVLEYEVDVLRELDWAFRAITLTRQKLAGDVPLFGFCGGPWTLL
FT                   VYMTEGGGSRLFRFAKEWIHKRPELAHKLLQKITDVAIEFLAQQVVAGCQILQVFESWG
FT                   GELSPADFDEFSLPYLKQIAAAVPARLRELGITEDVPMTVFAKGSWYALDKLCDAGYNT
FT                   VSLDWLWDPAEAVRINNGRVTLQGNLDPTVMYGSDETITKKTEAMIKGFGGGKKQYIVN
FT                   FGHGTHPFMDPEKIRHFLEECHRIGKM"
FT   CDS_pept        304320..307355
FT                   /codon_start=1
FT                   /gene_family="HOG000093779" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079009"
FT                   /locus_tag="AGL209W"
FT                   /orf_name="AGOS_AGL209W"
FT                   /product="AGL209Wp"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS54282.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG059773"
FT                   /db_xref="HOGENOM:HBG397580"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI0000253391"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Z6"
FT                   /transl_table=1
FT                   /translation="MKLTKAVFRFRRTNLSTLLVITYLVITTLYVWDHFRYHFTLPSDY
FT                   NYAQMLADAWLDLEIITQYPHPYASHANDKVHDYLLDRVKEITRDSMFAEISDDYGMGL
FT                   RTLFRQEDAISGTKESTVVYYESSNVLARVQGRNSALDGLLLSAHYDSVPSGYGATDDG
FT                   MGVVSMLAILTHYVKNQPERTLVFNFNNNQEFGLAGASAFFEHPWSKEISYVINLEGTG
FT                   AGGKAVLFRTSDVSTAQVYAEAVRQQPFGNSMYQQGFYNGHIGTETDFQVYEDQGLRGW
FT                   DIAFYRPRNLYHTAKDTVLYTSKQALWHMLHTALQLTDYMAINKPDMEDTSNAVYFDLF
FT                   GKWFVVWSARSLFYWNCIILALFPSILAILFLVAYDMQLLKFNFWDAMLRLPVSVCLAY
FT                   FCVKLFQVLVGQLNPYVFSRDYVSPILAEASMFIFMNYVILSSWERLRPLRDFKTVALV
FT                   EVSMVLWIYLISVTRWLRDSDYTATGLYPFTIGYTFVSIGAIIGVFCATFKAKLNPEDD
FT                   SYVGDSKVDIEQQQMLMQHQYQQHSQKHSNQHSPHHSTHHSAQHSVHHSPRQSIHQVPS
FT                   SEQRQRDASETPHVIISVDHTAGHQEDSEVTPLLNTGTVAPFPKPVPERVSRKSFLRNV
FT                   VTSILNYDWSIQFMVVTPWVTYFTWICLDLIMGAMNQTIQESAKGTTFVTHMALIGSLL
FT                   LSLPMLPFTYKLHSFAGMLFLLLAVTTAVWTIVAPPFTESSPLKLRFLQTIDLDKNNSS
FT                   SVYLYGRERTFMEPILDDIPSVTKYRCVEYAGDGVDICEYNGMPPRMFNNHHEAESDWT
FT                   KIMTLEILKDDRNSTSRTPYQPITAELKINVEENRVCTLNFNSTAFKNWKQGVSPLREV
FT                   VILHENPSSNVTPSFYNTAMKNGYYQDEFGNDHYRWNNGITELQLHKLDFKRGYYKIGL
FT                   EWIPQLLYRGYDPATSSSEEDDALGVSVTCYWGEYDTDSITDGFATTNVPAYDELRKYS
FT                   PKNIIYSSKEKGMVSVTKYVEL"
FT   CDS_pept        complement(307528..310113)
FT                   /codon_start=1
FT                   /gene_family="HOG000211468" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750128"
FT                   /locus_tag="AGOS_AGL208C"
FT                   /product="AGL208Cp"
FT                   /function="endo-1,3(4)-beta-glucanase activity "
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="AAS54283.2"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="GO:0033903"
FT                   /db_xref="HOGENOM:HBG059774"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="UniParc:UPI0001DB2B52"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Z5"
FT                   /transl_table=1
FT                   /translation="MRGFLKTLFFTSASLDLSDIQPATVPSFSTRPDRLLTVVALKSLA
FT                   LPTKIDPLTISEPTSIPHYGHWTLVSTPVTRPGNSEYTTASQPSESWYDSTPHTGEGMT
FT                   DILSSNRTRGTIGTTTHQNVSTPVVQPTRAGGTAGVTADDLFAPIETGGPPEVFTRQSN
FT                   PLDLPKGVESNGTPYQTNKFYTNLIVGAQNSSVFVFPYSVWYNKTRQGIAISHTGKSRN
FT                   ISRSGDDNSAYGMSHPLGMAELVFSAAGFGADKSQLHVKEMQSDSCRLELRGSGGDSYL
FT                   EMPLVQGMGWVTGIYHGGIKVAVQVPKGLKCLRAENPGTLPESTLKYRVILSNGVEWLL
FT                   YITFKDQKSWKDFDLVAKDRYTLEAEKSVDGVIVQAAIAPKDQNLEEHYDNSAGMYATS
FT                   FSIKGSVKDTVAEYSFEYSTEGKSQSGNTMLFALPHHIPMMTSDMESKKTGIELEAYTR
FT                   GIMKGFLTNKLSFRAELDRQLSWLPYSPEIKQHNLTYNVEQLHLLANVANLELQADISS
FT                   SIKGLNTYFIGKMIDKFAYILLVVCDVIGNKDITHESLTNLKTAFDLLLKNQQTFPLYY
FT                   DTKFSGIVSSADWKDYHGQADFGATYYNDHHFHYGYLIHTAAVIAYVDAKLGGSWGETN
FT                   KDWVNALIRDVANPSTEDNYFPVFRSFDWYHGHSFASGLFENPNGRNQESSSEDYNFAY
FT                   AMKMWGKVIGDLKMELRADIMLAIMSESINKYYLYSKADTIWPEQIAKNKVPGLLFENS
FT                   ITYTTFFGTNIEYIHGINMLPITPVSGLIRKPSFVKEEWNEKIAPILEKIESGWKGIVV
FT                   LNQALYDPKAAYKFFAAEGFDSQKYLDGGLSRTWALAFTGGLANTLGLL"
FT   CDS_pept        313014..313847
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750129"
FT                   /locus_tag="AGL207W"
FT                   /orf_name="AGOS_AGL207W"
FT                   /product="AGL207Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54284.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059775"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000253393"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Z4"
FT                   /transl_table=1
FT                   /translation="MLHYTNETPESYEAPNPAVDLYNMCKPIAPTGWSSTPEAEDISTP
FT                   LPCDDSSSSDASYFTAFFFDYQHEMQLQQLQLLEQLMNPAVAGMENTPNAIPATTEAVD
FT                   QSSIVFDPAKGGDFQRWLQTQDAVSEASTTFHDALDGNIPINTTQQPGVPVLQQTKAQG
FT                   SVLGPPRLSPPVQNKAPQRYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSF
FT                   NARSNMLRHHKLHFRTDCGMYMLPNGETTRVKPSSRKLFALSRQQHQKYTTLPTI"
FT   CDS_pept        complement(314110..316317)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750130"
FT                   /locus_tag="AGOS_AGL206C"
FT                   /product="AGL206Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54285.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059776"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001DB2B53"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Z3"
FT                   /transl_table=1
FT                   /translation="MVVVRYRMRRSRDDALSTEDPALMAWSNGRGVNDDSRVLKKTEKR
FT                   SRNGCLTCRARRKKCDETRPKCIGCQRNLLLCHWADDDGNYDGHSPNKEEVGIKSNDGF
FT                   LNCTLENWEAEYEVGKSYRFFSVPAEQLKFEYTVALGRDNSIWRLHRNHGSKQRLQKFP
FT                   THGQLDKSGVTPRSAPVKLHKYPVGTKKSARRSISAAILLQDSKNDLLPSDASYAVQRD
FT                   DLLDLKSLFDLQMEPYQQIGEPQLWGCFLYSGTPLETIQPNYSYLLYDHNSNSVYYKEV
FT                   LESFRHGDLSHANSIKEDDGFLFYVCYKEFIPLLDPRDSTYRLVTHTSSVIQQAENNPV
FT                   IKELILSCGASFLQYYSYDTFAPLSDRYYNTAIIFLSNFLGTQAVSGNEVWLMAAFQLM
FT                   ALKNKWCLQNNVNDVLECLTNSYLLLKNCYFGQFGDSISELFLSHPPLAACNSGLTGNL
FT                   GVRSALERPAIPSSCEGGEVSQLRENPLILLPQERTFLEAFIHCYSVCIMFATDQTQIP
FT                   DPFHIFKELNPLFKCPVRHNTEDWVSGASYGYTLEAFEILAKVSYISRYPMPITDPVIL
FT                   QKCQNLQKMARYYSNNLFSTDGPQAYDTYQLYALSFLSGLILARSSYLLITTVLEYSVI
FT                   QPHSPKLQETLGEIMNYFEAIPLDANIWGALTWPLLVCGVYCCTPDDQTHIRFYLGFLG
FT                   KRFALPTTGSIISYLESVWRLPMEQRIPQLFNRAELCKISL"
FT   CDS_pept        complement(316910..318757)
FT                   /codon_start=1
FT                   /gene_family="HOG000112168" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775030"
FT                   /locus_tag="AGL205C"
FT                   /orf_name="AGOS_AGL205C"
FT                   /product="AGL205Cp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54286.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059777"
FT                   /db_xref="HOGENOM:HBG203136"
FT                   /db_xref="InterPro:IPR006572"
FT                   /db_xref="InterPro:IPR013939"
FT                   /db_xref="UniParc:UPI0000253395"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Z2"
FT                   /transl_table=1
FT                   /translation="MGSPIKPGGPGRVATGPGSKYGRSPLKENDPNNQLRGVKAGIGSA
FT                   VQCFPGKKRSLNLLEETEKVRSKRAKAAGVAHPTGSPITGGVAGGRTIEGAVLITRQQA
FT                   QRRAEQSKITAKDLLDWQQNWKRIMRKDTRIYFDTAVVDHLQGAKLEKRKELLKRGFSI
FT                   LGAQMKVFFDMDVTIVITSRKLDRYDNLPETDVLFRAYKSSYMKIWNYEKALRFLKNLE
FT                   VDVDGLEQQNAVGASTGGPLLVIGGGHHNSGLAANALTTTNATATLSKLLESEKLYGPS
FT                   DRDPKAKRDDVHYFRYPHVYLYDIWQTWAPLITVEWRPSELTEPEKLPYPSVKPGSFGR
FT                   CPFVGDGTCDELSTRRILKRYKRDCLNEKYALKLRLLYQDSAVPRQIDDISEDEYPVML
FT                   PTTAQYPNSKTKYLEVMGIEDSKCKRPPPMSLLTRQETAGEDVLGNDDLCKRKNRIPQE
FT                   IKASGVNQSLDTNAGGSLSIGNGLAPAKASNVNKSLKSLNRLVVDRKFTQQTIPPPPQA
FT                   AKPTLTAACIQEKHSASPQGSLAPNHTVTASPVPAKRPLQGKLGGGYCENCRVKYDHLD
FT                   QHIRTEKHQSFAENDNKFERIDSLINTLRDEYTLYGSSQ"
FT   CDS_pept        complement(319130..319825)
FT                   /codon_start=1
FT                   /gene_family="HOG000000722" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750131"
FT                   /locus_tag="AGOS_AGL204C"
FT                   /product="AGL204Cp"
FT                   /protein_id="AAS54287.2"
FT                   /db_xref="HOGENOM:HBG124180"
FT                   /db_xref="UniParc:UPI0001DB2B54"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Z1"
FT                   /transl_table=1
FT                   /translation="MQEALGHHSCLCSGGRCRQRRCRRPSRMCLGGAGQRCAGCPGFQA
FT                   LKMYVAPLCCGRRIHTRTVCTMAMLQSRSIKRLLQQTLEPTATPLSTYQLQSTVLLSSK
FT                   TGSIVSFVSANPAHPTSGDALNNLKMMALLIKEKWSEDEHDPQAQATKSCYHVTVPARD
FT                   DAAAAAAPLTTRIYTCELEDLHTCVAQIPGSDLLLLFIADSLFPHGMLVLKMKSLLSAF
FT                   SEVYGYKLD"
FT   CDS_pept        complement(320013..320825)
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750132"
FT                   /locus_tag="AGL203C"
FT                   /orf_name="AGOS_AGL203C"
FT                   /product="AGL203Cp"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="AAS54288.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="HSSP:1AYZ"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000253397"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Z0"
FT                   /transl_table=1
FT                   /translation="MSNRKNTAASLLLRQYRELTDPKKAIPSFHIELDDDSNIFSWNIG
FT                   VMVLNEDSIYHGGYFKAQMRFPEDFPFSPPSFRFTPAIYHPNVYRDGRLCISILHQSGD
FT                   PTSDEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVKLE
FT                   VERSKQDIPPGFVMPTSQTAYISQRNTEPEEAKDVGDNFWYDSEEDDDMYGDDDDDADN
FT                   GHSNEEPEFEEEDDDDSMDNDSVMDKRKPDKADEESEDVDDVKLDINK"
FT   CDS_pept        321438..322112
FT                   /codon_start=1
FT                   /gene_family="HOG000182099" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750133"
FT                   /gene_name="ALG14"
FT                   /locus_tag="AGL202W"
FT                   /product="UDP-N-acetylglucosamine transferase subunit ALG14"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54289.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG193935"
FT                   /db_xref="HOGENOM:HBG735599"
FT                   /db_xref="InterPro:IPR013969"
FT                   /db_xref="UniParc:UPI0000253398"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750Y9"
FT                   /transl_table=1
FT                   /translation="MAWLAIVCLLAATTALCVRMAALAPGVYGPAVCGGRSGGGRGPPR
FT                   HVMIFLGSGGHTGEMLRLLEVYGAALVAGATVRVGYTDEASAERGRQSAALRAARGVEY
FT                   VPLLKAREVGAGAGAAVRSTVRAAAQAFSAVRRARRALHTGPHVVVLNGPGTSVVVLFW
FT                   LRVLDLLSLRRTRVVYVESLARTESLSLSGRLAYPFADEFVVQWPDLAQRYRRARWFGA
FT                   LV"
FT   CDS_pept        complement(322148..322894)
FT                   /codon_start=1
FT                   /gene_family="HOG000226413" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079274"
FT                   /gene_name="TPI1"
FT                   /locus_tag="AGL201C"
FT                   /product="Triosephosphate isomerase "
FT                   /EC_number="5.3.1.1"
FT                   /function="triose-phosphate isomerase activity "
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="gluconeogenesis"
FT                   /biological_process="glycolysis"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="AAS54290.2"
FT                   /db_xref="GO:0004807"
FT                   /db_xref="GO:0006094"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="HOGENOM:HBG000074"
FT                   /db_xref="HOGENOM:HBG708281"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="UniParc:UPI0001DB2B55"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750Y8"
FT                   /transl_table=1
FT                   /translation="MARTFFVGGNFKLNGSKQSIKEIVERLNTADLADNVEVVICPPAT
FT                   YLDHAVSLVSHPQVTVGAQNAYTKASGAYTGENSVDQIKDVGAKWVILGHSERRTYFNE
FT                   DDEQVAEKTAFALERGVSVILCIGETLDEKKAGVTLDVVKRQLTPVLEKVKDWTNVVIA
FT                   YEPVWAIGTGLAATAEDAQDIHAAIRDFLAERTSRDVADAVRILYGGSANGANAASFRD
FT                   KADVDGFLVGGASLKPEFVDIINSRR"
FT   CDS_pept        323344..324654
FT                   /codon_start=1
FT                   /gene_family="HOG000281563" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750134"
FT                   /locus_tag="AGL200W"
FT                   /orf_name="AGOS_AGL200W"
FT                   /product="AGL200Wp"
FT                   /function="dihydrolipoyllysine-residue succinyltransferase
FT                   activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="oxoglutarate dehydrogenase complex "
FT                   /protein_id="AAS54291.1"
FT                   /db_xref="GO:0004149"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0045252"
FT                   /db_xref="HOGENOM:HBG395225"
FT                   /db_xref="HOGENOM:HBG630916"
FT                   /db_xref="HSSP:1B5S"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI000025339A"
FT                   /db_xref="UniProtKB/TrEMBL:Q751B0"
FT                   /transl_table=1
FT                   /translation="MLRSTLRVTSRAARPLAASMGRSSAVHAGAAAQAKLYSQIQMGAM
FT                   HGPALQHLCGLRYASTSVQVPPMAESLTEGSLKEFTKQVGEYIEQDELLATIETDKIDI
FT                   EVNAPVSGTVTKLNFKPEDTVTVGEELAQIEEGAAPAGGQKPAAKEETSAPQEAAPASP
FT                   AAKEEKPQAAKPAQAAPAKEQPKQAAAQSSTVSAGASVSGFARTERRVKMNRMRMRIAE
FT                   RLKEAQNTAASLTTFNEVDMSALLEMRKLYKDEILKTKGVKFGFMGLFAKAVALAQKEV
FT                   PAVTGGIEGDQLVYRDYTDISIAVATPKGLVTPVVRNVESLSVLEIEQEISRLGQKARE
FT                   GKITLEDMAGGNFTISNGGVFGSLYGTPIINTPQTAVLGLHGVKERPVTVNGQIVSRPM
FT                   MYLALTYDHRMLDGREGVTFLKTIKELIEDPRKMLLV"
FT   CDS_pept        complement(324892..326571)
FT                   /codon_start=1
FT                   /gene_family="HOG000246747" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079275"
FT                   /locus_tag="AGL199C"
FT                   /orf_name="AGOS_AGL199C"
FT                   /product="AGL199Cp"
FT                   /protein_id="AAS54292.1"
FT                   /db_xref="HOGENOM:HBG059778"
FT                   /db_xref="HOGENOM:HBG396752"
FT                   /db_xref="InterPro:IPR002573"
FT                   /db_xref="InterPro:IPR007521"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000025339B"
FT                   /db_xref="UniProtKB/TrEMBL:Q751A9"
FT                   /transl_table=1
FT                   /translation="MPHPDARKSRSEVKTAPARSWSRSRSGQRPPSLPRVKSSQRLIRT
FT                   ISIEGRSHDGRAEEGRAEDGDDGLLRLAFGSEKQQYIEVPYVKATLDASLPEEYLRQDV
FT                   VNMTWNLQVPKWYRPGTRVAPEEVKLVMITGTMTNAIFKVEHPRLPSLLLRVYGPNVES
FT                   IIDRDYELQTLARLSRQNIGPSLYGCFMNGRFEQFLENATTLTKKDIRDWKTSQRIARR
FT                   MKEFHCGVPLLDWEKTHYTVLARIDKWLKKMGDSSWIQKKGNLQSTLFVQEWSQFLAVF
FT                   ERYRAWLKSVGELDQSLVFCHNDAQYGNLLFTAPVVATDTSSVGTSTSTPVSGSLFPSE
FT                   SNISLDDIIRPSIHDQSQDSKLVVIDFEYAGPNPAAYDLANHLSEWMADYHCAESYKTF
FT                   EHKFPKKEEILNFIYSYTSHLSASKQDPIDDKVRELYNSILRWRPCVSLHWAIWGLMQS
FT                   GELDEPKDLAVAVEGAGPGGEKYIITVDDCESINSIDSCLTDCSAVEEPTAKGADIHSF
FT                   DYVSYTIEKMCLFYGDLLQLGILSKDDLPPGVQPKFLDSTFL"
FT   CDS_pept        326760..327572
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775031"
FT                   /locus_tag="AGL198W"
FT                   /orf_name="AGOS_AGL198W"
FT                   /product="AGL198Wp"
FT                   /protein_id="AAS54293.1"
FT                   /db_xref="HOGENOM:HBG059779"
FT                   /db_xref="InterPro:IPR019146"
FT                   /db_xref="UniParc:UPI000025339C"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Y7"
FT                   /transl_table=1
FT                   /translation="MDLVRANYAADSDSDSQGEEDVSCPLPEYISHMFRRAATAGLRLE
FT                   RPHVYAYADVQLSEQQRGILERLVQRANSARVEAEFQPLFYGRLRARRPLHVSLTPALQ
FT                   FSSAAAATACVERMRAGLAGAGVLATALERAPRVLPNCDSSVAYLALPLAPAGRAQAAA
FT                   LTARLGAALAATPGGLTPYDSAAFAAGAHVSVAEDSQNPGLLRYARAKDTPGAAAHLER
FT                   METLLQASDTPLPPADAAALQIVCTAVHLTLNGRLQASVALRTQLQPM"
FT   CDS_pept        327981..330515
FT                   /codon_start=1
FT                   /gene_family="HOG000001123" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079276"
FT                   /locus_tag="AGL197W"
FT                   /orf_name="AGOS_AGL197W"
FT                   /product="AGL197Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54294.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059780"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000025339D"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Y6"
FT                   /transl_table=1
FT                   /translation="MAGEPWSIDPTALLHTHSNTGGDANARQGERVSLNLDYAAKDAVG
FT                   ELGLAVEAESEYFELGTENYEDIDEFLTQELRDLDIPVAPAPGGCAGLVEPPACYPKRP
FT                   EEEDVGIFASALDWTALEHVGSDSRTEPEQCVDRRTGRRTPSGTAIFGFSRHNKTLNIG
FT                   AGGIAGDDPERGELLDVKEKQSLPAMSSLIIKQQEELGLALERQKEMNRQLEEQLKITQ
FT                   LQQKQLQAVLNQQESAGRKLGGNTSIMTPLHHPQEYDSVLLASASRSGGYTFPILSEEE
FT                   EDDDKEPPDTVLTGSRATLNGSPRKQYLPLQETGALDTLGAVSPRGTAMDKLPPKTVPP
FT                   ISIERPLKLFPTGVQQQQHHQQQQQQQQQQQQQQQQQQQHGKQPCLIRQTFTVGSIDSG
FT                   LGDQSPLSPRHQLVASSPKLAYESSVTPVLHRNSKSLSSTPSTVFVPAEPESELSITSG
FT                   KLQRPTTIGLGLHYHDSQQPLVQTTNRPVSMGMLPSYKSKAFSGKESLSPPGYPQKYRF
FT                   QQTPLRDSPQRVMPIGSGRSSGSYPMNPNLFEMMKSPQLRPPGGAYYTHCRTRSDSTEY
FT                   AEDRVPEFVHAKSPSPILLSQEKFDKTHQFHGVSGTLGGSVMNGVGCKKVFDGHRPPGQ
FT                   YMGQSSIYSPERSSPMKKASNLPQGEIDQYIKKLQDKTFQCLYPECGKLFNRRYNIRSH
FT                   IQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKKTHAEKTFTCPCGKKFSREDALLTHRTR
FT                   MICVGGKKFDNIVIKKSPRKRGRPKKEGSSAHNSPVKDVLARDYSGTVTLKMEKQLQKE
FT                   PVNPDLLQVPGSTPKAKITMTPVALRGFITSP"
FT   CDS_pept        complement(331101..333908)
FT                   /codon_start=1
FT                   /gene_family="HOG000212524" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750135"
FT                   /locus_tag="AGOS_AGL196C"
FT                   /product="AGL196Cp"
FT                   /protein_id="AAS54295.2"
FT                   /db_xref="HOGENOM:HBG522343"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0001DB2B56"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Y5"
FT                   /transl_table=1
FT                   /translation="MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEEV
FT                   KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM
FT                   QTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAIT
FT                   GIWCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEI
FT                   KLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIR
FT                   SETEIAKALKKREKRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVC
FT                   TPSKLELVITTANNTIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKL
FT                   LATASNGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTM
FT                   LENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLI
FT                   HDTTLDLGEDLLCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDIS
FT                   HDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKY
FT                   WDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETEDQVFLEEEREKE
FT                   LEEQYEKTLLTSLEGGSGDDAFISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLG
FT                   ITEIDAWEKYEQQMKLWNKKLGDQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLED
FT                   ALLVLPFSYVLKFLKFIDIAIKNDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKM
FT                   QINRVKDQLRAALRSHVDDLGFNIQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKR
FT                   LFPTF"
FT   CDS_pept        complement(334113..335777)
FT                   /codon_start=1
FT                   /gene_family="HOG000141888" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750136"
FT                   /locus_tag="AGL195C"
FT                   /orf_name="AGOS_AGL195C"
FT                   /product="AGL195Cp"
FT                   /function="DNA binding"
FT                   /function="transcription initiation factor activity "
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="transcription factor TFIID complex "
FT                   /protein_id="AAS54296.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005669"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016986"
FT                   /db_xref="HOGENOM:HBG059781"
FT                   /db_xref="HOGENOM:HBG203175"
FT                   /db_xref="InterPro:IPR003228"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000025339F"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Y4"
FT                   /transl_table=1
FT                   /translation="MRSHEAVSTGEKRLSGWQARCFRSEGFSTRFIVLYLLVSLWSGQS
FT                   RKNSARDIGQTRKENMSSNNQQGNGQVPQLTPSSMRQLAYKFRTLVSEAQQVGVRTPEG
FT                   LELLKKASNIKAIYETYHRQQAQQAFQVRNPAPAGQLAAAGTGQATAPRPTSSVASNIK
FT                   MLLTPQQREAYEKLTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVKQLETK
FT                   KNELLTKLTGLNTQFQALPKKFQEDKKKFYIECAATNVNLKKFLQATSQQQRASAGNTG
FT                   TTNSPANTQLGANIGAASAATPAAANAAPTGSSAATPQSQRQQMQRPNSGANRYPAQVT
FT                   PVNAAANQNNSGTARPVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASA
FT                   LTMPVMTKLPPYEVDSERVMSKRKLRELVKTVGIDDGDGETTVDGDVEELLLDLADDFI
FT                   TNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQK
FT                   LQGISSARAAKLAPATTANVTTGSANAAAVATESNKK"
FT   CDS_pept        join(complement(336733..336735),complement(335917..336681))
FT                   /codon_start=1
FT                   /gene_family="HOG000112177" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750137"
FT                   /gene_name="DCN1"
FT                   /locus_tag="AGL194C"
FT                   /product="Defective in cullin neddylation protein 1 "
FT                   /protein_id="AAS54297.2"
FT                   /db_xref="HOGENOM:HBG202460"
FT                   /db_xref="HOGENOM:HBG206132"
FT                   /db_xref="InterPro:IPR005176"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014764"
FT                   /db_xref="UniParc:UPI0001DB2B57"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750Y3"
FT                   /transl_table=1
FT                   /translation="MSNARQRELIREFLAVTSATSAAAETYLERNHWSLDHALDDFYTQ
FT                   SGGGGRAEQYSAELVATFERYAAGGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEE
FT                   LTADISRFQFLSTWHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGG
FT                   RRLSVETAIAYWSLFFLDHTYAVTVPAPRLRSWFEFLRAGDHSVSRDTWDMFPRFAQRF
FT                   PDDTELLEHYNELASWPLVIDEYYEWVKGRNQL"
FT   CDS_pept        337086..339215
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750138"
FT                   /locus_tag="AGL193W"
FT                   /orf_name="AGOS_AGL193W"
FT                   /product="AGL193Wp"
FT                   /function="ubiquitin protein ligase binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cullin-RING ubiquitin ligase complex "
FT                   /protein_id="AAS54298.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0031461"
FT                   /db_xref="GO:0031625"
FT                   /db_xref="HOGENOM:HBG059782"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="UniParc:UPI00002533A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Y2"
FT                   /transl_table=1
FT                   /translation="MMYSQEAVGCQQQVVDAVCTWDPSLKDEIEAVLEWMDPNDDHNNH
FT                   QMRPPSLRIKNSIRLLRLGEQAPGTTVGLLRQCAVSQMRQHFFRHWERLEQYTDMVKLE
FT                   RYYEFPLRYVAVFTEDEVAAELVGLRKYLLNGNPGFRANMEARIRALILQDDDFETAAR
FT                   LYKWIVQGLGHPMVKFVIEVLTQKIALFCRNRMDGNVDQRYLIMEVFNSFIARCWAQFI
FT                   QLLQFPTADDPELNNLIYRCFEKKFIELKTQELFHQIIPKFPMSKPALLEMKSVIKGDT
FT                   AELDRLVAQIYNDFHKELLVPSVTTVEILLYYVKTIKCLMVVDPTGRSMNRFTSKLKPK
FT                   IKERSDLIISVLCAILELDSDEIHEVISKNTLTENPQLLSQLSKELKNSTALTFHSMST
FT                   SKGKAAIYSVAFERQDQLVKQFLEWTPEPGPFTADDAKALNSDDDGAETLELPKDVLEV
FT                   VFQVFDSPEVLINEFIQLVTNHMLQMDGYVLNAKWSQLLKTVMKKYFKNNKQVLKSMCE
FT                   ESNLVNVFVMWSDLEKSATFQTWSTKLQLVPPNVYPKIISYLYWKIGRRSPYGDYAVAP
FT                   GLAAIFDQMEKAFETRSPGRKLRFQKDQGSVDLQLVFEDGRHWSSRVSLPKYTVIDLFQ
FT                   RQACPLSVTDIAAHTNMSPRLVEDIIQFWCHEHVLHLNKNDLYEILENHNSAIASRQSQ
FT                   ASVPAFHPVSSAYAT"
FT   CDS_pept        339708..341207
FT                   /codon_start=1
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622484"
FT                   /locus_tag="AGOS_AGL192W"
FT                   /product="AGL192Wp"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS54299.2"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI0001DB2B58"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Y1"
FT                   /transl_table=1
FT                   /translation="MIAQIAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSE
FT                   AWSGRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG
FT                   VRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLG
FT                   QANVDGLTFAVAHASNSSVAVLGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTV
FT                   YSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLH
FT                   TGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDCNSR
FT                   RLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVF
FT                   DLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEFGNLTAT
FT                   ASDSSSGSVGSRSNSALTLTPPSLSVMLFAASLLGAATRII"
FT   CDS_pept        341558..343306
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750139"
FT                   /locus_tag="AGOS_AGL191W"
FT                   /product="AGL191Wp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54300.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059783"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0001DB2B59"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Y0"
FT                   /transl_table=1
FT                   /translation="MVITNVFGFSSSRRSNNEGQEHGGGGQGPGVEDGGEPRARANTRN
FT                   VTVAIQYSWLHDMRNVGGEGEEAGQGPGENGDTFVMSFTDVPDSTSNDRFQEVIGIAAQ
FT                   FALSRVARRISLLRGLSKESFEKLPLRKLSELDSELCSICYDDFEDDTSIGSKRNRDVD
FT                   NDALYLKRQRTGGDSSAQSSLSPGEAGAGGDAGGREGGHAGGWPAEEEAEQPHYKHSPT
FT                   ELPCGHVFGRDCIFRWTQEHNSCPICRARIVENEGLNHAVQDTPVVMDEFDRQSFERIR
FT                   QLIYGDNASSGDRPNGDGGITLQRHNVIVIRPDSASFNGHLQRGEAGTAPLAGSSAGTE
FT                   SEQAPAAQAERVPAGNSPTAPPAHAAESMEAVGVIPLALFSLAPLGAARNTDSPASAQG
FT                   NDTTPEPATTSEGGSAGTASMNNTDISRLFDLIANLTGRMQPRRNSGNNTNSSNSTLAP
FT                   SGSSRSGAERSQESAAAPPAPSRFGLFDFLSRGRMMGSPFGAGGSPIRDVLGDGRRRPS
FT                   LEGRGLFGTGVASFREGTGVRTVDFSGPMPHPRSPPAPAHNTSDEADVNSPHDRTHPDD
FT                   PTQETE"
FT   CDS_pept        343645..344757
FT                   /codon_start=1
FT                   /gene_family="HOG000204332" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928048"
FT                   /locus_tag="AGL190W"
FT                   /orf_name="AGOS_AGL190W"
FT                   /product="AGL190Wp"
FT                   /protein_id="AAS54301.1"
FT                   /db_xref="HOGENOM:HBG013535"
FT                   /db_xref="HOGENOM:HBG523770"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00002533A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q750X9"
FT                   /transl_table=1
FT                   /translation="MLVYQMKGYSGYAVQYSPFFDNKLAVASGSNFGLVGNGRLFIMDL
FT                   TAQGTMVESNSFLTKDGLFDVAWNELHENQVLAAQGDGSLRLFDITLQQYPIALFQEHQ
FT                   REVFSCNWNLLHKDTFVSSSWDGTVKVWTPARPQSMLTLLPAPANRSVMVEPGARGLPL
FT                   SNQQQHKDAADNKDCIYQAQFSPHDPNLVMSCSGNSYVSLFDLRQPAASNQQRFIAHSG
FT                   LEALSCDFNKYRPHVIATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRK
FT                   VVWSPHHSNILLSTSYDMTCRAWHDLADGPGGQHSGRTNNSDPQRGCSYVFSKHSEFVF
FT                   GADWSLWGQPGYVATTGWDGQVCAWYALAR"
FT   CDS_pept        complement(344798..345337)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622485"
FT                   /locus_tag="AGL189C"
FT                   /orf_name="AGOS_AGL189C"
FT                   /product="AGL189Cp"
FT                   /protein_id="AAS54302.1"
FT                   /db_xref="HOGENOM:HBG124391"
FT                   /db_xref="InterPro:IPR009851"
FT                   /db_xref="InterPro:IPR017435"
FT                   /db_xref="UniParc:UPI00002533A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q750X8"
FT                   /transl_table=1
FT                   /translation="MGTPVLPPKPCAAAGGPRAEVPLPRKAHLLSTAELQELLKAQDKL
FT                   QLYVAGLCESEETQKRVEQQRKQLAEIRETFAGLEGERQRVQERLDGYQRLVFRYHEAW
FT                   QAVDGACRARYDDGVLRARLQQEMRAAEAECRVLRAQLGDAEVDAFLTQYLRLRTEYHV
FT                   RREKLETWEVQGALRR"
FT   CDS_pept        345838..346545
FT                   /codon_start=1
FT                   /gene_family="HOG000260139" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622486"
FT                   /locus_tag="AGL188W"
FT                   /product="Acyl-protein thioesterase 1 "
FT                   /EC_number="3.1.2.-"
FT                   /function="carboxylesterase activity"
FT                   /biological_process="fatty acid metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54303.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006631"
FT                   /db_xref="HOGENOM:HBG398734"
FT                   /db_xref="HOGENOM:HBG651281"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="UniParc:UPI00002533A6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750X7"
FT                   /transl_table=1
FT                   /translation="MSATAPIRIAARAQPAKYAFIIFHGLGDSGAGWTFLAEYLQRDPA
FT                   LASAQFVFPTAPVRPITANNFAPATAWLDVRSWLSHESVDLEGFNESMKLVPKLIEEQV
FT                   AQGIPYERIWIGGFSQGAALTMGTALSFPHRLGGFLSFSGPPSYRWLEHTVSDANTGAP
FT                   VFQSHGTMDEVFPSSGAEAVHRSFTSQYGFKNHRLKIYDGLGHSISPQLLDDALAFIKA
FT                   NLDAEKPAPRPAL"
FT   CDS_pept        346809..351827
FT                   /codon_start=1
FT                   /gene_family="HOG000112248" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750140"
FT                   /locus_tag="AGOS_AGL187W"
FT                   /product="AGL187Wp"
FT                   /protein_id="AAS54304.2"
FT                   /db_xref="HOGENOM:HBG059784"
FT                   /db_xref="InterPro:IPR007249"
FT                   /db_xref="UniParc:UPI0001DB2B70"
FT                   /db_xref="UniProtKB/TrEMBL:Q750X6"
FT                   /transl_table=1
FT                   /translation="MSLPLKPLSIDSNFKRLDSKQSKYHQNVQKALQHFDAVTEWADYI
FT                   SSLGKLLKALQSWTPQFQNVKYYVPFPYQVSRRLASSLSPDLPSGVHLKTLDVYIFIFE
FT                   KIGMEALSKECNIWVAGILPLMAYASISVKSPVIELYEKYLIRLPPSMLRLLAKPLIAS
FT                   LLPGVDDESSEFQPMVLGLLDDLRRNLGDDSLFWQSCFMIMLSLRNRRLGGLVWMTKRL
FT                   PSLNAVPHLVSQYQQQAAEGNGDVQDKKQQRQAALALLLPESRCIVSPEPGLLIRSLVN
FT                   SLREENELLIQRGILDLLAQRIHLHSPVLQTLVTKADRELLIMSCCKTMLKKDMSLNRR
FT                   IWNWLLGPSSRVQQADTPLNDYFPKYGLESLMNGIIAMIGSESELPNAFKICLALMDRW
FT                   EIGSRIVPHLFIKLMKAADKFKESKHVITVASMFFDSIETTVIWGSCYEAITQKHDYDL
FT                   LEFLLSTFNVATDEEIVVRHCPLILLTMLLLSFEDEPAITKQKYRLCNALADIIPDKAY
FT                   LPLSLSALVGEEGKSSVELLSAITNFYIAEANPLVPNSADKMPPFPPADLAFLITEKVY
FT                   LLLLKSLETGCMVNEMSHLYVSLIGKIPTQPDAEDKATEADQALVSQIFSLGQKLDEDN
FT                   SKDSIFGIVVLYSDYLAHQVDLIDSLKILKMIVDCLWHYLLDPNRQMEAIRCLLALNRG
FT                   ISKQHIEGALTSAFIREKDIAAKLTVLDALWTKLENDIGMIRRPLQLMFDELFDEQHLS
FT                   YLHVSKWIVSVINANASNRLFQVLADNLLSFDFLMKETLTELDDLDLFTYHVQTVTNVL
FT                   RTEQSVLLKSFSLELTSLHSFEQWREEDVSTYKGLTIGILLRFLNLENNTHGRSIRSAL
FT                   ILLDTLIDGTEQNFKAIVTSLLQLSTKYIKIKVPESELIIVSLLSIVSKILSLSHKNDI
FT                   KLDIFDDNSSHINYIDFLVSSIANIESPLTVSSYVQLLSESIIYFQHSIFNIILPLSSS
FT                   LTQCIERLFYQSEDKGKNYKSFSLLIDGLEELLEVSHGYLMAGENNGYLNGPNSKNDFL
FT                   QSMVSNVFSNDPSNSTSKLQGEREVVFQSYKRAIDCSFGIWIWAQNISNSRALPPDHCV
FT                   GDPEYSESAHQLSYKYKFKTKKLIDKLFTLEPLEILENLISYRMDDLTITLTHVLDGNR
FT                   PVLTLPHLMLSVVSKCNKATTVTFSSIASRKSSDHLVTAAKLEPKQVLAFIIEYVRSLE
FT                   NAAIEDFYNDFLVFIKEVSQNYSQYEQLSYQLLILIAIISEKIAHSQFGQQKRVRKEVS
FT                   DVFVKYLTSTLAEDIVAKNGVCEANYQDILFILARLQYIVNESPQGDRFGACVSTIVSH
FT                   CVSPLLKQGKLEVSSPGFMELLLAIAPVGAKVRNWKTLLNDIFTDNTKLSMCLKEDRWN
FT                   QVIYEWSQYPDNQDKLISDLLLAIGQKGNVITPTINPFQGWAESEVDLKCKQMVKLAYL
FT                   LLIAPPDTYLLYFKQLMSQLEDYLFSTDTPLKANCFILLRAVFLCIEQMHIADYWSMIS
FT                   HGLQTGLQAFYESLQIQEPIDAHLVLHMCKCLDLLLVLNIEDFSATNEWLFIIDTINCI
FT                   YKTDPFMALIDEISECKDYTGSHIADIELAAGDARLPLLCGIRRVDSHLALRTFFHNLS
FT                   YSHYETSYSLKPIDQAACCRDVAADILAAISTTN"
FT   CDS_pept        complement(351824..352483)
FT                   /codon_start=1
FT                   /gene_family="HOG000219949" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750141"
FT                   /locus_tag="AGL186C"
FT                   /orf_name="AGOS_AGL186C"
FT                   /product="AGL186Cp"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAS54305.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG268641"
FT                   /db_xref="HOGENOM:HBG646581"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004557"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="UniParc:UPI00002533A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q750X5"
FT                   /transl_table=1
FT                   /translation="MLATPEVKCDPERVYEPSEDSFLLLDCLEKERTWLRQRQPRASVV
FT                   CEVGCGSGVVTAFMMQHEMPQPMSVYLATDVSPWALATTAETVQSTGCRGALCAARTDL
FT                   VTGLADGQVDVLVFNPPYVPAEGVPQGPAAGEREERWLEVALEGGADGMEVTTRMLGAL
FT                   GRVLASSGVAYILFCARNRPEEVAAGMRAAGWVAELVERRRAGWEVLSVYRFYRNS"
FT   CDS_pept        join(352585..352733,352782..352863)
FT                   /codon_start=1
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928049"
FT                   /locus_tag="AGOS_AGL185W"
FT                   /product="AGL185Wp"
FT                   /protein_id="AAS54306.2"
FT                   /db_xref="HOGENOM:HBG348259"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI0001DB2B71"
FT                   /db_xref="UniProtKB/TrEMBL:Q750X4"
FT                   /transl_table=1
FT                   /translation="MLLKVKTLTGKEIQIDVAPEDKVYRIKELLEEQEGIPPSQQRLIF
FT                   QGKQIDDDQTVMSARLAHGMQLHLVLTLRGG"
FT   CDS_pept        353065..355116
FT                   /codon_start=1
FT                   /gene_family="HOG000207972" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622487"
FT                   /gene_name="CLF1"
FT                   /locus_tag="AGL184W"
FT                   /product="Pre-mRNA-splicing factor CLF1 "
FT                   /function="binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="cell cycle"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS54307.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG068482"
FT                   /db_xref="HOGENOM:HBG611628"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00002533AA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750X3"
FT                   /transl_table=1
FT                   /translation="MTEATKEDVTAAQLLTAPVGHDGARKGMDVDILDVEELRDWQRRK
FT                   RSEFEEALKRNRLDVRQWLRYAAFEYEQRDMRRARSVFERALAVAPGDVVVWLRYVDCE
FT                   LRARDVNHARNLLVRATALLPRVDKLWYKYVLMEESLGQVELVRGVYTKWCTLEPAAAA
FT                   WDAFVDFETRQGQVEHVREVYSRYVMVHPVAATWLKWVAFERKHGDAGTVRRVYSLACD
FT                   TLTAFAGADVHEVEQLVVSFAEWEATQQELERSRAVLSVAVSRWPESSTLKDATAQLEK
FT                   KFGGARAGESILFKRKREYEEQLLAHPLDYDAWWLYLDLLEESFPAELRAALAEATVKA
FT                   VPRSQEKDMQWRKYVNLWLRYLLFLETVLVDSDLTRSMYQKLVREVIPNTKFTFAKAWI
FT                   MYAEFEIRQEKLDKARKILGMSLGMCPKPKLFQYYIDLEIKLKEFDRVRRLHEKLLEFQ
FT                   PDVLSNWIEYAELEENLGDEDRARGIYEIGLTADGGLSQARQLQLMQRYIQFETDASEF
FT                   ERARALYSRYVALSGYDPNVWISCALYESSVPTAAQVASYAHDQPNSDGDDSDDAYEQE
FT                   FELTEENKEQTRAIFEKALRHYTSEKDDEGRILVLQAYKDYESIHGSAEARQKIASRQP
FT                   RKVTRKRTVDGIEKEYVAYEFPDDTVSTSSVASKFVSLAQRWKQQQAP"
FT   CDS_pept        complement(355256..356779)
FT                   /codon_start=1
FT                   /gene_family="HOG000197271" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750142"
FT                   /gene_name="BBP"
FT                   /locus_tag="AGL183C"
FT                   /product="Branchpoint-bridging protein "
FT                   /function="RNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS54308.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG059785"
FT                   /db_xref="HSSP:1K1G"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI0001DB2B72"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750X2"
FT                   /transl_table=1
FT                   /translation="MTRLVWFCMQVAYCLHGWDWDIMDRGRSSNSYDSLWGGKARDNPI
FT                   VSQLPLQYRIRSALTQEQQTAYQVMYRIQEITIKLRTNDLNPPTSRYRSLSPPPVYDSQ
FT                   GKRTNTREHRYRKKLEEERHRLVEIALKMIPHFIAPDDYRRPSKFQDKYYIPINDYPEI
FT                   NFVGLLLGPRGNTLKQLQQQSGCKIVIRGRGSVKEGKAATDLPKGAMNMNEPLHCVISA
FT                   DTEEKIPLGINAVESIIIKAITSPEGQNDLKRGQLRELAVLNGTLREDNRPCPLCGEQG
FT                   HKKWECSSNPSLSMTVICQRCNQPGHAARDCTSPLNEFGKRTSDGPEFRETKKLQQDAP
FT                   PPSGPVGSHPSAPGSGSANSGVAPASLHPPGTMAPPGALPPPGSLAAPGTLPPPAALPA
FT                   PAAPGTLPPPVALPAPATLPQAGVPPAPDASPAVKTAVPIEGPPAPPQTAPPLRQTAAT
FT                   ASSAGSSQSAQEEPENARNGVEKAAPGPPAAVLPPPPPPPPPPPPPPSS"
FT   CDS_pept        complement(356900..359311)
FT                   /codon_start=1
FT                   /gene_family="HOG000001120" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750143"
FT                   /locus_tag="AGOS_AGL182C"
FT                   /product="AGL182Cp"
FT                   /protein_id="AAS54309.2"
FT                   /db_xref="HOGENOM:HBG059786"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniParc:UPI0001DB2B73"
FT                   /db_xref="UniProtKB/TrEMBL:Q750X1"
FT                   /transl_table=1
FT                   /translation="MTYTFTYCKDESGSTTGTILSFDNCTLLIDPGWSGGCSYDECMAY
FT                   WKEWIPQVDIILLSQPIQECIGAYAALFFDYISHFNSRIQVYSTLPVANLGRVATVDLY
FT                   ASLGIIGPFDTNRIDIEDIDTAFDHLNTVKYSQLVDLKSRFDGLSLVAYSSGFAPGGTI
FT                   WCANTYSEKVLYAPRWNHTRDTILNSADLLDKGGKPSTALMRPSAVIMSAAHVGPSTPY
FT                   RKRSQKFKEVIKKALSANTSVILPSAIGGKFLELFVLVHDILHENKKSGLQADAPVLLL
FT                   SYSRGRTLTYARSMLEWLSSQLVKTWESRDNKSPFDLGNRLKIVNVNDLANYPGTKICF
FT                   ISQVETLINDALSKVCTKEKAMLVLTEKPTYYSHTIAILAKAYAKWERALNSNNLNAVE
FT                   GNPIAYSESLSLQFSKTKPLTGSDLEEFKERIEARRKERAELLSSFQSNDNPAGASAFT
FT                   AIEDDDDEEEDVLRPHGAGALSTKVEIPTDLIIQPNALPKHKMFPFQPGKVAHDDYGEL
FT                   VDFERFLPQSAPSSAKRGATNEEDEESYDPHDFEDIRRNGSGGKRRRREQDALQRQMNQ
FT                   DNLSYLDTLTKPQHRTSNTQKVVIRCTMAFVDLAGLVDERSMSIIWPALKPRKMVLLPS
FT                   DAASVSPVAQQLQKKGLDVIEPELNKSLVINTSLRSLDIFIDAEMDQMLNWQRISEVYT
FT                   VAHVVGRLTKEKDTKVSHRDKWVLKPLPNASARMQTTDSLRIGDVRLAELKRKLTAASH
FT                   VAEFRGEGTLVVDGRVIVRKISESETVVDGTPSDLFYKVKSAVADMLAKV"
FT   CDS_pept        complement(359604..361739)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750144"
FT                   /locus_tag="AGL181C"
FT                   /orf_name="AGOS_AGL181C"
FT                   /product="AGL181Cp"
FT                   /protein_id="AAS54310.1"
FT                   /db_xref="HOGENOM:HBG059787"
FT                   /db_xref="InterPro:IPR018558"
FT                   /db_xref="UniParc:UPI00002533AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q750X0"
FT                   /transl_table=1
FT                   /translation="MADFESVLGGCVDFLQERVFRELPENAVTVCMEREAVGGAEVVAG
FT                   EWGPLEGVTDKQIRRDMQMNAFRAVVVRVVQGGREDGGYLANLAAVLDCVHWMQAGEGA
FT                   AGDAAAWANLYFDLTKSAMQFLAVPDGFLAFWPYFESRLAWYLQGQDVVPVRSGENRLV
FT                   SGIRLPLSRLLYHCNELVRQLEAQSKLNTPRHYMVAHKLQWFMSQLLPASENCNYNKSG
FT                   ELMAQLPETLWAQRGGKLRDARSPSLFRDWTYFVEEFVLDPVGVMVSPLRERQGFEEYT
FT                   NDIIEFLLEKEQDYYRKVASAVQGPNLIRQDLHRGLIPTQASTNNFREPQDSRHSICAS
FT                   KAAFWKHYSEVYATLEDVMHPLPLELCMEDEHTLNHQLETVEVDTFRKLVLLQITITCN
FT                   IVDQILRDKAIYRTYVTRYKNVHSGRAIPNDPPTLFKFFSTAVGRIRDFYRVKDPQFFD
FT                   MLNELLHADESFLFAKAANMAPFKEIAWNTESLGHAPEPACSFKKFGFITMGNKRINDV
FT                   WKIESGLKRTKDLAKAREIDPTGVYSALQAVAATAGAATDADSRIVKQWQDLRALRFEY
FT                   LFELAKVDETTGINGLFDPTLIAASREDKDKRISALHEAYIKRHREDLEKAEMYFRQQS
FT                   EQSEDKGDELSRKRAASTPDSADDLPETKRSRLQSESVPAEHLESAETPDTAKKSEPQE
FT                   KEQESDDDDDDEAVPEC"
FT   CDS_pept        361953..363788
FT                   /codon_start=1
FT                   /gene_family="HOG000001119" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079277"
FT                   /locus_tag="AGL180W"
FT                   /orf_name="AGOS_AGL180W"
FT                   /product="AGL180Wp"
FT                   /protein_id="AAS54311.1"
FT                   /db_xref="HOGENOM:HBG059788"
FT                   /db_xref="HOGENOM:HBG202453"
FT                   /db_xref="InterPro:IPR018307"
FT                   /db_xref="UniParc:UPI00002533AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W9"
FT                   /transl_table=1
FT                   /translation="MSKQHGEVRPCIVFGVALVDFHHTRGPEVEHWHSDELQNCTWNNL
FT                   PFQALPDGSHSFEETFTYFTLLYDEGRHRGLNGIDEVEEDNVDECTTLFAISCSRQIKS
FT                   EELLKKGVEVTRSTVQKSLVVISRVPIFGQIKDKLSIVTNALFLQRDFSDTSIIYTLYD
FT                   NLRSMFNSAASIDESNLFVGLSLRKIIHDFRREFLVILKAMLLERKIIFYGSNVEELCS
FT                   LQFGFISLIPNLISNLQDCGSPLLNKYERQLTACDSFKSSDRRSVIRFLGFPLQIFASG
FT                   GLFSPYTPLQQLGDLTSPKTKWYVIGTSNNLLLEQKDRLADLLVNVDMKTVETISDDKL
FT                   FAQALQLSHHDRRWMDLLIQNIVNTWNEYDLSTPSTFQFEGSEDFVRWQFEEYLTGLLS
FT                   SAKLDGFLTKNAGLDMNMRTIPPEYLQESPIQTFNPAWVHLWKETNNYKLFYTFTDDRL
FT                   FDLFEPKHVFNGVDPLTAWQQKFVKSFKMLNRSETKLGGLEHGPSDPRASDARHTDHNS
FT                   VNDDRREVDNAKQSSTSWMSWKEYFNTRLKKKPDGDIGISASDNQAEPKISLGQVNASM
FT                   PSLPLKTAQRNSPQLDSSTPDIQSLPDEVMENPWR"
FT   CDS_pept        complement(363901..365745)
FT                   /codon_start=1
FT                   /gene_family="HOG000141765" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750145"
FT                   /locus_tag="AGL179C"
FT                   /orf_name="AGOS_AGL179C"
FT                   /product="AGL179Cp"
FT                   /protein_id="AAS54312.1"
FT                   /db_xref="HOGENOM:HBG059789"
FT                   /db_xref="HOGENOM:HBG104421"
FT                   /db_xref="InterPro:IPR014848"
FT                   /db_xref="UniParc:UPI00002533AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W8"
FT                   /transl_table=1
FT                   /translation="MAEAVFICTTVRGRWGQATRSGMRSHRVDTALVKENVRLEVVYER
FT                   NPSIAGESVGLVVRLRHLGSVQAQLQLSERLQELEQARNSRQFQKNGERGSLISTLWSA
FT                   LSQEERFREEDTERQIEDLERQKAFNQPVDLLSFYVQLVGQFWYSSEVLDMRKMQYTNK
FT                   LIAAQSQSSPPVGGGGSPTISSRNELSEPIAHFVDTDLHSDPASQSVKGHLPLVVVPQT
FT                   LLFGELSLKPGEVRVFHFRSAALPQNLPPSYTLGDTFKILYQLQVGGIIHCQASIDSVM
FT                   FSFPLNVCSYLNEEGCQYIHELGHDPVILPVGQVKERAHLQRRRSTQSTFTRHRSSIHS
FT                   IMPSFQDRFNILENSKKHFKELLNSEREDCTDEQLVEKLLTFQFGENYTQEINDDSELS
FT                   ESFEEAQYREPRHLPISQHRNNSLVDDKVSQKPLLHSVMDNLRKEYLVNRNGENICTIS
FT                   LSKLFYGVNDEIDLTILIPQKSNYKVTGVSTALELLELVNPDYLVNQKSKKAQRYPVYE
FT                   EHSICFEGCNDIPIKLLPSRSPTNIYPNQFRTNIFQLSWTLCFKFVIVEKTESDTLVEV
FT                   YKDRNGALLQAKEQLQGEKFVFRVPLVVLGSSKQLGGW"
FT   tRNA            join(complement(365843..365879),complement(365790..365825))
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        366137..368077
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750146"
FT                   /locus_tag="AGL178W"
FT                   /orf_name="AGOS_AGL178W"
FT                   /product="AGL178Wp"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="AAS54313.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="HOGENOM:HBG059790"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR005162"
FT                   /db_xref="UniParc:UPI00002533B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W7"
FT                   /transl_table=1
FT                   /translation="MHHSEIVFHSTVKPFTGDGDVHELPTFLLELDGRFEQGNIRTDPE
FT                   KISLLILHLGGRAARWFVKYRREYDVKMMTYEEVVGHLRNRFGQDSNAMVILARLMEVS
FT                   QKGTLAEYNDEFCSLLCKLPAEWVPPDHMLVALYWRGLAPRYSIAILQAEAMDLSDAMR
FT                   ITAMNSTLNKDELYGDSPRLQNPRDMGWSPVGLEEDTFEELPLWIQERYLDTVKDDLPA
FT                   YEFNNCSVEHAIEFKEHSEEPRARAYKLKCRLEKVAVQLIQDLLDKGFIVPSKSTCTSQ
FT                   LTLVKEKDATYHIAIDYRRINNITVKDPFPLPTVESLLARVGTAGHFTILNLHNGQFQI
FT                   PLREEDRYKTAFITTMGTFEFTVMPEGLLNGPNTFAKYMADVVGDLPFVFVYMGDILIF
FT                   SDTEEEHWTHIDAVLSRLSDRKLVSRRSDSHFNQEEFEYLGYVISRNSIEPARDRIESI
FT                   NHYPKPKCVKDAQRFLSMINYYRRFIPNFAMLVKPILQYACRKTIWWEDQEKAFDKVKR
FT                   LLRTGPVLVPYKEGASYRLTTEASKYGVAAVLEEVAGNDTIGVVGYFSKLLKGAQRHYP
FT                   EGELELLAIVEALRHFRYILQKIPFTLRADHINLALLQDQSGPVRRISAWFEELSEYDF
FT                   TLEYYLDQSAS"
FT   CDS_pept        complement(368220..368708)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079278"
FT                   /locus_tag="AGL177C"
FT                   /orf_name="AGOS_AGL177C"
FT                   /product="AGL177Cp"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="AAS54314.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG524497"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="HSSP:1A58"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI00002533B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W6"
FT                   /transl_table=1
FT                   /translation="MSKVFFDVEADGQPLGRIVFQLYNDVTPKTAENFRALCTGEKGFG
FT                   YAGCPFHRVIPDFMLQGGDFTHGTGVGGKSIYGGKFPDENFVKKHEKPGLLSMANAGPN
FT                   TNGSQFFITTVPCPWLNGKHVVFGEVSEGMDVVKKVESMGSSSGATRARIVISKSGEL"
FT   CDS_pept        369015..369479
FT                   /codon_start=1
FT                   /gene_family="HOG000001039" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079279"
FT                   /locus_tag="AGL176W"
FT                   /orf_name="AGOS_AGL176W"
FT                   /product="AGL176Wp"
FT                   /protein_id="AAS54315.1"
FT                   /db_xref="HOGENOM:HBG059791"
FT                   /db_xref="HOGENOM:HBG203180"
FT                   /db_xref="InterPro:IPR013239"
FT                   /db_xref="UniParc:UPI00002533B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W5"
FT                   /transl_table=1
FT                   /translation="MIRGGRRPIVSSLNQPVVLHVAGPPQHLDKDSALRFLSVFIEEKE
FT                   TAAVLGAAGGAVVTSGGVGSEGGVDTALSSALAQLKRMERDLKGLPPTILSGADEEERE
FT                   EEPEAVVGETVSRSATGGTKRRFADEEAEKAEEAATAASDDEEAPKKARK"
FT   CDS_pept        369511..370725
FT                   /codon_start=1
FT                   /gene_family="HOG000013358" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750147"
FT                   /locus_tag="AGL175W"
FT                   /orf_name="AGOS_AGL175W"
FT                   /product="AGL175Wp"
FT                   /function="NAD+ or NADH binding"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="aspartate-semialdehyde dehydrogenase activity "
FT                   /function="protein dimerization activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54316.1"
FT                   /db_xref="GO:0004073"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG000063"
FT                   /db_xref="HOGENOM:HBG518238"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00002533B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W4"
FT                   /transl_table=1
FT                   /translation="MQDESEAGGRALARRRGSCGGQKKSPSTISASSSRPEDKMAGKKI
FT                   AGVLGATGSVGQRFILLLADHPDFELKVLGASPRSAGKRYADAVNWKQTELMPAFAEDI
FT                   VVSECKAEAFCGCDVVFSGLDADYAGPIEREFADAGLAVVSNAKNHRREDDVPLVVPIA
FT                   NSEHLEMVQQKLESAAAEGRARPGFIVCISNCSTAGLVAPLKPLVDAFGPIDALSVTTM
FT                   QAISGAGFSPGVPGIDILDNVIPYIGGEEDKIEWEAKKILAPLNASKTSVELLSDEELR
FT                   VSAQCNRVAVSDGHTECVSLRFRNRPAPSVEAVKKCLREYVCEATHLGCHSAPKQAIHV
FT                   LEQQDRPQPRLDRLRDAGYGVSVGRVREDPVLDLKMVVLSHNTIIGAAGAGILIAELLL
FT                   AQQMI"
FT   CDS_pept        370788..371741
FT                   /codon_start=1
FT                   /gene_family="HOG000001124" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775032"
FT                   /locus_tag="AGL174W"
FT                   /orf_name="AGOS_AGL174W"
FT                   /product="AGL174Wp"
FT                   /protein_id="AAS54317.1"
FT                   /db_xref="HOGENOM:HBG059792"
FT                   /db_xref="HOGENOM:HBG202464"
FT                   /db_xref="UniParc:UPI00002533B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W3"
FT                   /transl_table=1
FT                   /translation="MLQLCPLDEDTLYTHVYERYVELDRHAETLAQDLGIHASDAETLV
FT                   VDIAPAQPTKSSDTYSLTVSQSLASLRSSTVNNNSTTGYVLWSGTPFFLCWLLYAPSAA
FT                   PLRDGGRVPVTDSAAQFLQLPPLFSAPARPVCVVELGSGAAGVAAIVLANYVDRYLVSD
FT                   QKAILKPLRANLLANISEVSRRTVCSKQTPELSSNRRTPARCELELIALDWERIATVPA
FT                   ALRPTDAAHVHVLALDVVYNDFLIPPLLTAIKRLLRWYADEHAVKATAYVLVHLRAQDI
FT                   LQTFLEHAIIDLRLRCYYMDEERLRSSRFALYYVTL"
FT   CDS_pept        371888..376012
FT                   /codon_start=1
FT                   /gene_family="HOG000065955" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079280"
FT                   /locus_tag="AGL173W"
FT                   /orf_name="AGOS_AGL173W"
FT                   /product="AGL173Wp"
FT                   /protein_id="AAS54318.1"
FT                   /db_xref="HOGENOM:HBG059793"
FT                   /db_xref="HOGENOM:HBG203181"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="InterPro:IPR017173"
FT                   /db_xref="UniParc:UPI00002533B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W2"
FT                   /transl_table=1
FT                   /translation="MASVGSLNPLANNGFKKKALKGQNKGIKHKPQKVKVHDKERAEVQ
FT                   SWTGYPQRDDRQHRKMGSARLSGAQDDAVGAVAERFSPETMGFQRFAHKKRETPRYMLQ
FT                   QTPLLWPQQFAQDPWDASNQKKMLSLEGSIADVTELWETLKKIRDVERKIMEQKGLVDR
FT                   ADFAKDLNDAIVFQGTCQDMCPIFERARRSVENNVVRYEKENPTDKRISRFRALKVFAR
FT                   PAAAAAPPLPSDVRPPHVLVKTLDYIVAHILQLLPDCESFLWDRMRSIRQDFTYQNYCG
FT                   PEAIDCNERIVRIHLLILHVMARSEADYSRQQELEQLHKALITLTEIYDEVRAHGGSCP
FT                   NEAEFRAYALLSRIRDPEYDKMIQELPGHIFNDDLVQLAICFRRVISNSSFIERGHIRT
FT                   ENCLNLYQRFFQLLSSDRVPFLMSSFLEVYVNEVRFFAMKALSLTLSKKHKSIPFQYFL
FT                   DNLLFNSVDELLNFCKYYSIDTDEQGVSLKTLTHHSHQIPETKPLRQCYLQCIEEKLQR
FT                   TTYEALINCGKPNKGYLPEDPGESLNSNFTSDMAQESTSLSEDDAALGSNDSNLPTYSE
FT                   SIIEQGSSLHGEHQDISKTFNFDSGDYKTTEPTTQSRAGSEVKSSMQFKPQQQSDLQST
FT                   KQFTAPFMSSVGSTTSPHILEETKTKKDVPFESSHRKPFAGNSQLKEENTFHFNQTALK
FT                   LGAQTEASAQDEARDSGSKAIEGNELRNAVATELTDELIRTAVASHVRSEIEAVNKKTA
FT                   KKKLMISILSDELFNAFIHETLYFVFLETRAESFYTKRRLKYHLTKWFQKYNSRKSDRV
FT                   LRQKRKEELQEVSRQLGIPFLKRPRTSESVNSSGSNILGNSSFMKTPRIWVDTPVATET
FT                   NHFNTPVRKNAALWQSIDLRKDYCDRIQINKDLAEYSDLLRKCDVKKDPIGLFVYSKNW
FT                   NCISGSWLLGKFSLNENPSISVSGSKINMSVTKLCNDYAPSDFGNLHLLIFNTGVTDSN
FT                   IFDLEMKMKQDGGKLIELVHGIALNTNYKFNILLIFWASADNPWSNHNISKYLKLRTIS
FT                   RLFGSVIQNIDIAHMNDGRPDETLFRSLTNVASNFKLELTERGEYNMSIMRRNLAGEGG
FT                   AALMPFPGGHNDIDAKLHHMLQLESQKHELYRNKKSLYAHLQNHVRASPKAKTTKLPVL
FT                   LSESNKNKFKTPLAFLPHRRSFSESPGSSLPSASSHLVAKVRHAPPPISTYGTPSHVRR
FT                   PPQATNKLVFQTPSAAILGGSAGAPVTGTANTSGLSNITFAPPLLTPVTQMVLQSPPLQ
FT                   EQRNHPRPRTYALQARAESSFCRSDEVSAPPSSAALREAPTITRRDSRPGVAPPSYNDQ
FT                   PSSPIERNDLLSDNILELKGLIASVKSKLKH"
FT   CDS_pept        join(376329..376352,376508..379180)
FT                   /codon_start=1
FT                   /gene_family="HOG000168542" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079281"
FT                   /locus_tag="AGOS_AGL172W"
FT                   /product="AGL172Wp"
FT                   /function="sodium:hydrogen antiporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54319.2"
FT                   /db_xref="GO:0015385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059794"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR013928"
FT                   /db_xref="UniParc:UPI0001DB2B74"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W1"
FT                   /transl_table=1
FT                   /translation="MAVWDHLDVSKAHVAYACVGVFSCIFSLVSLFVKERLYIGESTVA
FT                   VIFGLIVGPQCLKWFDPTAWGNTDSITLEISRVVLCLQIFAVAVELPKKYMLKHWMSVT
FT                   MLLIPVMTTGWLIIGLFVWLLIPGLNFSSSLLISACITATDPILAQSVVSGKFAERVPG
FT                   HLRNLLSAESGCNDGMAFPFIYLALNLVIYPGNGREIVKDWICVTILYECVFGCLLGVV
FT                   IGYAGRRAIRFAEDKKIIDRESFLAFYVVLALMCAGFGSILGVDDLLVSFAAGAAFAWD
FT                   GWFAKKTEESKVSTVIDLLLNLAYFVYFGAIIPWKQFNDPLIGTKVWRLILLAIAVITL
FT                   RRIPAVLFFKSMIPDIKSWREALFVGHFGPIGVGAIFAAILARAELEAHATGEDTPLKE
FT                   IPAQGTEHWQLIACVWPIVCFLIVTSIIVHGSSVAVITLGRHLNAITLTKSFTTHTTNG
FT                   NNRSSSWMQRLPGLDKSGRSFSLHRIDTLARAESLTRVSTVETSGVPAKRAGGMQKKRG
FT                   RKFGKNRAKDLFRTASRRADTTPFEDPALKEERLARERQAQAAAFALSREDRTDYEEKG
FT                   TTEGYGESPSTQQSLGYSSNVTDLPQDTATLEEADLSSDDLSHQMDERVPFPSSSQGSS
FT                   RLAEHYNEDHDPTVAYLEGNSVILENKHGEIVGHSKRSKPAKDIEEGTQNDELSRRSSE
FT                   VMNTLKKVISPAFLKKPIIDVDRGIKYHAYKVNDILIIENEDGEVLRRYRINTHKENGR
FT                   PRTKPRPRTKTRSSSVVTKALSVVGLGRSKNSSPSSEDEAEPSDDLNQRPIQARRLTPV
FT                   PSAYPPVVTGDVTGYTDIEDEDEDEDESYRSTDLSDQAHSDSDAPAFEDEETEVERARR
FT                   LTALGAFSAPRCDDDEEEVPRLTASKK"
FT   CDS_pept        379516..382071
FT                   /codon_start=1
FT                   /gene_family="HOG000065954" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750148"
FT                   /locus_tag="AGOS_AGL171W"
FT                   /product="AGL171Wp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54320.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG059795"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001DB2B75"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W0"
FT                   /transl_table=1
FT                   /translation="MTGPRIGLFPEKNNYETTHGSSGLISTNNTDKDEEEDAWRTGESD
FT                   LHATGVESGSAAAERTSQVEMRILEDILMEDMVCGYEEFQERIKNDRFYLTKRYNTKVG
FT                   LNELNTDADARRDDIDFLTYSQKVASEYSFREKAEKLLKSINKQPIRVLTGEELHENYA
FT                   RGEEELVPVRPGTFGLRHFFKSSVKGRMLRQPTESDLVNTNGGISASTQVIDLEKNGQR
FT                   AIDESSNKSNIYESHRKELLPNGIHHPTSRGCLRNALIYLINNPLCESLRKPDRYHIQR
FT                   KLKVRHLQMIAIGASIGVGLFLTSGNAFAVAGPFGTLLGFSICGTVCLATMLSFTELST
FT                   LIPISSGFSGLASRFVEDAFGFALGWSYWLSFTVTFPSQIIASIFMLSYYEKVVATRIS
FT                   TAGLVTVFWLYATAVNLLDVRLFAEVNYISAFVKVLITILAMILMLFLNVRGVDGKSGA
FT                   IGFRFWNSSSSETELTYGLFRPTFDLHDTGQGSLNGIGGARGRFLAIILVVLISTYSFN
FT                   GVEMAFVASGEAINPRKTLPSATKRAFTKIVTLYILSITFVGLNMYSGDPRLLRYGVDV
FT                   PTVVYRNTPGLQWQRDYSCMEQDIMQLHNMENGNRSPWILALQSFGLCSLASAFNGVLV
FT                   FFGISAASSSLFASSRTLYSMATQQKAPKLFQTCTSYGVPWIAILFSGSFGIIAYISVA
FT                   ESSMANFQTLSSIASGTNAIIWLGLNVSFLRFYYALKRRPDIISRDDPTYPYRSPMQPF
FT                   LSFYGLIGSGLVVIFMGFTNFLHGFWSTRSFLSSYGGLIFFITSYFAYKLFGASKIQSL
FT                   EQLDMDTGRREMDRMIWDEHRQYSGSLWERFKYVITWLL"
FT   CDS_pept        382228..383364
FT                   /codon_start=1
FT                   /gene_family="HOG000246800" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079282"
FT                   /locus_tag="AGL170W"
FT                   /orf_name="AGOS_AGL170W"
FT                   /product="AGL170Wp"
FT                   /function="binding"
FT                   /protein_id="AAS54321.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059796"
FT                   /db_xref="HOGENOM:HBG395434"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00002533B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q750V9"
FT                   /transl_table=1
FT                   /translation="MEDAIRQARDALSVNDPKSALKILKPYKKLLRKEETEVVGLLEAY
FT                   SDAYMEDGQLDKAYPLLEQACALDPEGKIGGCGKFFTLGQVVGGQHGLNTLMIGIDNMV
FT                   NKAGAALQQADVDKVIGGLLTMIEIWMTDLCMEPDAEEQCEQLISKAMVISNENSPEAW
FT                   SMLGSIRISQTRFAEAAEAFQKSWELFQQKKSQLEEALKAGLNQNQLRSHAEYVELIQP
FT                   LLALGKMCIELGLYELALQTIGTVKDIDEDNMEGYYLEGFTNYMVAKLELFKANNPAAE
FT                   ITTENIYEVNEHFKDLALDLNEAAIQDYVQDARVALSFVLKLGENADADDEVARELVQG
FT                   TVDLLGELGGPVEISDLIKLKRGEEVLEEDEAVLESLE"
FT   CDS_pept        complement(383587..384345)
FT                   /codon_start=1
FT                   /gene_family="HOG000065953" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079283"
FT                   /locus_tag="AGOS_AGL169C"
FT                   /product="AGL169Cp"
FT                   /protein_id="AAS54322.2"
FT                   /db_xref="HOGENOM:HBG059797"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI0001DB2B76"
FT                   /db_xref="UniProtKB/TrEMBL:Q750V8"
FT                   /transl_table=1
FT                   /translation="MAKREDLSTENISSASSDEEFNTVGYISIKDYAYDESNPLHYGYF
FT                   DESSCAGAGLPHDDSDEGDEYGGGEGGYYSYYYYGRGLGPRGRSEEEDAVEKRQSIVMP
FT                   GEYVVNKHAVALYDFVPENDNELELQEGSIVYISYKHGQGWLVAEDSARTRTGLVPEEY
FT                   VSILEDEDEPGVVAGGRADDEQARPFYLTQMLTQSMKAAAARQSAAEDEWEDIEGDEDE
FT                   AESAQGDEAGGAGGSEVDTVRQSMSDKLAL"
FT   CDS_pept        384563..385117
FT                   /codon_start=1
FT                   /gene_family="HOG000065952" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079284"
FT                   /gene_name="CWC15"
FT                   /locus_tag="AGL168W"
FT                   /product="Pre-mRNA-splicing factor CWC15 "
FT                   /function="RNA binding"
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS54323.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="HOGENOM:HBG124529"
FT                   /db_xref="InterPro:IPR006973"
FT                   /db_xref="UniParc:UPI00002533BA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750V7"
FT                   /transl_table=1
FT                   /translation="MTTSHRPQLEARSGTKSGVAGEYVPTGVKHARLLPGHRTVKRRRE
FT                   GGATAEDEERERAGAETRTVDCNEGTDELAGEGRSAGSGDGDEASSAEDSSDADDEDDV
FT                   DNPEELRRELEALRASKTGAKTGAKTGAKTGEKGAGGGGWRAGAVFGRQKRRREQAEGR
FT                   AYRNDVTQSEYHQDFLRRLTK"
FT   CDS_pept        complement(385140..387323)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622488"
FT                   /locus_tag="AGOS_AGL167C"
FT                   /product="AGL167Cp"
FT                   /protein_id="AAS54324.2"
FT                   /db_xref="HOGENOM:HBG059798"
FT                   /db_xref="UniParc:UPI0001DB2B8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q750V6"
FT                   /transl_table=1
FT                   /translation="MLLFRKCTRALPSHYVPLVQLQYLRSRRYYSGSNGIIHPRLPSDD
FT                   TDTTLDTGTDTSSEVKDSSGRLEHNSVLPNHHFIVLDPEQTGLLPKRGETGRSWRKDRE
FT                   HGSRRNLKTRDDLSEKPAKKQDKEKVTARDLLDALEWSGEKMLREEKRSTSDEETIGVI
FT                   NNMRPDQAALQMSPERFEQLRKALAKSFSYTQLRLYASKLYGLKKTNETKKAFVTKVMQ
FT                   ECWKCKVDKTISKKQDLIIKRTIDLSQKDMYLLLMTDGGRILQNMARTGASIAAAFTEN
FT                   KLIIHASKSLATYIEASIASILNSIQSSRLSLYEFAKEHTAVQDSRSPQYSPEQLLAMV
FT                   CRECSVHQEKYPEVPGLVALSALSQEKLAAARQLLLWAFDYKPEVTTDTIFCGLEDNQI
FT                   TYAKYPVSDPEWFNWLERKTKWFRLQQVEHRLSPDMSGAAPAPVPVVPENVLNQVYDFC
FT                   MRQSTGNVAEIQNHAAEAKVLRVSLGQVLTDESGQRQMFQPQAPYMNQKLLQLPLYYPL
FT                   ESEHDYYSVDQHDYFLQLRYAPVLSATGFRYNLPPLELWFTLGENNRVEPHTVRCINRL
FT                   AERSVMLQLPGSPVDCRVTLERVSEMVPPGDDASHEWLLTHQPALQQYLDRVTPTLDRH
FT                   LRARMQNVALPDPIHLNVALPGSPPSPIPYRFVSMAHHRVLSLRYLDKYRVQLSTVSGG
FT                   PAGGKHSELDVLPDAVPDRAAFAQLIADVSKLL"
FT   CDS_pept        387605..389128
FT                   /codon_start=1
FT                   /gene_family="HOG000184682" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622489"
FT                   /locus_tag="AGOS_AGL166W"
FT                   /product="AGL166Wp"
FT                   /protein_id="AAS54325.2"
FT                   /db_xref="HOGENOM:HBG059799"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI0001DB2B8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q750V5"
FT                   /transl_table=1
FT                   /translation="MAKRKAADERLRSLKRRNCIPLERYSEIFNQEVQRVFDPHWHKNE
FT                   FRDSVVHLSSKVRYLQDTDEEHDSDARSDSGAESDSGDDSGDVRGQLLSSGELGTFWSA
FT                   REKQVFFHWLARCSIHRLDEWAPRLPDKSKYEILAYYHVLKSNLQDLKRMNTKKRGGIL
FT                   TKRALPIAYEMDPFFVQLEEEYSLLIHSETENVVKLEDEADLEDGVVNWENWYKRWDPL
FT                   YSHHRLGEYQPAARQPLPFSRQSELLVERLVRAYTRRLLFHTVVPLLELKHVPRASLLH
FT                   EDLRTEIAQRAAAPRSRTPLVEAHVWDSGDIEIRTGNLEFPHLVAPADVWRALLALRAA
FT                   GHLAPTLPETVVSTVTKFDLHHPAGKLFKNRAVPAALVVPMLLHKSAPYALVPAIPPPC
FT                   PPLAHSLEKKLHLLLGKRALPPHGFIDDDPYDSIDNPIYAQLFSHDTAATDAVDIQRSR
FT                   LYQHAVITHMHGADNDSPFFRFLPSPVLAVPPPTHPVPSAVVDLYQYCD"
FT   CDS_pept        389418..390809
FT                   /codon_start=1
FT                   /gene_family="HOG000248390" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775033"
FT                   /locus_tag="AGL165W"
FT                   /orf_name="AGOS_AGL165W"
FT                   /product="AGL165Wp"
FT                   /function="proline dehydrogenase activity"
FT                   /biological_process="glutamate biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline catabolic process "
FT                   /protein_id="AAS54326.1"
FT                   /db_xref="GO:0004657"
FT                   /db_xref="GO:0006537"
FT                   /db_xref="GO:0006562"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059800"
FT                   /db_xref="HOGENOM:HBG397339"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="UniParc:UPI00002533BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q750V4"
FT                   /transl_table=1
FT                   /translation="MNSRLGQVLRQAVRVQTGLRGPARSMRGYVSQTQTKQNTVAVVAG
FT                   AAERFVAPAADAHLKTLSQRELVALGVIGCVTTNARLLKLVTQAFPYVPTPVAKLLISA
FT                   LYCGGDTMAEVRETGRALARRGVGNMMLSLTVEDSEGTKNIDIDYIVEETVRSLHGVLL
FT                   PHMEEQLARAADVNSVPPGYLALKPSALVSDPANTLLHFADPAWREKRDALVANFSRIV
FT                   GEVYKLNQEMLARYPGRKSPFFVATIDAEKYEVQCAGVYELQRLMFAKYNPVSSPIVSC
FT                   IGTWQLYLRDAAADLVAQAERAEREGYKLGLKLVRGAYLHSEPNRDVIHPTKEATDEHY
FT                   NEVMAKVIQDLLANGEHSVFGHLVVASHNYQSQMLATMLLQAHGESVGKSNVVLGQLLG
FT                   MADNVTYDLIHNHGARNIIKYVPWGPPKETKDYMHRRLQENGDAVRADNGWPLVKAVCR
FT                   ALFYR"
FT   CDS_pept        391101..393161
FT                   /codon_start=1
FT                   /gene_family="HOG000247962" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750149"
FT                   /locus_tag="AGL164W"
FT                   /orf_name="AGOS_AGL164W"
FT                   /product="AGL164Wp"
FT                   /protein_id="AAS54327.1"
FT                   /db_xref="HOGENOM:HBG034749"
FT                   /db_xref="HOGENOM:HBG396212"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00002533BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q750V3"
FT                   /transl_table=1
FT                   /translation="MKFVALVSGGKDSCYNILHCMKNGHELVAFANLHPKEENVQELDS
FT                   FMFQTVGHEIVSYYGKCTGLPVFRQAIARDTSKNVALNYFATAGDEVEDLYLLLKRVKD
FT                   SNLGVEAVSVGAILSSYQRTRVEDVCSRLGLTALSYLWERDQEDLMREMCSMSKKPGDA
FT                   PVAKLDARIIKVAAIGLNQNHLGLSLPEIFPTLLSLNRRYGVHICGEGGEFETMVLDAP
FT                   FFTKGYLEIVGLRTTVERGSGVCTAALDIQFVARHLEGTTGADLANLPVPKLENKWEEI
FT                   YHDLEPTKFGDIPSSIHSSAETGVSLSENTVGGLLYVSNIQPRCRGPLEKQARDVFDQL
FT                   NESLTRHGVVKAQVLSSVLLLADMGTFAEINTAYNGYFSIQEIGPLPPSRACIESKSLA
FT                   PGIGLQLSVVIQHDIKIVPCANLLLNPGKGGLHVQSRSYWCPCNIGPYSQATWDTTDRN
FT                   KVAYISGQIALLPNTMEMCNTLTGTSGNPYQEGLSQAILALRHFNTLKKSIETCHQLFM
FT                   CCYIAEDFMAPIASSVWSSYCSSNPDNTLGTLLIVRVSALPRSALCEWGGSACQRLLVE
FT                   DDDDDYSDELPEQCSDTLPSMALNYEAFLDVNVMTVRAKNQVRHYLTGFLDTQGDVKKV
FT                   LDSCVQCQITLYYVPSPEVTLPTASNVEYVPVNAIYDSTARIRNYALQIKY"
FT   CDS_pept        393324..394532
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750150"
FT                   /locus_tag="AGL163W"
FT                   /orf_name="AGOS_AGL163W"
FT                   /product="AGL163Wp"
FT                   /protein_id="AAS54328.1"
FT                   /db_xref="HOGENOM:HBG059801"
FT                   /db_xref="UniParc:UPI00002533BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q750V2"
FT                   /transl_table=1
FT                   /translation="MGADERFDNLLSRLDQVGFDFEQEFDKLALLRQKAFDALSDHDTR
FT                   KKRLQIELRLRQKYRRYRQNAAYFAKGRFDKVDMDYLNSVIMSNDQLRAACHIHGIHTA
FT                   QKGSSASVEDYACIANLREDKKGVGSAILEPTERYEPTQPSDDAMSADNTLLYEKKMGK
FT                   KSPCPLNGASTVESTAAAGLQLPPASLPAKPRSPALSLKRKLCPSSDNSGGGKAKRRVN
FT                   TSHSTIQSDMSDAKMPRIPDNQLELPDYHHLPSSSFHYNLGHNSLPANFHFPDVNDPLL
FT                   RNMQFSNPQMNFHSYSNMNLVPVLVPADALAQVKSMGQPSNVVQRMTENSNQHVESIAA
FT                   AEKNPQTSGPSSGNRHPETSKKNTKRSKAHALPHGTSIEKLLKPPAPKALKKMQKMARK
FT                   YNL"
FT   CDS_pept        join(complement(396760..396790),complement(394607..396690))
FT                   /codon_start=1
FT                   /gene_family="HOG000065951" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775034"
FT                   /locus_tag="AGL162C"
FT                   /orf_name="AGOS_AGL162C"
FT                   /product="AGL162Cp"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /protein_id="AAS54329.1"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG028551"
FT                   /db_xref="HOGENOM:HBG397714"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniParc:UPI00002533C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q750V1"
FT                   /transl_table=1
FT                   /translation="MSDLIELQKNYVVSFLNSIETEHGIKFLVVDRVVDRLLECLFAER
FT                   SELLKYVTAVDIIDSETRSGQASVDVVYMVSPTRYNINCIDADFSNVPPKYRRHHIRFL
FT                   PGLDQGLAQYLHSRRNLSQFMVSLAEIKCGFYPREQQYFETIGIDQPLQVFFNAQCTDL
FT                   IERNIRRTVHSLLNICIVTGEYPIVRYSEPNPEVSALSRPTLLAKKLAVEFQYELDNYA
FT                   RQHEDFPPANSRPRSIFIIASRALDLFSPLVHDFTYQSMAYDLVNEVNMTTDVFSYEAE
FT                   NEMGEREQKTSKLADLVDPDWLELKHQHIADASEYLNSKINEMIAKNPLLVDRSKVKTT
FT                   TDLLSVVAHLKDFDEERRRITVHKTLIDQCLETSKQRNLVEASEVEQALCSFGLDIDGN
FT                   KVKNFTDEFVNMLASTNASTTDKVRYIIEYALFRGGLIEPDLVKLLAFIGIEPNHKFYK
FT                   HFMQLFKNFDFMGFQLIKPHVKDPPFKKEWAHSTLTNDPNIYQTSRFVPAVGNALSSVI
FT                   TNPLLLSEDSFPYVKDKPIELLDPGLQSSLQATTSVASLKNPRHKAAWAKTNSQSKIPK
FT                   QRFFYYILGGITHVELKAASTQSHMKNKDVFIGSDSILTPLQFMQGVEKLSESRDHLRL
FT                   KDDSTEPVEPPSFLFRRAPKSSPVNQPQRHHLPEQPRPQTSAVCSAPTPLEDAKEKDKR
FT                   RHKFTKFLRK"
FT   CDS_pept        complement(397145..399457)
FT                   /codon_start=1
FT                   /gene_family="HOG000211468" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775035"
FT                   /locus_tag="AGL161C"
FT                   /orf_name="AGOS_AGL161C"
FT                   /product="AGL161Cp"
FT                   /function="endo-1,3(4)-beta-glucanase activity "
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="AAS54330.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="GO:0033903"
FT                   /db_xref="HOGENOM:HBG059774"
FT                   /db_xref="HOGENOM:HBG398584"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="UniParc:UPI00002533C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q750V0"
FT                   /transl_table=1
FT                   /translation="MWHWIPANTGHYSRPAIPPPYVRYDMGNVTAPHRRNEYVPPIPPR
FT                   NYATPPPLPPRPRDDFTNADTSTAKNDMSNLFSAPLSTDAPLSEFKRVQHEVKLLPGVH
FT                   KDDKPVPTNKFYANMLVADQTLPIWTQPYSLWLDQEKSYVGMAISQIRADQRVFDTHNK
FT                   PPRFFFAPRGIRSFVFSATEFNSSNAASLDMRDLKHLSAQARLAKSDHEYIQFPLVQGM
FT                   GFVTAIYYNLVPKLYSPVGFRSIQGQTSPRSGINKYRVQLHDNVTWTLYVSVPQGQSLT
FT                   LSLQNGAIVGDKGVNGCVFQIVSSTEDAIDRAAGCYPVDGSLTGSIDGSNGTYTLTYST
FT                   RGSSNGGTTLMYALPHHVEYATGKTTGKINSTLASTVLGNMQGYLTNVIEAKVPIASGL
FT                   SFDPFTTIPDKMGPQYSDSVKQKIREAADKEVNNDVSRESDLDSMYYSGKILLKYAWIL
FT                   YVCQYILHDGDKVSKLMPKLKDAIQRFISNRQQLPLNYDTTWNGIISSGTIYQDFGNPY
FT                   YNDHHFHYGYHVAAAAILAKVDADAGDGKWLAANKSWVENLIRDYANPHEDDKYFPVFR
FT                   SFDWFTGHSWAKGVFESGDGKDQESSSEDVNAAYALKLWGQVTNNSKLAGIGDLMIGIL
FT                   RTSLNHYFLYLDDNRTMPAAFIKNKVSGILFDNKVDHATYFGAEPQYIHMIHAIPIIPA
FT                   SSFVRSPKFVREEWDQKLSSIVDEVDDGWKGLLMLNLALTDPQASYKFFSDNSFQDKYL
FT                   DNGQSRTWSLAYSGAFL"
FT   CDS_pept        399817..400392
FT                   /codon_start=1
FT                   /gene_family="HOG000066119" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750151"
FT                   /locus_tag="AGL160W"
FT                   /orf_name="AGOS_AGL160W"
FT                   /product="AGL160Wp"
FT                   /protein_id="AAS54331.1"
FT                   /db_xref="HOGENOM:HBG059802"
FT                   /db_xref="UniParc:UPI00002533C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q750U9"
FT                   /transl_table=1
FT                   /translation="MSDKALRAGEDGTEIRNALRSLQQELRVIHILYHRNKNQHRVATW
FT                   WKQLNSLKRSVSQVVTVTSKPVRTEADLEALAGLLRRFAVRQAPAMYYEFNGVIALGQF
FT                   VTLGVVLVAALARVWALYGQLREALGLLPVRAAQAERECDVAPTEEIGEEVAVAVAASP
FT                   PGAAALPGGKRIKKKSKSKRSAIDDIFG"
FT   CDS_pept        400726..402078
FT                   /codon_start=1
FT                   /gene_family="HOG000111149" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622490"
FT                   /gene_name="TRM82"
FT                   /locus_tag="AGL159W"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase subunit
FT                   TRM82"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54332.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG059803"
FT                   /db_xref="HOGENOM:HBG397716"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="UniParc:UPI00002533C3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750U8"
FT                   /transl_table=1
FT                   /translation="MIHPIQFTLTNHDGTLLFCVIKNTIFAYKTNGEDGHLDLAGEWVD
FT                   DYDSAELIKAKVEKEQQRRLAENAAKKLKTNEGEAIERPGNQRRVPLPGKDPKVPVPGP
FT                   GAPPVYQYIRCLQLSHDEKMLVACTDSDKAAVFFRIELHKDNCLTLFKRQPFPKRPNAV
FT                   TFADDDAKLLLADKFGDVYAVDSVGEPEKKDPEPILGHVSMLTDIALVTDTKKSYVITA
FT                   DRDEHIKISHYPQSFVIDKWLFGHKEFVSSLCVPEWQSSMLFSAGGDSFIATWDWQKGL
FT                   LMSSFDYSTIVEPHLTDAHLPPARFLANDGSDRREASISKLLTFKDLPYLVAVPEMTKI
FT                   VLLLQWDATSGELILSQTLALPLNVVSATVTSANHKLILSLDNREQPGKNFVKIFTLEN
FT                   GKFEEEQAASSSVDEAIVRNLSERPEVQTTVDDIYPLYHVSQLRKRGEHYS"
FT   CDS_pept        402276..402605
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059070"
FT                   /locus_tag="AGOS_AGL159WA"
FT                   /product="AGL159W-Ap"
FT                   /protein_id="ADJ41735.1"
FT                   /db_xref="UniParc:UPI0001DB2B90"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGH0"
FT                   /transl_table=1
FT                   /translation="MDQKHRELSPIGISSTPIKYSFESSGPPTQDSISKPLNFTHKEQF
FT                   SEGDEPDIYNALDDANRLQYEIDLLFRRYVDANKEIRADIDDFCQISGERRSSRTSFAA
FT                   NDSSF"
FT   CDS_pept        complement(402847..405426)
FT                   /codon_start=1
FT                   /gene_family="HOG000065950" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079285"
FT                   /locus_tag="AGL158C"
FT                   /orf_name="AGOS_AGL158C"
FT                   /product="AGL158Cp"
FT                   /protein_id="AAS54333.1"
FT                   /db_xref="HOGENOM:HBG059804"
FT                   /db_xref="HOGENOM:HBG203183"
FT                   /db_xref="UniParc:UPI00002533C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q750U7"
FT                   /transl_table=1
FT                   /translation="MVEMLNPFAFDNSKLLEVYQLKTLNPRSTWEKETTRNDSTENSEA
FT                   SRKQRSLSDIPDPLQPSRSMEGLLEQLNIPPEERHRYYINCNSFNTKLFLRNIHKDDTF
FT                   KELADALESLNVSMTEEGNDLKNLVQTNFVRYVRCKSNLDQIYDQFNKRMSGNENFLGI
FT                   DHLDESVNNMVRGTTMKVIPLVDQASKVKHYKSAIRYVQDNKELFDLPKTLIESVNKKD
FT                   YGTLMSEYKNGCKLYAQTKQNHVVTKIWKEVETIIDQYRNHTWEQLLESVENENQEYFL
FT                   PLISKLVDLKVEENPVNLWMTNRLKRFHTQLRTLSQTMMEKIVNAQHDILKNNIAENID
FT                   LTFYLNMETYSEDMKNVASRKYNLTDSPIVIEMWLLILKYITTISDLCTKFVEFWEHVE
FT                   RFMNNSYQTTLLNEKRKENIIGLGDQTQEEATMLQLSKTEIAVTREGGQNFVKLLNRAL
FT                   SDLFMSTQQSLGKEQAKVPEGAYPSHFGFIPPRCNSLSCLRYLPKIVDPILKFTTELAQ
FT                   LTITDDCIRILRTLDEMILDRCVGAISSTKLRDMSNSHELEDWEVFQVVGDEKYCITQY
FT                   PEIVLCFNQYSIRTMRDILFSYEKLPVLNGISIVSYPSDQLVSVIELQQITSLESVLES
FT                   ILKNAAKDKDNPRNSHTILTLTNLQHIKAHTFPEILQYFDEAFESNLNAKKLEIFTLLK
FT                   KMESSIFGNYLSGLKMTLRDILEEKFHDINWATHSSNSFRAGDYIIESLMILVTVHSEC
FT                   FQLGPQLIQRILKESQIFISKYLFEAFKPYIGHISSDGLLQITVDLQFFQRVLRGHLEH
FT                   ETVTILNACLQSCFQNDIPRMQRCITETDPIVTSNLNRTSVQFASFE"
FT   CDS_pept        complement(405605..405913)
FT                   /codon_start=1
FT                   /gene_family="HOG000182712" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750152"
FT                   /locus_tag="AGL157C"
FT                   /orf_name="AGOS_AGL157C"
FT                   /product="AGL157Cp"
FT                   /protein_id="AAS54334.1"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI00002533C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q750U6"
FT                   /transl_table=1
FT                   /translation="MSTSGIPVKLLNEAQGHTVSLELTTGETYRGKLVGSEDNMNCQLR
FT                   DVTATARNGQVTHMDHVFVRGSHVRFFVVPDMFKNAPLFKSESAHKPPPPIRGPRRK"
FT   CDS_pept        406087..408819
FT                   /codon_start=1
FT                   /gene_family="HOG000001125" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750153"
FT                   /locus_tag="AGL156W"
FT                   /orf_name="AGOS_AGL156W"
FT                   /product="AGL156Wp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54335.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059805"
FT                   /db_xref="HOGENOM:HBG202471"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR007810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00002533C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q750U5"
FT                   /transl_table=1
FT                   /translation="MKVQIEHVSLSFIKEINNNICSLQVQNNVMCFALESGQLFLINLA
FT                   EPSNVVEFRVSLLNLNQEKVVQLWMNTQGTRALIKTNFSKYFVCNVGQLLEGGANDRRN
FT                   PVCATLKKLNRKECDIVSVDWSFSELELLVGTRQGKLYYLDLRHGEPAPVRIYMSQTPI
FT                   EGIKWSHENGAMAVSGSTIQYWESVPGQTAAAFTRMPPKESEEFEPLKKTSGTRFTAHN
FT                   STFAWVTQAGIVFGNTKTSPVLSSAKLLLNIELPPSNSHIKDIKLTDYHLILLRGSEVI
FT                   VINQLNNNIVFQEVIFSKENERMLALCADYSQSPPTFWCHSTENVYELVVENETEGIWQ
FT                   LLCANGQFMAALNLKGLSEPETDFIREQYANKLYNEGKWLEAAKEYGTSGQGSSIGSIA
FT                   LKFMEFDDLIHLQTFLMEKLKSILQKANKIQVFIMTSWIIWNFMNQLNRAEEIIAEEAT
FT                   DTNLDELKNAKAKLESQFQEFVRTHVEYLDRDTVYQIVSQQNRKAELLFYANIIEDYRY
FT                   VLCYWIRSDNWYESLKILVTLKDPECVYQYATVLLINAPDATVNTWVQIPNVDPVKLVP
FT                   SMLTYFSHYQDQQRFSHRMLPNYALTYLKFCIKEYNCQESLIHNTAIYMLLVSIAEDDV
FT                   DGEHDVIKFMNDHATRFDPNFILRLALKLRRYSVAIHLYSQLKLYDNAVDLALSKDMLS
FT                   SAKVIVGSLETEDTYMLKRLWLKIARVTIYEDTDVRQSIRSIIQDANGVLTIKDLLPLV
FT                   SKVATIANLKEELVRSLENHQMSMSHIFQEISDSIKIKREIRQDIELFNKRRQALQPGA
FT                   GCDSCREVLQTRKFFVFPCGHNFHTDCMIKEIIQSNDFNLRSQIESFQRKLARKQPVDA
FT                   DKLDHLLSTKCCLCSDLKINTIDEPLPDLAADTSGDWDL"
FT   CDS_pept        408950..409546
FT                   /codon_start=1
FT                   /gene_family="HOG000175811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079286"
FT                   /locus_tag="AGL155W"
FT                   /orf_name="AGOS_AGL155W"
FT                   /product="AGL155Wp"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54336.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="HOGENOM:HBG138910"
FT                   /db_xref="HOGENOM:HBG398309"
FT                   /db_xref="InterPro:IPR003923"
FT                   /db_xref="UniParc:UPI00002533C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q750U4"
FT                   /transl_table=1
FT                   /translation="MSEKEVTIDEDLNVDDELNEFDDGEEAPVDNAMLFGSQPPEDRAG
FT                   ADPKHRKLFEIPEFTRKDKTVNELLDLMTDNPPIIPDAVIDYYLTKNGFECTDVRVKRL
FT                   LALATQKFVSDIAADAYEYSRIRSSIAVHNSNNGQARARQLMLGQQQPGTQQISQQQHQ
FT                   QNEKTNANKVTLTVNDLSSAVAEYGLNISRPDFYR"
FT   CDS_pept        409718..411202
FT                   /codon_start=1
FT                   /gene_family="HOG000190315" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750154"
FT                   /locus_tag="AGL154W"
FT                   /orf_name="AGOS_AGL154W"
FT                   /product="AGL154Wp"
FT                   /protein_id="AAS54337.1"
FT                   /db_xref="HOGENOM:HBG059806"
FT                   /db_xref="HOGENOM:HBG397566"
FT                   /db_xref="InterPro:IPR004918"
FT                   /db_xref="InterPro:IPR013855"
FT                   /db_xref="InterPro:IPR013873"
FT                   /db_xref="InterPro:IPR013874"
FT                   /db_xref="UniParc:UPI00002533C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q750U3"
FT                   /transl_table=1
FT                   /translation="MAIDYSKWDKIEISDDSDIEVHPNVDKRSFIRWKQQSIHEQREKR
FT                   KQDIRNLEFQIEMYGHLNKRVDKLMEALSDRELVDRERVTRFLNENFDKTEKGSGENVD
FT                   PDMPPYNEMVEDLFEQLERNAAEEKKDPKDGTVLREQMQKHREKIRTVTAEARTKLDEL
FT                   YKEKAMHISSEDIHTGFDRSFVNKGKDGDQATFMPVPAKPDQAALPDSLKLVPTDFIDF
FT                   KDDPMKLAPETEQFGSVPVGNYKASEAYLLDHVSILSEQQKDALMMQAFEYQLAGDEKK
FT                   AYQVIHQSELMSYIREIYAMKKIPHLNAEELKEVIRVFFQKVFYNTNNKMGKSSFLESV
FT                   QSKFKHVTERCKVLANEQADTTEGGVETIQLKSLDESTELQVNLPDAQSKDPKEIQKVA
FT                   AFNKLPKTMQDAVKTQKLDAINEVFAEMSIEEAEAILEIFNEGEIIGVNALLEGEEEFK
FT                   ELQEHYNQEKNMEQLSIGEVDGSSSSAPQDTANIID"
FT   CDS_pept        complement(411436..413610)
FT                   /codon_start=1
FT                   /gene_family="HOG000001126" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079287"
FT                   /locus_tag="AGL153C"
FT                   /orf_name="AGOS_AGL153C"
FT                   /product="AGL153Cp"
FT                   /protein_id="AAS54338.1"
FT                   /db_xref="HOGENOM:HBG059807"
FT                   /db_xref="HOGENOM:HBG202472"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019417"
FT                   /db_xref="UniParc:UPI00002533C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q750U2"
FT                   /transl_table=1
FT                   /translation="MTIQSITGSSFSGGDVSAGSEKVYQNYLMPTLKLYDAKVSINHWQ
FT                   LRDCVKCSSTGLGSVYYIYDHSIRTLDTRSTAAELQNEKMERRRRRSSLCGGQRSDPWR
FT                   DHRAPSELVVQFDYKPRCFRENGGLIACGGLISSDDIGSTVSRSGRHEDSDGGGQSTGV
FT                   LTPSQVEPIRLANSDILTDYSFYGDQQSWKGILALYNMENGVSLTYKLGQYINNCVELY
FT                   QRTSQQYDLYTCNNDSHLYQCDVSNRGVELTRRYSDLKFALNCSAISHDGKTMVVSGDS
FT                   SKFAVYRQNELSGCFSLQYDAAPEWGSKWSRTKCVPRYAAVDRSEVLDRIYDSPGGDNG
FT                   FYTSYSENDVHMATIFQNGLCLVYDMRKMDTPLAEIPSTRRHAQNGSFRVCKFSRSFDD
FT                   LLFISEHQSHVHVVDTRNLMNHQVIVIPDKVRSPDENLTPSPNSGVSRSPPAPSIDDPC
FT                   VTRATRLPIRSLEPEVLPYPDVAQYSNNFQNVSSDEDAIDQLSSGVFQNRRRRSTFRVR
FT                   RYSTSSIINSNYPRALEDIDPSILDHHYTQHNYRAVDNYNYVNDQPQRGSPARVSRRVL
FT                   VPGRSRRAMAVEDIDDDTLEEDNGPEDEDDNPMMGYAEAYNEINEITHGSQFRFENVPQ
FT                   SSAIPRRQGISMALTNILNRTRDSGNRSSRTPAFSTASGSDLFEENSISGIDWVQDQEG
FT                   SSLIIGTDYGIIKWNINSWARRSFPCYDFC"
FT   CDS_pept        complement(413931..415466)
FT                   /codon_start=1
FT                   /gene_family="HOG000065949" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079288"
FT                   /gene_name="STB3"
FT                   /locus_tag="AGL152C"
FT                   /product="Protein STB3"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54339.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG124527"
FT                   /db_xref="InterPro:IPR018818"
FT                   /db_xref="UniParc:UPI00002533CA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750U1"
FT                   /transl_table=1
FT                   /translation="MASVLLLPHQRRKHRQKRARTASYRKPMSQGSSPSPAMEVDGPEF
FT                   PGKTGGQTIAEMGEERSGAGTGNTGTGGQSSVSGAGGKAGALNTAKLVLSHKPISTSSP
FT                   EAMAAAQQVTPQKLAQLLLAKGPLAIRFITQALTEEIPSFKDLSASKQRRLIMGALEAG
FT                   DQENSVVFAKIGWGQWSARHVKPHLFIKERELTNVANSKVKDAGVHEARRSSSNAKKGG
FT                   KSGSFLNELKRPMLAAPTASIYIDENALASDDDEEDDEEDEHDMLNYENLKRRQPSVVA
FT                   VEPPELSDQQEVLFRARLRAPNGGSRRRSTSKVRSVSVSKPGAHRAPPAAGDAVEGPLR
FT                   RLSPSQADRKSTIDIATPEEPPHDELLSANSVAKTRRAAARRDSWLSRSKESSIRSTLL
FT                   SHSNYNIVSPPSHAQPPADHHPLGREADHSDTDEEDWASIGAPALRNNSMPSNLSSSSS
FT                   HHGNSASASNAHSEQGSPHARPLNYAIPNSIPPRQHSPPDAEDAAFLLMSLKS"
FT   CDS_pept        join(415822..415827,415913..416668)
FT                   /codon_start=1
FT                   /gene_family="HOG000197305" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750155"
FT                   /locus_tag="AGL151W"
FT                   /orf_name="AGOS_AGL151W"
FT                   /product="AGL151Wp"
FT                   /protein_id="AAS54340.1"
FT                   /db_xref="HOGENOM:HBG059808"
FT                   /db_xref="HOGENOM:HBG396732"
FT                   /db_xref="InterPro:IPR019084"
FT                   /db_xref="UniParc:UPI00002533CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q750U0"
FT                   /transl_table=1
FT                   /translation="MSNPFDLLGNDVEDATVVVSPPKELVKKTTSSKKADVPPPSADPS
FT                   RAKNNRPKPTGNEAAFRDKQAGRSQNKSKDAPAPGKPAKDSRKTFDRHSRTGKTDSAKK
FT                   IKQAWGDNEKEQADEEAGAAVAEAELAADAAEEEQATAAAVTLEAYLEQQNSDLNKAPV
FT                   ARKVEKFDDAELFVKKQEVFMEATKVKNVKTKHLKAKQFLEFDGTESFAPKSRDQRDNK
FT                   RGGKGGNRGGKSGNREPAQAKPVNANFPALI"
FT   CDS_pept        complement(416858..417841)
FT                   /codon_start=1
FT                   /gene_family="HOG000247997" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079289"
FT                   /locus_tag="AGL150C"
FT                   /orf_name="AGOS_AGL150C"
FT                   /product="AGL150Cp"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAS54341.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG059809"
FT                   /db_xref="HOGENOM:HBG398240"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI00002533CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q750T9"
FT                   /transl_table=1
FT                   /translation="MSPKLTPLDNVANLLRFRNTNSFPTRAVWPVNRRAAVLILLFIGT
FT                   HGELRVLLTKRSRGLNSFSGHVSLPGGKADNPMEPFELIARREAEEEIGFPLNDGVLSE
FT                   EYNLKVDTISGELPHYISTTFLSVKPFLCFLYNADLSDDEKHVRALKINKPFTKLNPGE
FT                   TSSVFSIPLRDLVAHELSEQPTDVEYVRRREFMYDWGGLSWLVRHYYYACDNVGEVSWL
FT                   NGVEDLSSDEDDSGGEVICKDVWGLTAKILYDVARVAEGLVPNSKSEGVCAHEALIYGL
FT                   HELGKQMHSPNRTTWELGMIERKRALSCADVIPDYYMERLKSHLPL"
FT   CDS_pept        complement(418069..419997)
FT                   /codon_start=1
FT                   /gene_family="HOG000248253" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079290"
FT                   /locus_tag="AGL149C"
FT                   /orf_name="AGOS_AGL149C"
FT                   /product="AGL149Cp"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54342.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058330"
FT                   /db_xref="HOGENOM:HBG396136"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniParc:UPI00002533CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q750T8"
FT                   /transl_table=1
FT                   /translation="MKNAGPYEKAECNSADRKIVKSVSSFFSYLKILDLRDRIIRFGRC
FT                   PLYIGCVRRGIKMLSIGLGVAVFIAIKPVLKIYVILLIGYLAARYNILNAEITRGISNL
FT                   VVNILIPSLTFNKIVQTLSNKDIKTIGVVILNALVLFALGGICSLLIHGLAPVPKRWFW
FT                   GLIFAGIFPNISDLPIAYVQSMQNSGLFSMDDLNKGVAYICIFLTFQGFIFMNLGAYRI
FT                   VGLDFRDSDDEERSKGDSKLRDIVHPMARQQVGSRNLSRNSFGSISHAAQAASSRGSRL
FT                   TQEAAVIENAVSASSHHPDACTGFGEQAEDIDSPISHHANRAMDTALSLQFRDSPSALD
FT                   TQTISVKSLPCHAVGESLQFENVCAPPATAYSICSRRTHERALGAELGRGSYSLPQALE
FT                   VCPPNLAPHGYPVGEEQADRNAREQLFEDVSRVSSTNHTEKSGSAPSFKNSRRRWLYYI
FT                   VMTCCRPASSGPLLGILCAMVPTLRALFVHNDLKLENAPDGQPVLNFIMDITEYLGNAC
FT                   VPTGLLLLGSTFANMRIESLPKGIWRAVLMLTSFKLVALPIIGILFAGELRNINWLHDD
FT                   IGKFVIILTWTMPSTSAQVYFTTFFATADGHRLQMSLLSLFFMTQYAVLFFAMAFVVTY
FT                   TIKFQLN"
FT   CDS_pept        complement(420365..422428)
FT                   /codon_start=1
FT                   /gene_family="HOG000229981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928050"
FT                   /gene_name="ACS2"
FT                   /locus_tag="AGL148C"
FT                   /product="Acetyl-coenzyme A synthetase 2 "
FT                   /EC_number="6.2.1.1"
FT                   /function="AMP binding"
FT                   /function="ATP binding"
FT                   /function="acetate-CoA ligase activity"
FT                   /protein_id="AAS54343.1"
FT                   /db_xref="GO:0003987"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016208"
FT                   /db_xref="HOGENOM:HBG519036"
FT                   /db_xref="HOGENOM:HBG547964"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00002533CE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750T7"
FT                   /transl_table=1
FT                   /translation="MSCKEHKVVHEAHNVEARKTPDHFYRSQPGPSYVQDIEQYRTMYQ
FT                   QSIEDPDAFFGEKAREFLHWEKDFTHVRAGSLRTGDTAWFLNGELNAAYNCVDRHALEN
FT                   PDKVAIIYEADDEADNRVVTFGELLRQVSQVAGVLQSWGVKKGDTVAVYMPMIPEAVVA
FT                   MLAVARLGAVHSVIFAGFSSGSLRDRIVDAESKVVITCDEGRRGGKTVHTKKIVDEGLA
FT                   GVGVVSHILVFQRTGSEGIPMKAGRDFWWHEEVRKQRGYLPPVSVNAEDPIFLLYTSGS
FT                   TGSPKGVVHTTGGYLLGAALTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLCLGTA
FT                   TIIFESTPAYPDYGRYWRIIQRHKATHFYVAPTAMRLIKTVGEQEISKYDLSSLRVLGS
FT                   VGEPIAPDLWEWYNEKVGNNNCVVCDTMWQTESGSHLIAPLAGAIPTKPGSATVPFFGI
FT                   NACIIDPVTGDELEGNDVEGVLAIKSPWPSMARSVWNNHDRYIETYLKPYPGYYFTGDG
FT                   AGRDHDGYYWIRGRVDDVVNVSGHRLSTAEIEAALSEHEGVSQAAVVGIADELTGQAVV
FT                   AFVSLKEGYGRGSSTDTDPESIAPDVVPLDTLRRELVLQVRAEIGPFAAPKSVIVVDDL
FT                   PKTRSGKIMRRTLRKISANEADQLGDLSTLANPETVPAIIAAVGAQFLKGKK"
FT   CDS_pept        complement(423010..428700)
FT                   /codon_start=1
FT                   /gene_family="HOG000181045" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928051"
FT                   /locus_tag="AGOS_AGL147C"
FT                   /product="AGL147Cp"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /function="binding"
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54344.2"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG059810"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR015403"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB2B91"
FT                   /db_xref="UniProtKB/TrEMBL:Q750T6"
FT                   /transl_table=1
FT                   /translation="MASSVDRVNEVSPPESVQKENMSNNSTEDVAEHVQVGKEVISGTN
FT                   ANGVAQKKTFDEPVIEISTPASVQKENMSSNSVEDVAQHVQMGADAIPDTSANSSDQNN
FT                   ALGESTKVEQTSEDGDERFVKGPVEATGNSTAPSPPTSQDNLKRHTRAYSNVSGSPWTM
FT                   KSAVHLVKTTLEGILQAKSMHKHPNNEKLVEKTVKNLTEQLLQSENDPKFLDSLLVFEA
FT                   LRACCRTNVPEIQVSALDCLSKLFAFKALDENVLVNPPNSAASNDQGTTLPDSGVTPPP
FT                   RMRLIDAAVDTITDCFDGEATDGKVELQVVRALASCILTDEPYCNCHGASLLKAVRQIY
FT                   NIFILSLSSSNQGIAQATLTQIVNATFEKINVVSLYPPSFSQNSLRKEPLEHYSPTSVE
FT                   DQPPLTLQNLESFNEEHEGQLDSMDTEHDASTTDEQSLIVKDAFLVFRVMSKLSVKPLD
FT                   DNLDMRSYAVRSKLLALHIIHSIMRDHIDVFLSHNVLLPGKQNTTLLNGVKQYLCLALA
FT                   RNAASPIAPVFEITFEIMWLLVSNLRSEFKREIPVFLTEIYFPISHMKSSTPHQKRYFL
FT                   SVIQRLCNDPRTLIEFYLNYDCDSSMPNIVETVVDYLTRLALTRVDITASQRAYYDEQV
FT                   NKPLATYNLSQLPLLSISNVSSMSVAPQQLQFPVEFALKMTSLKCMLAVLRSLNSWADK
FT                   ATAPNGTLNHNRASVGSSTIERKHSSAFSSFSHTMNTTPVGDQNSVQQSEASEDIDDPT
FT                   QFENLKLRKTELQKCIRLFNFKPHKGIQDLLKLGFIKDTTPNAIAKWLLYTPGLDLAAV
FT                   GDYLGEGSEENIAIMHAFVDELDFSNLSLVDALRVFLQRFRLPGEGQKIDRFMLKFAER
FT                   YVDQNPDRFATLTAYTLSYSIILLNTDLHSSQIKNKMTLDEFVDNNRGIDNGKDLPREL
FT                   LAQLFNEIAQNEIKLQSEQHQAMIAGDLNPVHQQSAFAFFSGKDLEREAYMQLSKEISS
FT                   KTELVFKNWEKAKSGDKVFYAASHVEHVRSIFETLWMSFLAALTPPFKEYDDLETTMMC
FT                   LEGLKMSIKISTRFGIDYARASFIGALIQFANLQNIQEIQPKNVNAIIALLEVALSEGN
FT                   FFRDSWRDVLVIASQVERLQLISKGVDGESVPDVAQARLANHRSSFDSTRSMSMSFFER
FT                   WTKKSNPIEIAQEKHHNQSLSPEIYDYISSSKLVVLIDRIFTNSSKLSGQGIMDFIKAL
FT                   IQVSREEIESSQDAATPRMFSLQKMVDVCYYNMDRIRVEWTPIWAVLGEAFNWTATSPN
FT                   LAVVFFAIDSLRQLSIRFLDIEELPGFEFQHDFLKPFQHIIQNTTNTDVQEMCMECFRN
FT                   FILVKSTTLKSGWKPILESLQFCARSSKESIVLKTYQLITVDVMKDHFESVFVQEDAFI
FT                   ELVGVLREITKNRKYQKLSLHSLKSLKKIYQKVAELCFKKENQHLLHGKDIFEDIWYPV
FT                   LYSFNDAVMTADDLEVRSRALNFMFDALVEYGGEFGISFWESVCTRLLFPIFGVLSKHW
FT                   EVNQFNSHDDLSVWLSTTLIQALRNMVALFTHYFDSLNEMLDGFLVLLVSCICQENDTI
FT                   ARIGRSCLQQLIIQNTNKFGTTHWEQVTNSFARLFELTTATELFESDPLKRGRKPSVAT
FT                   INTNGTAETQSCASDVDREVERAQREEKGEDVGNASTEEDKPMSRLVRTKSSEEIGHRV
FT                   SIKNTIVVKCVLQLLMIESLSELFADENFANAIPFKNAIRLTSLLESSYWFARDFNDDF
FT                   ELRNRLVNARIVDKIPNLMKQETSSSAVLIDILFKIYLNDETPDSETSADLLARLVGIC
FT                   TQIVVRYVALDEATMERTIATWRPVIVEILLGYHELDDDDFRSQSPAMYKLVLQVLDKA
FT                   CPLDLRHAIKVFLSRVGDLYLV"
FT   CDS_pept        429133..430449
FT                   /codon_start=1
FT                   /gene_family="HOG000077582" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775036"
FT                   /locus_tag="AGL146W"
FT                   /orf_name="AGOS_AGL146W"
FT                   /product="AGL146Wp"
FT                   /function="GTP cyclohydrolase II activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="AAS54345.1"
FT                   /db_xref="GO:0003935"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="HOGENOM:HBG052034"
FT                   /db_xref="HOGENOM:HBG323958"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="UniParc:UPI00002533D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q750T5"
FT                   /transl_table=1
FT                   /translation="MIMASVSESNCVGNLSSHTHAKDKSQLADDIRITTFPGESRPIAI
FT                   QWGAKALSDRGPVVASRRGEGFSKHNAIGAYAGSYCIYQALAVGAKAVQADHIADYSMS
FT                   EPMFHLPPQQAWFNKDEIVSMDPLGHLAPALFGRIAQDEQVEVRPTVAITKATMQVPEI
FT                   REAVVLGRLPVDGKIVANKNGDLRVSKIAVEQVWYLPGIAKRFGMSEEELRTTLFEHTN
FT                   GMYPELVTRPDLKVFLPPIGGLTVYIFGNPLDVSDPAKKLTLRVHDECNGSDVFGSDIC
FT                   TCRPYLIFAIEEGVKQAQAGGSGVVIYFRKEGRALGEVTKYLVYNARKRSGDHAAEYFK
FT                   RTERIAGTEDMRFQQLMPDVLKWLGVTKVDRLISMSHMKYNAIADCGIKVLERVPIPSE
FT                   LIPADSHVEIEAKVHSGYFTHDKVPSVTDLRRCKGKQWF"
FT   CDS_pept        430809..432884
FT                   /codon_start=1
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622491"
FT                   /locus_tag="AGOS_AGL145W"
FT                   /product="AGL145Wp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation release factor activity "
FT                   /protein_id="AAS54346.2"
FT                   /db_xref="GO:0003747"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG491630"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR003285"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI0001DB2BA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q750T4"
FT                   /transl_table=1
FT                   /translation="MSEEDQIQSQGNDQGQSQAKDQGQNQGQGQQNFGQYYNPSNFQNY
FT                   QGYVPQGGYQAYGQQAGGYQGYAQYNQQAGGYQGYQGYQQYNPAQAGYQGYQQYNAQGG
FT                   YQSYKQYNSQPQGNRKGNQSYGYGQGQSATAPVTLNNFEKGTVPNATAPKPKKTLKLAS
FT                   SSGIKLVGAKKPVAKKEEAKAEEPTKEEPKSSAEGAPKSEDATASSEDKAVPSIEKLSI
FT                   SEADTAKKDTADAAGATSSDALIKEQEDEVDEEVVKDMFGGKDHVSIIFMGHVDAGKST
FT                   MGGNLLYLTGSVDKRTVEKYEKEAKEAGRQGWYLSWIMDTNKEERNDGKTIEVGRSYFE
FT                   TEKRRYTILDAPGHKMYVSEMIGGASQADVGILVISARKGEYETGFERGGQTREHALLA
FT                   KTQGVNKMVVVVNKMDDPTVNWDKARYDQCIKNVSNFLQAIGYNVKEDVMYMPVSGFTG
FT                   AGLKDRVDKKDCPWYDGPSLLEYLDNMQHVDRFINAPFMLPIASKMKDMGTVVEGKIES
FT                   GHIKKGNQTLLMPNKIPVEILAIQNETEQEVDMAVCGEQVRLRLKGVEEEDISAGFVLT
FT                   SPKNPVKNVTKFVAQIAIVELKSIMSAGFSCVMHVHTAIEEVSITRLLHKLEKGTNRKS
FT                   KKPPAFAKKGMKIIAVLETEEPVCVETYQDYPHLGRFTLRDQGITIAIGKIVKILE"
FT   CDS_pept        complement(432968..433987)
FT                   /codon_start=1
FT                   /gene_family="HOG000065947" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750156"
FT                   /locus_tag="AGOS_AGL144C"
FT                   /product="AGL144Cp"
FT                   /function="inositol trisphosphate 3-kinase activity "
FT                   /protein_id="AAS54347.2"
FT                   /db_xref="GO:0008440"
FT                   /db_xref="HOGENOM:HBG059811"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="UniParc:UPI0001DB2BA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q750T3"
FT                   /transl_table=1
FT                   /translation="MGHKKLRHQAAGHDGTLTDIDERLIFKPAVDQELEFYTGIISRKD
FT                   REGVDFPLECWMCVFVGTLSEGILNVENNDSIMRLKGEDVVKPTTDYLQHLNLSNDHTQ
FT                   KYLVLENLTYGYRRPNILDIKLGKVLYDDKATEEKKARLTTISASTTSGSLGFRVCGMK
FT                   IERNSLIGQLDKSHYEEDDDDYVLLNKLYGRSRTVDNVSDAFRLFFNAPNLPKHRHAEL
FT                   INRFAVRLRMFYNTLLDEEVRMISSSLLFVYEGDPERWDMENAVDGVLNEPCFLDGDSD
FT                   CSSEEWDKSRNIPLSSMTLIDFAHSKFTPGEGYDENVIVGVENLMEVFDKVSGEYGEQ"
FT   CDS_pept        complement(434218..435342)
FT                   /codon_start=1
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775037"
FT                   /locus_tag="AGOS_AGL143C"
FT                   /product="AGL143Cp"
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54348.2"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG380070"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI0001DB2BA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q750T2"
FT                   /transl_table=1
FT                   /translation="MILEANDSLFGPLFKRHSHSHSEEPEECPTENEYDGSDGIRILSV
FT                   FIILLASAIGTFFPMLGSRFSRVRLPTWAFFFAKYFGSGVIVATGFIHLLLHGHESLSN
FT                   PCLGGVLSEYPWAFAICMMSLFTLFFVEINSHHFVNKAARSTAVAVAGDEKSIKEDEST
FT                   EDTPPKPNTAVSGANSAVVSQHFAHDECHQDLEQAKSLAADPNREQYLNQLISLFILEF
FT                   GVVFHSVLIGLSLAVTAEDHFTTLFVVLIFHQMFEGMGLGARIAETEWGVHRKWTPWLL
FT                   GLGYCLSTPIAIAIGLGVRHSFAPESRPSLIVNGVFDSLSAGILLYTGLIELMAHEFLF
FT                   SNSFKGEGGFNKMMQGFVYMCLGAGLMALLGKWA"
FT   tRNA            complement(435890..435971)
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        complement(436505..440998)
FT                   /codon_start=1
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750157"
FT                   /locus_tag="AGOS_AGL142C"
FT                   /product="AGL142Cp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54349.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001DB2BA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q750T1"
FT                   /transl_table=1
FT                   /translation="MEFFNANLTANRASHVSAGASTSIGEADRPYVGLAEDLEEQEVIR
FT                   SLAQTLSRSSAAEYELQPTSADPSALFGPDKDARLDPESDEFDPRYWVRTIRNLYASDP
FT                   DHYKPAELCVVIQNLRVCGVSADTDYQATVGNSPLKALRMLYQMTPFARGREKSEFDIL
FT                   KPLDVVFEPGRLCVVLGRPGAGCSTLLKTVGARTYGFTVAPESEISYSGFSQKEIKNHL
FT                   RGEVIYSAESDTHFASLPVGYTLEFAARCRCPQVRPGGVKREVFYKHYAAAVMAMYGLS
FT                   HTRYTKVGNDYIRGVSGGERKRVSLAEVTLAGAKLQCWDNCTRGLDSATALEFVRALRD
FT                   NAEVMRTTQLIAIYQCSEAAYSLFDDVLVLYEGYMIYFGPRKLAKGYFLRMGWECPPRQ
FT                   TSADFLTSVTSPFERKSQPGYEDKVPRTAREFYEYWLRSPEHAVAMKQIQRRIAEAKTD
FT                   AAREQLRDHHIVRQARHVKSSSPYLISFYMQFRAIVDRNWQRLRGDPSVYLFSIVAYSI
FT                   MGLILASCFLNLKPDTNSLFNRGSALFTAVLLNSFFSFLEIMSLFEARAIVKKHKSYAF
FT                   YRPSADAFASIFTELPAKFTVCICFNVPFYFMVNLRRSTGAFFFYMLVSLTATFAMSHL
FT                   FRSVGAACKTLYVTMFPASLLLLGLAVYVGFVIPQKNILGWSRWLFYLNPIARIMEAMV
FT                   ANEFDGRIFECSRMVPDGSFYEGFPISNKVCLSVGAVPGQSFVNGTRYIEFAYGYNTKN
FT                   KWMNWGIVLAYAFFFLGVYLILIEYNKSGMQKGEMAVFLRSTLKKIKKQNKKAINCDIE
FT                   FGNAPGKESSTIGSDQSRELIQRIGSDSIFHWRDVCYDIQIKNETRRILTNVDGWVKPG
FT                   TLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGHLRDTSFQRKTGYCQQQDLHGR
FT                   TQTVRDALKFSAYLRQPQSISRAEKNAYVEDIIKLLGMEAYADAVVGVTGEGLNVEQRK
FT                   RLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLVNHGQAILCTIHQPSAILM
FT                   QEFDRLLLLSNGGRTVYFGPLGEGCSTMIQYFENHGSQKFPEACNPAEFMLEIIGAAPG
FT                   SHALQDYHEIWKNSDEYQSVQEELHRMEMELWHKPRFETSDQNKEFASSIWYQYIIVSR
FT                   RVLQQYWRSPEYLWSKIFMSIFASLFIGFSFFKSKTSIQGLQNQMFAVFLFLVVLTPLV
FT                   QQMLPQYVEQRDLFEVRERHSKTFSWKVFLLSQITAEIPWAILGATISFFCFYYPVGFY
FT                   THATDAANRAERGFLFWLLCVTFYIFSATFGQFCIAGLEKAEPAAILANFYFTMCLIFS
FT                   GVLVTKDNLPRFWIWMYYLSPVTYLVSALLSTGSGNMTVECAPEELIKFAPPKGLFCAL
FT                   YLEPFANNAESVLLNPAATDLCTVCPIKNSDYYLALVNIFYNHRWRDWGIFTIFVATNI
FT                   IGFAATYWFFRVPKSTHITIKTKANVKEQEQEQEHQ"
FT   rRNA            complement(441868..445257)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_1"
FT   rRNA            complement(445468..445625)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_1"
FT   rRNA            complement(445833..447627)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_1"
FT   rRNA            448979..449099
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_1"
FT   rRNA            complement(450065..453454)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_2"
FT   rRNA            complement(453665..453822)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_2"
FT   rRNA            complement(454030..455824)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_2"
FT   rRNA            457176..457296
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_2"
FT   rRNA            complement(458262..461651)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_3"
FT   rRNA            complement(461862..462019)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_3"
FT   rRNA            complement(462227..464021)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_3"
FT   rRNA            465373..465493
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_3"
FT   rRNA            complement(466459..469848)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_4"
FT   rRNA            complement(470059..470216)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_4"
FT   rRNA            complement(470424..472218)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_4"
FT   rRNA            473570..473690
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_4"
FT   rRNA            complement(474656..478045)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_5"
FT   rRNA            complement(478256..478413)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_5"
FT   rRNA            complement(478621..480415)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_5"
FT   rRNA            481767..481887
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_5"
FT   rRNA            complement(482853..486242)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_6"
FT   rRNA            complement(486453..486610)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_6"
FT   rRNA            complement(486818..488612)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_6"
FT   rRNA            489964..490084
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_6"
FT   rRNA            complement(491050..494439)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_7"
FT   rRNA            complement(494650..494807)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_7"
FT   rRNA            complement(495015..496809)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_7"
FT   rRNA            498161..498281
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_7"
FT   rRNA            complement(499247..502636)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_8"
FT   rRNA            complement(502847..503004)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_8"
FT   rRNA            complement(503212..505006)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_8"
FT   rRNA            506358..506478
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_8"
FT   rRNA            complement(507444..510833)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_9"
FT   rRNA            complement(511044..511201)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_9"
FT   rRNA            complement(511409..513203)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_9"
FT   rRNA            514555..514675
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_9"
FT   rRNA            complement(515641..519030)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_10"
FT   rRNA            complement(519241..519398)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_10"
FT   rRNA            complement(519606..521400)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_10"
FT   rRNA            522752..522872
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_10"
FT   rRNA            complement(523838..527227)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_11"
FT   rRNA            complement(527438..527595)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_11"
FT   rRNA            complement(527803..529597)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_11"
FT   rRNA            530949..531069
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_11"
FT   rRNA            complement(532035..535424)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_12"
FT   rRNA            complement(535635..535792)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_12"
FT   rRNA            complement(536000..537794)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_12"
FT   rRNA            539146..539266
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_12"
FT   rRNA            complement(540232..543621)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_13"
FT   rRNA            complement(543832..543989)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_13"
FT   rRNA            complement(544197..545991)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_13"
FT   rRNA            547343..547463
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_13"
FT   rRNA            complement(548429..551818)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_14"
FT   rRNA            complement(552029..552186)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_14"
FT   rRNA            complement(552394..554188)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_14"
FT   rRNA            555540..555660
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_14"
FT   rRNA            complement(556626..560015)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_15"
FT   rRNA            complement(560226..560383)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_15"
FT   rRNA            complement(560591..562385)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_15"
FT   rRNA            563737..563857
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_15"
FT   rRNA            complement(564823..568212)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_16"
FT   rRNA            complement(568423..568580)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_16"
FT   rRNA            complement(568788..570582)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_16"
FT   rRNA            571934..572054
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_16"
FT   rRNA            complement(573020..576409)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_17"
FT   rRNA            complement(576620..576777)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_17"
FT   rRNA            complement(576985..578779)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_17"
FT   rRNA            580131..580251
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_17"
FT   rRNA            complement(581217..584606)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_18"
FT   rRNA            complement(584817..584974)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_18"
FT   rRNA            complement(585182..586976)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_18"
FT   rRNA            588328..588448
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_18"
FT   rRNA            complement(589414..592803)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_19"
FT   rRNA            complement(593014..593171)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_19"
FT   rRNA            complement(593379..595173)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_19"
FT   rRNA            596525..596645
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_19"
FT   rRNA            complement(597611..601000)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_20"
FT   rRNA            complement(601211..601368)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_20"
FT   rRNA            complement(601576..603370)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_20"
FT   rRNA            604722..604842
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_20"
FT   rRNA            complement(605808..609197)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_21"
FT   rRNA            complement(609408..609565)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_21"
FT   rRNA            complement(609773..611567)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_21"
FT   rRNA            612919..613039
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_21"
FT   rRNA            complement(614005..617394)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_22"
FT   rRNA            complement(617605..617762)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_22"
FT   rRNA            complement(617970..619764)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_22"
FT   rRNA            621116..621236
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_22"
FT   rRNA            complement(622202..625591)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_23"
FT   rRNA            complement(625802..625959)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_23"
FT   rRNA            complement(626167..627961)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_23"
FT   rRNA            629313..629433
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_23"
FT   rRNA            complement(630399..633788)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_24"
FT   rRNA            complement(633999..634156)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_24"
FT   rRNA            complement(634364..636158)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_24"
FT   rRNA            637510..637630
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_24"
FT   rRNA            complement(638596..641985)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_25"
FT   rRNA            complement(642196..642353)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_25"
FT   rRNA            complement(642561..644355)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_25"
FT   rRNA            645707..645827
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_25"
FT   rRNA            complement(646793..650182)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_26"
FT   rRNA            complement(650393..650550)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_26"
FT   rRNA            complement(650758..652552)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_26"
FT   rRNA            653904..654024
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_26"
FT   rRNA            complement(654990..658379)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_27"
FT   rRNA            complement(658590..658747)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_27"
FT   rRNA            complement(658955..660749)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_27"
FT   rRNA            662101..662221
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_27"
FT   rRNA            complement(663187..666576)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_28"
FT   rRNA            complement(666787..666944)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_28"
FT   rRNA            complement(667152..668946)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_28"
FT   rRNA            670298..670418
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_28"
FT   rRNA            complement(671384..674773)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_29"
FT   rRNA            complement(674984..675141)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_29"
FT   rRNA            complement(675349..677143)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_29"
FT   rRNA            678495..678615
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_29"
FT   rRNA            complement(679581..682970)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_30"
FT   rRNA            complement(683181..683338)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_30"
FT   rRNA            complement(683546..685340)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_30"
FT   rRNA            686692..686812
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_30"
FT   rRNA            complement(687778..691167)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_31"
FT   rRNA            complement(691378..691535)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_31"
FT   rRNA            complement(691743..693537)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_31"
FT   rRNA            694889..695009
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_31"
FT   rRNA            complement(695975..699364)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_32"
FT   rRNA            complement(699575..699732)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_32"
FT   rRNA            complement(699940..701734)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_32"
FT   rRNA            703086..703206
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_32"
FT   rRNA            complement(704172..707561)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_33"
FT   rRNA            complement(707772..707929)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_33"
FT   rRNA            complement(708137..709931)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_33"
FT   rRNA            711283..711403
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_33"
FT   rRNA            complement(712369..715758)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_34"
FT   rRNA            complement(715969..716126)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_34"
FT   rRNA            complement(716334..718128)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_34"
FT   rRNA            719480..719600
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_34"
FT   rRNA            complement(720566..723955)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_35"
FT   rRNA            complement(724166..724323)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_35"
FT   rRNA            complement(724531..726325)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_35"
FT   rRNA            727677..727797
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_35"
FT   rRNA            complement(728763..732152)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_36"
FT   rRNA            complement(732363..732520)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_36"
FT   rRNA            complement(732728..734522)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_36"
FT   rRNA            735874..735994
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_36"
FT   rRNA            complement(736960..740349)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_37"
FT   rRNA            complement(740560..740717)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_37"
FT   rRNA            complement(740925..742719)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_37"
FT   rRNA            744071..744191
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_37"
FT   rRNA            complement(745157..748546)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_38"
FT   rRNA            complement(748757..748914)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_38"
FT   rRNA            complement(749122..750916)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_38"
FT   rRNA            752268..752388
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_38"
FT   rRNA            complement(753354..756743)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="AGOS_RDNA25_39"
FT   rRNA            complement(756954..757111)
FT                   /gene_name="5.8S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN58_39"
FT   rRNA            complement(757319..759113)
FT                   /gene_name="18S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN18_39"
FT   rRNA            760465..760585
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="AGOS_RDN5_39"
FT   CDS_pept        join(762818..762859,762948..763664)
FT                   /codon_start=1
FT                   /gene_family="HOG000001040" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079291"
FT                   /locus_tag="AGL141W"
FT                   /orf_name="AGOS_AGL141W"
FT                   /product="AGL141Wp"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54350.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG059813"
FT                   /db_xref="HOGENOM:HBG398058"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI00002533D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q750T0"
FT                   /transl_table=1
FT                   /translation="MSEPSLKLRTAKDSLVSSLFELSKAANQTASCIVDFYHVIGEDEE
FT                   EKIEAFTTLTEALQRLTAATNQLHGVSTELTNPLDDDKEALPSSPAKGITKKRQERDPN
FT                   APKKPLTVFFAYSAYVRQALREERQRTGLPPLSSTEITQEISKKWKELSDSEKDKWKQA
FT                   YTAELENYQREKQKYLEAKKNGIMHVYDGPNSAPVPIPEYLQSAEDSFEPLPEKRSYEE
FT                   ESGSASSDKKKKKKKKDKKKDKNRSSGNDA"
FT   CDS_pept        complement(764068..764979)
FT                   /codon_start=1
FT                   /gene_family="HOG000248581" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079292"
FT                   /locus_tag="AGL140C"
FT                   /orf_name="AGOS_AGL140C"
FT                   /product="AGL140Cp"
FT                   /protein_id="AAS54351.1"
FT                   /db_xref="HOGENOM:HBG059814"
FT                   /db_xref="HOGENOM:HBG395381"
FT                   /db_xref="InterPro:IPR017081"
FT                   /db_xref="InterPro:IPR019349"
FT                   /db_xref="UniParc:UPI00002533D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q750S9"
FT                   /transl_table=1
FT                   /translation="MRVSLARQLQTSLRLLNSSRNGAGGELKAVAEDLYLRPSEWKGLK
FT                   TPQLLQLHAERQARLGAQYRASEEEIDALLPSAKDLGIPEKVFRRYINAPVQELERKLG
FT                   ITKKPAYDNIKEYEYDELPTLAHTLVDQHREQRFYNRLAAYELPLLVQYRQEYRPPSRK
FT                   TQPVLYRYTTYIGEEHPNSRKVVLSVLTADLGLNEAQLHKLRLLARTRYDHTTDILKMS
FT                   SDRYEHAAQNARYLADKLQALINEASDLTDDFSDVPLDTRHTEARLARKNKKIPEFPES
FT                   WKRPQDAPPKTVNVIEKLMQNL"
FT   CDS_pept        765210..767405
FT                   /codon_start=1
FT                   /gene_family="HOG000248582" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079293"
FT                   /locus_tag="AGL139W"
FT                   /orf_name="AGOS_AGL139W"
FT                   /product="AGL139Wp"
FT                   /protein_id="AAS54352.1"
FT                   /db_xref="HOGENOM:HBG192662"
FT                   /db_xref="HOGENOM:HBG395380"
FT                   /db_xref="InterPro:IPR019340"
FT                   /db_xref="UniParc:UPI00002533D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q750S8"
FT                   /transl_table=1
FT                   /translation="MSRNTRRGKGIRDQSQVEDVAYPTPSHLLSNVLKSLELSFDKDNG
FT                   VLAGKHVRAAPDNAMLLNFRGKLEKLDEVLARIAIEDQEMVDMVRDARDTARKVEHSQP
FT                   RTKETAGKKARYGGVERIGTGRGGKGDVASNIDEAAPRLGAHELGKRPAGNGSGAGEQV
FT                   YAEDVARSASEEDVTAPQRRVGTKKRLLKPDHRDGGGMEPGSTAADSKSASSSRKKSKV
FT                   DIERIENDPTVKNPNSEFVVSQTLPVAARQLGLFNEEGLESTGDAYLKNKYAVASYPAN
FT                   DLKDMLPGELPDMDFSKPKPTNQIQYSTFLSSIDNFFREFTEDDIKFLQTRHIIPQTLQ
FT                   IQKQYDPEVTPYIIPKLGHIYTDVWLKEDNNQNVANLSPPPVSDPSSVLPKKSASDIND
FT                   DTLETESISCGPLVSRLLSAILKDDSGDSHTSKADQMDDSTVTFENKTEDIADTVGVKV
FT                   EGANNTVGAAAGNKNNPSNNATAAGGHHGTNSVSAANNNVNIFEEIKLPTQSTSSLPQQ
FT                   QGWKAQDVSLDYTSFEERLKRELKYVGIYMSLPKDENGTDDPDWLNGREDDEISVELRE
FT                   LQNVLRQVTKRNEKRKAVLVPLVEKQLAWQEYISILDDLDKQVDQAYIKRIRVPKNKKK
FT                   KHSASTPVANPNSTSQAAIQAAHQQAANSSLKSLLDKRQRWISNIGSLFDKPEKMKRIP
FT                   KESVFRDLDQEEEEEEGDVFDGNDNNKDEEDMGGLQK"
FT   CDS_pept        complement(767481..768893)
FT                   /codon_start=1
FT                   /gene_family="HOG000242450" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928052"
FT                   /locus_tag="AGL138C"
FT                   /orf_name="AGOS_AGL138C"
FT                   /product="AGL138Cp"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS54353.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG407991"
FT                   /db_xref="HOGENOM:HBG476859"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI00002533D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q750S7"
FT                   /transl_table=1
FT                   /translation="MPTITMSKMLRCLRGRLRGLATSSTVPRTRISQLPNGLTVASEAM
FT                   PNTATASVGIFVDAGSRAENVRNNGTAHFLEHLAFKGTKNRTQVGIELEIENLGSHLNA
FT                   YTSRENTVYYAKSLQEDIPRALDVLSDILTRSVLDPKAVERERDVIIRESEEVDKMYDE
FT                   VVFDHLHAISYENQPLGRTILGPIENIKSIQQRDLKEYISTNYKGDRMALVGAGAVDHD
FT                   ELVRYGEKYFGHIPKSDHPVPLGSPRGPLPVFHGRELAVTDMRLPTTHVALAVEGVSWS
FT                   APDFFTALCTQAIVGNWDRSLGTGTNSPSPLAVAASENGTLANSYMSFSTSYADSGLWG
FT                   MYLVTDSKEHNLKLIIDQILKEWSRLKAGAILDSEVERAKAQLKASLLLSLDGSTAIME
FT                   DIGRQIVTTGKRHSPEEVFEKVDKITKDDIVMWANYRLKDKPISIVTLGNTETVPSLSY
FT                   IQRSLNGDLQRQ"
FT   CDS_pept        769497..770012
FT                   /codon_start=1
FT                   /gene_family="HOG000204209" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750158"
FT                   /gene_name="SDH4"
FT                   /locus_tag="AGL137W"
FT                   /product="Succinate dehydrogenase [ubiquinone] cytochrome b
FT                   small subunit, mitochondrial"
FT                   /function="heme binding"
FT                   /function="ubiquinone binding"
FT                   /biological_process="electron transport chain"
FT                   /biological_process="transport"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial respiratory chain
FT                   complex II"
FT                   /protein_id="AAS54354.1"
FT                   /db_xref="GO:0005749"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0048039"
FT                   /db_xref="HOGENOM:HBG175893"
FT                   /db_xref="HOGENOM:HBG734876"
FT                   /db_xref="InterPro:IPR007992"
FT                   /db_xref="UniParc:UPI00002533D9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750S6"
FT                   /transl_table=1
FT                   /translation="MQGIKMASPVIRAACKRSLHQSAVRAITIPFLPTLPQNPGGVKGD
FT                   VNEANPVPPANKMHGSLHWNIERAFAVAAVPLVGLPLVAGSGVSTLMDSLLASVMLGHC
FT                   YIGFQACIIDYIPQRVYGKFHQYAMYLLAFGSLLSGVGIYKMESEGYGICGAVAAVWSG
FT                   KAAREEKA"
FT   CDS_pept        complement(770081..770572)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750159"
FT                   /gene_name="CSN9"
FT                   /locus_tag="AGL136C"
FT                   /product="COP9 signalosome complex subunit 9 "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="signalosome"
FT                   /protein_id="AAS54355.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008180"
FT                   /db_xref="HOGENOM:HBG124593"
FT                   /db_xref="InterPro:IPR016806"
FT                   /db_xref="UniParc:UPI00002533DA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750S5"
FT                   /transl_table=1
FT                   /translation="MIRQEVLHAVLDPKAVHFKQFWLSSVDRDESELLEVLCFGNYGDL
FT                   NAIQSCEEWKDAIESKLRTLTLLGLCEVPSELEYDQAMASCCIPDDVILEQRMVELQAQ
FT                   VHFQLDSVGRRIKVLRCLGARDIYNGERPLLLLRDAARSRESTLAGLRQWKQKLQYQLR
FT                   "
FT   CDS_pept        770714..771979
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750160"
FT                   /locus_tag="AGL135W"
FT                   /orf_name="AGOS_AGL135W"
FT                   /product="AGL135Wp"
FT                   /protein_id="AAS54356.1"
FT                   /db_xref="HOGENOM:HBG059815"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="UniParc:UPI00002533DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q750S4"
FT                   /transl_table=1
FT                   /translation="MSSILYNANSRLVVKYQKKYQLATSSLESEDEGQDEPFSSTHPKD
FT                   SREYLLDLCCNVYPKHLSSRLQTLPDWSLAIHALVALLFKNFVKTWYGEKIPTTDDALL
FT                   VLLFDICDETIKNIHASEVNWSQILWNDIPQILDSHMGAMSQVMTEHLTYSEFEQLNLY
FT                   KGQYPGCLVAKINEISHNRSELQRAFLDGFIGDLILGKIVSKTVAPFILIDIIRSTCDK
FT                   LLLIHDVEVTVHVEADLKSRIWSKITKAFKLIQDEQVPDMKAAVPIGHSYIFTFFKNMF
FT                   SLERRKPTVYSLVKAVQILVDKVYPFSYLALKLVGCVNRAILNNSTIQHASIAFRHALF
FT                   PKDNKMAPGKLEPTEEEFLILKVECIKSLWNVCAKYRLPTVLGLKKQDVEDFVEAICYD
FT                   ARMNQFLIYRISECLLGRLTEE"
FT   CDS_pept        complement(771930..772712)
FT                   /codon_start=1
FT                   /gene_family="HOG000115801" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750161"
FT                   /gene_name="PUS5"
FT                   /locus_tag="AGL134C"
FT                   /product="Pseudouridylate synthase PUS5 "
FT                   /EC_number="5.4.99.-"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS54357.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG059816"
FT                   /db_xref="HOGENOM:HBG202484"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI00002533DC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750S3"
FT                   /transl_table=1
FT                   /translation="MNRWAVPILHEHKHYYIVNKVHGIVCQPPDLRTWYKYHDYEPPVL
FT                   LDLLRKQHPNFGGEVWRTVHRLDEPVTGGVLVSRNKRAAAMFSRSLALGGNRGFPLTRR
FT                   YVALLAREAKGLPSEGRITMGDMITDYKRLENDLVLLQLQTGRKHQIRKQMAQVFGQPV
FT                   VNDKMYGGDSVDGIVDNLIGLHSAFIGAQCGLQARTYLIPIPRTQDAFKLWDKYIDEQG
FT                   GFIPSVQKELRDFSLPSKLENTITLLSGGQGGIQISYK"
FT   CDS_pept        773041..777480
FT                   /codon_start=1
FT                   /gene_family="HOG000154264" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750162"
FT                   /gene_name="SCC2"
FT                   /locus_tag="AGL133W"
FT                   /product="Sister chromatid cohesion protein 2 "
FT                   /function="binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54358.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG059817"
FT                   /db_xref="HOGENOM:HBG203190"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00002533DD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750S2"
FT                   /transl_table=1
FT                   /translation="MSTFPGEDTRIPKRISEALSHQPLNHLVPKRELSRLLSKPVQISV
FT                   QLESEDAFEEVPEELWQYPHPIDLDPLRLEESQPLRFRRPRGARLDYREDSSEIADLPG
FT                   MGQLARACLSGTQLVDSAAIVESIESNAKKRKQTLAIGDVEMVSPDKKTKVMASVSPVS
FT                   LNRVALGSQHLKTLERLMQYIGADESSAEFGDFEYWITLEDRATHILSEQCIDKLHIVF
FT                   RNILSIPAVWTELDVSLLQRIMDVCVSTITICLEKIELKEYSHDYTLIAFGSSMVVFFI
FT                   FLLDQNDRRLQLEQYMMVPLQFLTFTADNLEEEFDRGGNGVERSLAMLHSTLDVFYMYI
FT                   SNKPKLDDGLVVKLVYMFTELIMSTWSHNVSSVSLQNHIGNVKTIGMKSIEVLFEKLPE
FT                   QRLFIIDELLSHLDNLPNTRSQKRMKNIGKNLHITHFSYIMLSILQVWNNYDYCSNLVS
FT                   PDTEQLHDLIAHHAATQSDLEFAADHIIDTILKKCFSNISKYRFVFDQFVTDMTTVVTL
FT                   PDWPVSDLILARLLKKLLSIFNPQSQKHINIESVALQGIGLIGSTILDIRLSSNSNPTA
FT                   NLIHLFNYPEDIDGLFKAYRTCLAYCTNSVQHHTPYKFLWCKQLDVLTKLKEMDKESQG
FT                   WGSKLQQKFLSLIESIHLPLEQAANLGAVEILPTYCSTLLTSELINMYEPYLKLVLSLL
FT                   ERHKVKLRSGAIRCLALLISKDKNMLYTPIVKETIENRLTDSSPLVKDAILELIELGSS
FT                   YIDFYQHININYNDDSMLVRKHVLRMNQIIYDDTEDIIIKAYVASRILRRIEDEEDVII
FT                   ETARSELLKRWILSIQCPNAKPELQIKNCRVSIRVIAQLLVGGDKICDLFEHFLIFYVL
FT                   NKNAHTEDQNKLISSSLCLLTDQVIEMVIENEAADVDNQREEEGRNIMKFLSVLSSCQD
FT                   SFITKDHITALYPYLHSDTKSDFQLHILKVYRNTFEQLSHFKPKFLYDLETTILSRLPR
FT                   MNVRELDEAIPLSWSLSRHRKDDTRICKACASCLGQLSPYIANATTDPSAVRPDGKLQR
FT                   LLYLATGFARFCSFENTEGKFPNLKTRENIFEYVTKCLLMFTKENIHHVIRRIATKNLV
FT                   KIASRYPKLFNSRHVLTVLDTQFEKGILDIQLVVLESLYDFFLAEERRSLIQVGVDGTI
FT                   SSNNELRKVVANHTKSDSINDGICSALVSRYLDKILKICLIADLNNAMVAIRFLKQILT
FT                   YGYTNPSLCVPTVIALTASPNSYMRDLSSEMFSELLQGYESMAFNCLNQGIRLGTEYAV
FT                   KIRPKQFHEDSMFLRRLQQLMSTNKRNRSKFLKVVKKTVFSNYLSTSVNYEESCYHIIY
FT                   LLHNLSKISYDNMLELYEMLRSVISVSEYFSDRISERLDGFQSNQNTAAEVSAIIVTRL
FT                   SIEEFKRFMFEQHHLSEAKLTLLDATDDENLRNKSVAALDDQVGSLHMENIFLGYENPI
FT                   NNKDYCWKYISTLHRDEI"
FT   CDS_pept        complement(777498..778748)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750163"
FT                   /locus_tag="AGOS_AGL132C"
FT                   /product="AGL132Cp"
FT                   /protein_id="AAS54359.2"
FT                   /db_xref="HOGENOM:HBG059818"
FT                   /db_xref="UniParc:UPI0001DB2BA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q750S1"
FT                   /transl_table=1
FT                   /translation="MAGNGRVLRSNLKARKSGGDDDERFNFDTVEHEIDPYVPLRIVQT
FT                   ARAPLLDLDLESGATRAQIRNMLLEVEARTLGDGGRSHIEDDDVYESYHRKMFKQETRM
FT                   INDDKVESENGAERLQHISEALELPGWEQVLQQITVIGDASDAKELESKRKKTQIAIAD
FT                   MLTKFRDMKRRINVHSRNYRHAMCNVMSNPSLLYRKVDRTMVLGYTSSSDEEEEDMDIE
FT                   QIRRRRRLQREKKFAGSLVIQLTNTTKMNARYAIVAEPLRAPYVIKYTREERNHYRKLL
FT                   QDGPARFTFLTPLEDQVAIFKCRKMIPLTLDPVALRPVNDSESDVAHCKSLSTLDQIRR
FT                   FRVMESNSIDATVTCHTVASPSANTVENKPSSSSLLPHKRSLSPKSSSRLDKRRQLAGL
FT                   QEFSATAAVSAPDDKLS"
FT   CDS_pept        778920..780383
FT                   /codon_start=1
FT                   /gene_family="HOG000065946" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750164"
FT                   /locus_tag="AGOS_AGL131W"
FT                   /product="AGL131Wp"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAS54360.2"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG059820"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0001DB2BAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q750S0"
FT                   /transl_table=1
FT                   /translation="MLKPRRRETGLLHNLNPLEPFGAKIERDTRHWMQRAGGVKILWRY
FT                   LALLAVLWFVLVHYYERTVVARALRQCMWTWEPWPTEATPHRVALLADPQIMDEHSYPG
FT                   RPQFVNWLTQQHLDNYHRKNWVYMHAELNPDSVIFLGDLFDGGRDQDQEHWTKEYQRFM
FT                   RIFEPRPGTLTVTSLAGNHDIGFGDSVVDSSLQLFRAFFGEPSKAIDVGNHTFVLLDTI
FT                   SLSNKKDLDISAKPKAFLETFDVHVQKYPRILLTHVPLWRNVREQTCSGPRESKIPFPA
FT                   MYGYQYKTLIDSSLTDVILSRVQPEIVFSGDDHDYCQIKHVYQANGKSKNTEEITVKTC
FT                   AMNMNIKRPAIQLLSLYNPEEPLQDPDDPSSTLKTYKTEICYLPSPYKAIKVYILFYIL
FT                   SLALLIWMNMYPSSFNARIGFKLSRWMGTSAKPLLPISAKQTAKDRKSALQGMMFTITS
FT                   SGGVPTVVANTAVLTILVFLIFAYHYRSI"
FT   CDS_pept        complement(780442..782937)
FT                   /codon_start=1
FT                   /gene_family="HOG000248789" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750165"
FT                   /locus_tag="AGOS_AGL130C"
FT                   /product="AGL130Cp"
FT                   /biological_process="exocytosis"
FT                   /biological_process="vesicle docking"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54361.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0048278"
FT                   /db_xref="HOGENOM:HBG059821"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="UniParc:UPI0001DB2BAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q750R9"
FT                   /transl_table=1
FT                   /translation="MNTIYELDDQWKKVLTLDNFLGGLTVNEFVQQLSKEHAPSSLSSS
FT                   ANGNSNRDSTFDQLDPKPYIRTFESVLRELKKLKVECESNKVHLNQEVTESELAHARNV
FT                   LQLNERFKAIVSNYDALDEKLSSVTQVVAPLGEKLEKSMRAKNSYVKSAELISFYKDFH
FT                   LEGTSANLESLRTSSDWREKAQAAILVKQLLVLTRKIDTKSLPKTIETTSALEEYASAM
FT                   ETELLDSFNLAYRNNDFDKLNEIALILKHYNGGVNVIQSFINQHEYFADAELIKQNEAD
FT                   VAVFSNSALTEKLTNAEEHDMFYPKTLVESLSSMEEIVKAEAEIVRRVFEERAPVVMKL
FT                   FLKQLMAKRVEPKATLFLNTSMTISNLAYLRTLHSVYSLINQFIKDLSEFFIEMNWDTN
FT                   NSLASALDQCFTEIFSKIVFDRVKYFDVEKKCLESILIHMTSDFNTYHEREIRARHLTA
FT                   KLSASGDVKAELTTYSIQGSNSKLSKVNSFIRSHLERDKKNAARSPPLRQPTDNSPPPD
FT                   YTDLTHDEDPLFTLSCLDTMLKCAVESLARMMELIPTNSSDFCVELVEVMLLGLISSYV
FT                   ESALEAAYSQLISSDPAQTTNLNLSYMKYVSKTTEMLSLISASIKAIILPLLNNSPQAK
FT                   KDIIKLANAYLKRAELAINIILEDTVQMVDQRFTIVLLKQNKKDFVPRSQELLDQDTVT
FT                   GSELVTMLYSIHSQASRHLNNANLKSFLTEVGNTLYERLLQHYKKFYVSSIGGVIVTKD
FT                   IIGYQNAIEEWGIEELDEKFALLRELANLFTVQPELLESLTKEGRLVNIGRNIISEYIS
FT                   RREDFNNDSFRTKFRMNLM"
FT   CDS_pept        783106..783702
FT                   /codon_start=1
FT                   /gene_family="HOG000171916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750166"
FT                   /locus_tag="AGL129W"
FT                   /orf_name="AGOS_AGL129W"
FT                   /product="AGL129Wp"
FT                   /protein_id="AAS54362.1"
FT                   /db_xref="HOGENOM:HBG210883"
FT                   /db_xref="HOGENOM:HBG627010"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI00002533E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q750R8"
FT                   /transl_table=1
FT                   /translation="MAAERVAQSEDKLTASGSDDEALDELLESLENDDSFLDRYREQRT
FT                   EQLAQHFREARQNAASGDYGQLHTLEDEGALLALSTRTARVVIHFYLETFPRCQTMDSK
FT                   LRKLAAKHMHTRFVRISVEKCPFLVQRLGIKVLPCVISYRDGLERDRLVGFQDLGNQPE
FT                   DFPLAALERRLASIGMLPSGADALTVNRIDRDHDY"
FT   CDS_pept        783918..784376
FT                   /codon_start=1
FT                   /gene_family="HOG000233943" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750167"
FT                   /locus_tag="AGL128W"
FT                   /orf_name="AGOS_AGL128W"
FT                   /product="AGL128Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS54363.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG348259"
FT                   /db_xref="HOGENOM:HBG713462"
FT                   /db_xref="HSSP:1AAR"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI00002533E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q751A8"
FT                   /transl_table=1
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKHKKVKLAILG
FT                   LFNVDAEGKVTKLRRECPTETCGAGIFLADHKTRHYCGKCHATFMKKD"
FT   CDS_pept        complement(784702..785925)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750168"
FT                   /gene_name="ATC1"
FT                   /locus_tag="AGL127C"
FT                   /product="Protein ATC1/LIC4"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54364.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG059822"
FT                   /db_xref="UniParc:UPI0001DB2BAC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751A7"
FT                   /transl_table=1
FT                   /translation="MSVEGKNVDSYSGLTASVQHEHTHPVHNRGVALETTTQHAFITVA
FT                   SQLKPDLKGEDEEHNLELELHKFLSQHNHGPPSSGTTGTTLAGVPDFSASHNISHRDEM
FT                   AEAIEKAMAEIACPELWNNDHSSAGATVGGDVHLDTLTMDGILGNEEPFVQVHEGALGS
FT                   VDMDGQRYPHGRNSLSSIVGSKAIIQQSMDIHPTAQGGARSRQSTEEVGMHICATPNGK
FT                   RKNAGVASSQATVKRSRLFYETISPESLSPLSDNSDFLKAMDTKGSGVQNVPISTSVTA
FT                   GALGHGAKNIKGYQNASKINMASNIPKEKLQVHSTPPVVSILPEKLTQEFTMQQVMETK
FT                   RRIINTHKLILNFNFLKESYTRSCSELKRTVFKLKESECHRARLAKENEQLKRLVIELN
FT                   ERMKNPSK"
FT   CDS_pept        complement(786364..787032)
FT                   /codon_start=1
FT                   /gene_family="HOG000187596" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622492"
FT                   /locus_tag="AGL126C"
FT                   /orf_name="AGOS_AGL126C"
FT                   /product="AGL126Cp"
FT                   /protein_id="AAS54365.1"
FT                   /db_xref="HOGENOM:HBG494750"
FT                   /db_xref="HOGENOM:HBG602019"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniParc:UPI00002533E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q751A6"
FT                   /transl_table=1
FT                   /translation="MKLFQNRCEFAYPWEEVTEAHWKKYPNEMSTHVKATDVLRRELDP
FT                   TGRKLVSERLITVQQSAPRWVMMLVGGTNISYVREVSTVDLDSQTLTLRSVNLTYANLL
FT                   KVCETVTYSRDPVDPARKTLFEQEAQITAYVPFARVCNQLEEWSVQRYHDNAEKGKRGF
FT                   ETVLKALSRRWDQGERYVEDISSTIVTKVNETVDDLLGADENSLLSRYSAILEAAFQPT
FT                   "
FT   CDS_pept        complement(787240..788343)
FT                   /codon_start=1
FT                   /gene_family="HOG000248576" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750169"
FT                   /gene_name="ERF2"
FT                   /locus_tag="AGL125C"
FT                   /product="Palmitoyltransferase ERF2 "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54366.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059823"
FT                   /db_xref="HOGENOM:HBG396038"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniParc:UPI00002533E5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750R7"
FT                   /transl_table=1
FT                   /translation="MRLHSRQASNPHRQYSAAQSLHSSSDDSEHKEIPSTMGWAKRLMR
FT                   WMVTVDQPHTFETSLKNYQSLAHVTNYIFFCGGRLRTVAKTKYLSVLVLVMLIAPIVLF
FT                   SVFETGYLWKHVAGAKPCVVLCYYFWTLCFASFISTGATDPGTLPRNIHLAQLQDDYKL
FT                   PLEYYSIITLPSPVANAPVRLKYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCI
FT                   GQRNHRYFLAFLFSSVLSSIWLLTCCALKLRHAGSPSAAPVSLLLICYCAVSIWYPLLL
FT                   AIYHLFLTGTQQTTHEYLKAVDSRNPIFHKVTHPERNPFVTGSCARNMLLLMCQPRGYD
FT                   FLHTRSEHQAGDWRFFRLPIPHSFEKV"
FT   CDS_pept        complement(788774..790870)
FT                   /codon_start=1
FT                   /gene_family="HOG000141886" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928053"
FT                   /locus_tag="AGOS_AGL124C"
FT                   /product="AGL124Cp"
FT                   /protein_id="AAS54367.2"
FT                   /db_xref="HOGENOM:HBG059824"
FT                   /db_xref="UniParc:UPI0001DB2BAD"
FT                   /db_xref="UniProtKB/TrEMBL:Q750R6"
FT                   /transl_table=1
FT                   /translation="MGKEAPIRQDASKVKVKAMGSLFLLSYMDPLAFVDRRLDVFNIYL
FT                   YIDIPTIDYYNDEMTQAKLFRLNRRFKIHKVKDQILGSFTDGKPDVWKRLLLEREKNEG
FT                   SFKLYVCSSGSLRYVESIRFLIESCWNEVRAHTDCIRIRFYVQVTPTSQKWFTTFLNKE
FT                   ILDADILEFLLIDTYSSILSKSSIPFKEYYAKLNEKFLRPPDPFTLDSIVIVTNSTGVK
FT                   ALLTILSDRPLTSYLSQESLDSLNKTALQRNGKIVSAAEKHPEQDETPLKRNSSSIIKF
FT                   QNSLLTSNKDKAVRVRSLSLQRQSHRPQLIPMSCQSAAHVHAHSMSSGKTELKHELTEI
FT                   APADWKHTAADERELEDDDDFDDDSDMEYESSDDDGISFYVPNLLSRTATNEPDTGHDT
FT                   TCESSDPPSRRRFRSLSLMDPPSRAPFSQCMPPPLEHIEDEMCSPTVNNEWYTNIYVHD
FT                   GHFGEHSATNQAKRPKRSLRQECSANGLIPPEFYSRLSSPSSSNNSSNSSLQNLHLLPG
FT                   TFAKLLSIHSNSSSEDKKASPSSSTLFDKRLVSKSFDEVRRQPSIQLFQTLMNGNGLAL
FT                   NFRANKPLPSPSYEGECPTPRETEDSDANKTLQQSQPGSVATIFNSDKVSQTLNKFNLQ
FT                   IYNSDNGTSLSQLAVPDPVGSTSHFASPSKPSQPFRKPKFTLDLYGDDDIANKGAWVLG
FT                   ANNR"
FT   CDS_pept        791404..791823
FT                   /codon_start=1
FT                   /gene_family="HOG000014707" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775038"
FT                   /locus_tag="AGL123W"
FT                   /orf_name="AGOS_AGL123W"
FT                   /product="AGL123Wp"
FT                   /function="cytidine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54368.1"
FT                   /db_xref="GO:0004126"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124758"
FT                   /db_xref="HOGENOM:HBG352939"
FT                   /db_xref="HSSP:1ALN"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI00002533E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q750R5"
FT                   /transl_table=1
FT                   /translation="MPSTQGEPYQGAVARALAAKELSYSPYSKFRVGCCILTASGEYIV
FT                   GANVENASYPAGICAERTAVVKAVTAGHTNWVCIALSGDSSDVVTPCGICRQVLREFVD
FT                   PKKLTVIMMNADGSKVLQRTLEELLPYSFGPDSLR"
FT   CDS_pept        791980..793092
FT                   /codon_start=1
FT                   /gene_family="HOG000030427" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750170"
FT                   /locus_tag="AGL122W"
FT                   /orf_name="AGOS_AGL122W"
FT                   /product="AGL122Wp"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS54369.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG233109"
FT                   /db_xref="HOGENOM:HBG299384"
FT                   /db_xref="HSSP:1O0X"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniParc:UPI00002533E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q750R4"
FT                   /transl_table=1
FT                   /translation="MTTVYCASLQCGKATDSALKCPLCLKQGIQSVFCNESCYRDCYKS
FT                   HKALHIKDDSDKSYDPFQNFKYTGELRAQYPLTPKRAVPDDIEKPDWAANGLPLSEQRN
FT                   DRLNKIPVYNKEEIKRIRKACMLGREVLDIAAAALRPGITTDELDEIVHAETIKRGAYP
FT                   SPLNYYNFPKSVCTSVNEVICHGIPDKYVLKDGDIVNLDVSLFYQGMHADLNETYYVGD
FT                   NISKEALNTVETARECLKIATKMCKPGVRFQDLGDAIEKHAKQNKCSVVKTYCGHGVGK
FT                   FFHCSPSIPHYANNKTPGVMKPGMVFTIEPMINEGVWQDLTWPDDWTAATKDGKLSAQF
FT                   ENSLLITETGVEILTARTKKSPGGPRPRTK"
FT   CDS_pept        793249..794949
FT                   /codon_start=1
FT                   /gene_family="HOG000226733" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750171"
FT                   /locus_tag="AGL121W"
FT                   /orf_name="AGOS_AGL121W"
FT                   /product="AGL121Wp"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54370.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="HSSP:1A6D"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012722"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI00002533E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q750R3"
FT                   /transl_table=1
FT                   /translation="MKKRHCIERSASEKNKPQHHSYMSVQLLNPKAESLRRDAALKVNV
FT                   TSAEGLQSVLETNLGPKGTLKMLVDGAGNIKLTKDGKVLLTEMQIQSPTAVMIARAASA
FT                   QDEITGDGTTTVVCLVGELMRQAYRFIQEGVHPRTITDGFEIARKETIEFLEQFKVTKD
FT                   GEDGLDREFLLQVARSSLSTKVNAELAEVLTPIVTDAVLAVSDINTNALDLYMVEIMQM
FT                   QHLTPKDTVFVRGLVLDHGGRHPDMPNRVENAHVLILNVSLEYEKTEVNSSFFYSSAEQ
FT                   RDKLAASERRFVDEKLKKIIELKNEVCGLNSDKGFVIINQKGIDPMSLDVLAKHGILAL
FT                   RRAKRRNMERLQLVTGGEAQNSVDDLSPSVLGYSGLVYQETIGEEKFTYVTENKDPKSC
FT                   TILIKGSSHHALAQTKDAVRDGLRAVANVIKDKAVVPGAGSFYIAAADHLKKANHAQLG
FT                   AKGKTKTGLQAFAEALLVIPKTLVKNSGYDALDVLALCQDELEEDSTRSVGVDLSSGDS
FT                   CDPTIEGIWDSYRVIRNAVTGATGIASNLLLCDELLRAGRSTLKEGPAH"
FT   CDS_pept        join(795196..795238,795332..797217)
FT                   /codon_start=1
FT                   /gene_family="HOG000199564" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079294"
FT                   /locus_tag="AGL120W"
FT                   /orf_name="AGOS_AGL120W"
FT                   /product="AGL120Wp"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /protein_id="AAS54371.1"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG359924"
FT                   /db_xref="HOGENOM:HBG435256"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniParc:UPI00002533EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q750R2"
FT                   /transl_table=1
FT                   /translation="MSPDSNSSLRERQIAAIEKLLVLNAANASTDLTSGLDDQELVWKA
FT                   LVLDAKSTAIISSVMRVNDLLRSGITVHYSITQNRAPLPDVPAIYFVQPKKENIDLIVM
FT                   DLKGDKYADFYINFTSSLPRDMLEYLASEVASLGKASRIKQVYDQYLDFIVTEPELFSL
FT                   ELPETYLKINSPVSSEDTITQLCDTIADGLYNVILTLDSVPIIRAPRDGPAEMVAQKLD
FT                   SKLRDYVINTRSNTNSSTNTNLERFVLVILDRNIDLPSMFAHSWIYQCLVFDVFNLSRN
FT                   TISVPNTDEKGQPTYKKMDIEPKDFFWTTNAHLPFPDAVENVENALADYKAEAEAITRK
FT                   TGVDNIGDLDPNSQNDTLQIQEAVNKLPELTARKNIIDTHMNVLAALLKELENKGLDSF
FT                   FEMEQQSDSAKVRQAFMDVLKDGKTNNLKDKLRTYIIIYLTSSEKLPDQFVQHVESYFK
FT                   DNNFETPALKYIYKLKELANISSMPLRSEPAIHDSKVQVGAGNSSQLLSGLSNKLLGLT
FT                   EGKIQGGVGSLISGMKKFLPEKKAIPVTNALASVMDPLNSSQSSLEATDDYLYFDPRVM
FT                   RGAHSQKPKRQSYNKALVFVVGGGNYMEYQNLQEWAHQQGSSKKVIYGSTAIITPSSFL
FT                   EELSKLG"
FT   CDS_pept        complement(797396..798775)
FT                   /codon_start=1
FT                   /gene_family="HOG000190885" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079295"
FT                   /gene_name="RVB1"
FT                   /locus_tag="AGL119C"
FT                   /product="RuvB-like helicase 1 "
FT                   /EC_number="3.6.4.12"
FT                   /function="ATP binding"
FT                   /function="DNA helicase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54372.1"
FT                   /db_xref="GO:0003678"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG015017"
FT                   /db_xref="HOGENOM:HBG749829"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="UniParc:UPI00002533EB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750R1"
FT                   /transl_table=1
FT                   /translation="MVQISEVKDQVPGSSAGARTAAHTHIKGLGLDEFGAAKQVEGGFV
FT                   GQVEAREACGVIVDLIKAKRMSGRAILLAGGPSTGKTALALAITQELGPKVPFCPLVGS
FT                   ELFSVEVKKTETLMENFRRAIGLRIKEVKEVYEGEVTELTPEEAENPLGGYGKTISHVI
FT                   VGLKSAKGTKTLRLDPTIYESIQREKVSVGDVIYIESNSGAVKRVGRSDAYATEFDLEA
FT                   EEYVPLPKGEVHKKKEIIQDVTLHDLDVANARPQGGQDVISMMGQLMKPKKTEITEKLR
FT                   HEVNKVVAKYIDQGVAELVPGVLFIDEVNMLDIEIFTFLNRALELEIAPVVVLASNRGM
FT                   TTVRGTEDVVSAHGIPPDLIDRLLIVRTLPYTQDEIRVIIEKRSKVENLQLEQAALDLL
FT                   AAMGSDMSLRYALQLLTPAGILAATAGRTEILLSDIEEAKMLFLDAKRSTKILESNSNY
FT                   L"
FT   CDS_pept        799134..800378
FT                   /codon_start=1
FT                   /gene_family="HOG000111204" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079296"
FT                   /locus_tag="AGL118W"
FT                   /orf_name="AGOS_AGL118W"
FT                   /product="AGL118Wp"
FT                   /function="NAD+ binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="AAS54373.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG059825"
FT                   /db_xref="HOGENOM:HBG203195"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI00002533EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q750R0"
FT                   /transl_table=1
FT                   /translation="MSATRHAAGQPRVQQAAEVCGTCGMTEATGGIGVKRYRSPMKVKL
FT                   PITPPSSVKKKQTEACDSGPSVSEEVTPKELLPALRKARAPVRRKPRLTYRPATNSVFQ
FT                   LAHYVSDPELVSARDADFIRYALQHSRDIVVVTGAGISVAAGIPDFRSSDGLFATLRGG
FT                   KVKSGKHLFDFNHVYSSDDMSMQFNRMIVDIHGKSQRFEPTEFHRLLDGLAQQGRVRRI
FT                   YTQNIDCLENKLANISSLQTGPKQVPKTIQLHGSINHMCCNKCRKIYDMDPTLFKCGDN
FT                   DTTGDVIPVCPECEELEAVRRIAGKREQGVGKLRPYIVLYNEVHPEGEKVGEIVAKDLR
FT                   LKCDCLIIVGTSLQIPGVKTICRQFCQAVRARKGIVLWVNKELPTQAIQDFLGGMDLII
FT                   VGDCQDLTTLAPSFN"
FT   CDS_pept        complement(800474..801289)
FT                   /codon_start=1
FT                   /gene_family="HOG000207661" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775039"
FT                   /locus_tag="AGL117C"
FT                   /product="GPN-loop GTPase 3 homolog AGL117C "
FT                   /function="GTP binding"
FT                   /protein_id="AAS54374.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG326130"
FT                   /db_xref="HOGENOM:HBG409872"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="UniParc:UPI00002533ED"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750Q9"
FT                   /transl_table=1
FT                   /translation="MSRVGVLVLGPAGAGKSTFCNGIISYMQSVGRRAHIVNLDPAAEA
FT                   SEYEFTVDIRDLISLDDVMEELSLGPNGSLVYCFEYLLENLDWLDEEIGDYNDEYLIFD
FT                   CPGQIELYTHIPVLPTIVRHLQNQLNFNLCASYLLEAPFVIDTSKFFSGALSAMSAMIL
FT                   LELPHINVLSKVDLIKDEYSKKRLKRFLNPDPMLLVDSANADTNSKFHQLNKAIANLVD
FT                   DFGMVQFLPLEAKNPDSVSTILSYIDDITQWGEAQEPKEPNDALEIEDM"
FT   CDS_pept        complement(801440..803008)
FT                   /codon_start=1
FT                   /gene_family="HOG000074556" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750172"
FT                   /locus_tag="AGOS_AGL116C"
FT                   /product="AGL116Cp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54375.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059826"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI0001DB2BCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Q8"
FT                   /transl_table=1
FT                   /translation="MSNYRNKQPCKYFQQGRCNKGNACNFAHVHSGGASSGSGGGKSEA
FT                   ERYSEFVSDGALERWGNMVSSDMGDVALFQTRPLLSSYAPTDVAAVNLIQGRDLSAEES
FT                   RFQWWEAMAQGKKAQYDAAMAARAKDIEKCVAYVKSNAKKGARFLQLATKRFREQGTYP
FT                   SKPFIEHELDLTGGSGFGAAPLGGGGAFGQAAFGSTGGTMAASAFGQPAFGPPPTAGGG
FT                   LFGSTPAAGGGAFGSAPAAGGGAFGQPAFGASASAATGAFGSGSTTTSAFGSPAFGSGA
FT                   TPTISGAFGKPAFGTAGSGATGAFGKPSFGTGATTSPFGTFGAQTAVNAAPATTSNAFG
FT                   QPAFGSAGFGAQPTPAFGTGALPAKPFGFGATASTSTTTAVPFGANSSGMGGTTSAFGQ
FT                   PPGAAKTGSTFGSAPASASIGFGGKVPSQQALSPFTQQAIGSSSSPFGGAGTTNTPFGS
FT                   PQQPFGSAKTVQSTGTTRPVQGLPTADDKITEDELPREILDAFKAERFTLGHIPGVAPP
FT                   LTLIH"
FT   CDS_pept        803157..804056
FT                   /codon_start=1
FT                   /gene_family="HOG000246756" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750173"
FT                   /gene_name="ARV1"
FT                   /locus_tag="AGL115W"
FT                   /product="Protein ARV1"
FT                   /biological_process="lipid transport"
FT                   /biological_process="sphingolipid metabolic process "
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54376.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006665"
FT                   /db_xref="GO:0006869"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG192590"
FT                   /db_xref="HOGENOM:HBG202508"
FT                   /db_xref="InterPro:IPR007290"
FT                   /db_xref="UniParc:UPI00002533EF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750Q7"
FT                   /transl_table=1
FT                   /translation="MICINCCCHVESLYVAYPGDHIRLTDCWQCGEVVDRYVEFDNVLL
FT                   FIDLLLLKPGAYRHLVYNSLEVDMRRYPEHGTRESGFRGYVQDWLLWFRKYDRLNRIWL
FT                   LLITFEVYLMWMTEEKKYNNYYREPATQYGWHLLTGDVLSLQNPLLQYLFFAVYVIGDL
FT                   ALLHKLTRESLLNWSQWGQDLRYAKDIVSYTILLSYGAKIFPILMLIWPYDSLVSTSII
FT                   KWIANFYIVESLRIVTSKSYSYIILLFAGIFIVRSVVLKPVLALIVSRGNMLQAQRYLW
FT                   GEYELFKFRFLTKRDIFL"
FT   CDS_pept        complement(804116..806476)
FT                   /codon_start=1
FT                   /gene_family="HOG000212982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750174"
FT                   /locus_tag="AGL114C"
FT                   /orf_name="AGOS_AGL114C"
FT                   /product="AGL114Cp"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54377.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG051360"
FT                   /db_xref="HOGENOM:HBG395921"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="UniParc:UPI00002533F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Q6"
FT                   /transl_table=1
FT                   /translation="MWNNLAAEGHMASHTGIFEPMRNNTSPDFRRPTTRIVTTQLTIAL
FT                   SLGLFALVSFSALLRKFPKLYASRKYKVQGLPDWDQGSLFGWLPVLYRITDEQVVEYAG
FT                   LDAFVLLGFFKMSIKLLAVCCFISMTVISPIRYKFTGRYDDGNDDDDDSRGIYRRLFAA
FT                   MTAVEPEHDTGPERAEVYLWMYVVFTFFFTFLALRMLMIQTELVVRTRQRYLGRQNTVT
FT                   DRTIRLSGIPVQLRDEEGLKKRIEELNIGKVSSVTICREWGSLNRLFHYRQLVLRELEL
FT                   KLSDCPQELRYEELYSREEFSLRGRVSGAPAEDAIEQSQSSEDQSRGENEHLYNEIQLK
FT                   GRPKMRIGLFGWFGEKVDAIDYLSQKLRFIDEEIKQARTKHYSATPTAFITMDSVANAQ
FT                   MAAQAVLDPRVHYFIARLAPAPYDLKWDHVCLSRRERLIKSYSVTLFIGIFSIFWIIPV
FT                   SYLATLLNIKTISKFWSSLGKFLEDNQWAENIVTALLPTYIFTLFNFGIPYLYERLTEH
FT                   QGLVSYSEEELSLVSKNFFYIFVNLFLVFTLAGTASNYWAYLSDTTKIAYQLATSVKEF
FT                   SLFYVDLIILQGIGMFPFKLLLAGSLIGFPFVKITCKTPRQRRELYNPPIFNFGLHLPQ
FT                   PILILLITIIYSVMSTKILASGLAYFIVGYYVYKYQLIYATDHLPHSTGKVWPLVYRRV
FT                   IMGLLIFQLTMAGTLAGFQGGWILSSCLAPLPLITISFLWDFEKNYLPLSQFIALSSVR
FT                   EHERDSNGSCELAECENFEYPHLVSPLQGPMLD"
FT   CDS_pept        complement(806736..809348)
FT                   /codon_start=1
FT                   /gene_family="HOG000174003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750175"
FT                   /locus_tag="AGL113C"
FT                   /orf_name="AGOS_AGL113C"
FT                   /product="AGL113Cp"
FT                   /function="1-phosphatidylinositol-3-kinase activity "
FT                   /function="binding"
FT                   /biological_process="phosphatidylinositol-mediated
FT                   signaling"
FT                   /cellular_component="phosphatidylinositol 3-kinase complex "
FT                   /protein_id="AAS54378.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005942"
FT                   /db_xref="GO:0016303"
FT                   /db_xref="GO:0048015"
FT                   /db_xref="HOGENOM:HBG025547"
FT                   /db_xref="HOGENOM:HBG320338"
FT                   /db_xref="HSSP:1E8X"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR008290"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI00002533F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Q5"
FT                   /transl_table=1
FT                   /translation="MPSQSVTFVVSQELNIPLKIKISSLHGTKKLLQPSQRFTHPELTQ
FT                   RTSNMRLNSDMFVSVQVFDRERNRALTTPVHTQYVPFKTGRVWNQWLTLPIYINQLDRN
FT                   STLQITIWEYDAANCIEFATLKTPVFSDADCTLKRGREALHFEYGAPESSRVEGDAIQG
FT                   LLNKYDQGGIKAIDWLDSLTFKKLESMQREADLPKGTFRLNIEFPLFELPVVYTEATNT
FT                   NVQKNIPTLNNFEPPSETIESKMDSQAKISVGSPRQSTLKFYDLDQYNVDVIEEKFRRL
FT                   ERSSKSSNLDRELKPDAKKRDILNHIIAYPPCTSLTPHEKGLVWKYRYYLVNNKKALTK
FT                   LLQSTNLAEENERKEVLDLMDLWAEIDIDDAIELLGPVYKNLSVRSYAVNRLKKASDTE
FT                   LELYLLQLVQAVCFESSSTWSDKSNSAFTIVHMDQSKNGNCTPKSLTPHMTASLDSLDR
FT                   SDVESNGAESSIVISPLAEFLIRRVVNNTRLSNYFYWFLKSESKGTQYLVHILDSFLVR
FT                   LSQESRGQIEDQVQLVNLLKECCCEVKQLKDTTPKKHELLHYLMLSKVRPFLRATNVAL
FT                   PLDPEVVAVDVVPEDCKVFKSSLSPLKITFKTKDARKYSLMFKVGDDLRQDQFVVQIIT
FT                   LMNALLKNENVDLKLTPYRILATGHNEGAIEFIPNDTMANILSKHHGILPFLKSNFPDR
FT                   GEPLGVQDWVMDNFVKSCAGYCVITYILGVGDRHLDNLLIAPDGRFFHADFGYILGRDP
FT                   KPFPPLMKLPPQIIEAFGGAESNNYNKFRSYCFVAYSILRRNAGLILNLFELMKTSDIP
FT                   DIQMDPDGAILKVKEKFCLNMSEEQATVHFQNLINASVNALLPLVIDHLHNLAQYWRS"
FT   CDS_pept        complement(809625..811601)
FT                   /codon_start=1
FT                   /gene_family="HOG000113654" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775040"
FT                   /gene_name="MSS116"
FT                   /locus_tag="AGL112C"
FT                   /product="ATP-dependent RNA helicase MSS116, mitochondrial "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="regulation of translation "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="AAS54379.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG059827"
FT                   /db_xref="HOGENOM:HBG395779"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00002533F2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750Q4"
FT                   /transl_table=1
FT                   /translation="MFRVTGIATARAVALQPFRAPLGVIRRFGISATASYEFQHGHDMQ
FT                   SRNGSRWDSRRQGDRRSSRWEGRGSDREDGERGSRGGMWRKPQGRRGRTDGAAREGFSL
FT                   GPNTEVVRVADEAAGVESTPRTLVEEGVLSNELYEMLQSRGFDKLTPVQQKTLKPILQT
FT                   EHDVVARAKTGTGKTLAFLMPLFQRLLEGPPSENVKAVVIAPTRDLAAQIFNEINEMRN
FT                   ANRKLRRFNAVVMMGGSSRTETFRSLERRRPNIVVATPGRLIDMLEACGPKYFTEVDFK
FT                   VLDEADTLLEIGFKQALEQINDILNQLNQKGTTHIRTLLVSATLDDKVQSLANSIMNHA
FT                   KCLFIDTVDPNEQATNENIAQKVVISKDFADNITASLYKIREEASANPKLKAIVFMPTI
FT                   VAVEYWGELLQSQCRGTPVLLFHGGLSQGRRNSTMKRFRAMDSGILVCTDVAARGMDVS
FT                   DVQHVYQVGVPTSPDNYIHRIGRTGRAGRKGSSTIFLAEHELCILDILRRKNNVVISDQ
FT                   ETFDAAAQELSDVREAFSLDRDRLHDFLLKNLSFYRGSQGEYDFPLEAYISIARAYGTL
FT                   LGDSNQRLTLSGRMLTTFVPNHPAVCSLFNIIGPVNSKSSYGFRDTNKRHRRGRLDDSG
FT                   RLEYSKKRHSYARSYSPSISDGF"
FT   mat_peptide     complement(809628..811496)
FT                   /gene_name="MSS116"
FT                   /locus_tag="AGL112C"
FT                   /product="ATP-dependent RNA helicase MSS116, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750Q4 "
FT   transit_peptide complement(811497..811601)
FT                   /gene_name="MSS116"
FT                   /locus_tag="AGL112C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750Q4 "
FT   CDS_pept        811845..813260
FT                   /codon_start=1
FT                   /gene_family="HOG000141885" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622493"
FT                   /locus_tag="AGL111W"
FT                   /orf_name="AGOS_AGL111W"
FT                   /product="AGL111Wp"
FT                   /protein_id="AAS54380.1"
FT                   /db_xref="HOGENOM:HBG059829"
FT                   /db_xref="HOGENOM:HBG103976"
FT                   /db_xref="UniParc:UPI00002533F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Q3"
FT                   /transl_table=1
FT                   /translation="MNSVPEKINIAHAMPSSMINVMRDDIKQLQQAKELDQQQMDKVDH
FT                   YIDQLDSIFTQFCKDNEHVEKRAKGVTEADVQLFQGLKKMYADYMNQLSEIKKRKVEEE
FT                   QEFHGDKPLEYILDELPYLQPSERNRYVSALLKDKVPFSKDRKLFEGIANLCLLDGSVR
FT                   DYLQTYKCLLQSVGFTQEEILSRIPFLADDYKREGTPEPPLSSDAISQDTSSDSSNTTK
FT                   TASTAVSSLLNSSGVEPNERPEEDKKKKISFSKYLKKDVSEPVKRSLSPDDAAQPIVKK
FT                   QKVDLPVSILRDESKAKKRAVIRFVDDSKLVTVFGDDLPESGVVTSPDRLKKILNPYVE
FT                   GEPREFLLAAWKNQKVHKLIIDMGVIEDSDITESKNGPVSMSTKVPLAFRINFSKFSDE
FT                   LAGPHKEPADNEDDEQEIKNHKGKRRGGKGPIIARAFGKNALLLKKDRGGLPYKKVPEV
FT                   RRNEYPVRPEDNF"
FT   CDS_pept        complement(813439..814272)
FT                   /codon_start=1
FT                   /gene_family="HOG000020768" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750176"
FT                   /locus_tag="AGL110C"
FT                   /orf_name="AGOS_AGL110C"
FT                   /product="AGL110Cp"
FT                   /function="ATP binding"
FT                   /function="dephospho-CoA kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54381.1"
FT                   /db_xref="GO:0004140"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="HOGENOM:HBG460048"
FT                   /db_xref="HOGENOM:HBG650290"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="UniParc:UPI00002533F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Q2"
FT                   /transl_table=1
FT                   /translation="MLVIGLTGGIACGKSTVSRRLHERYRIPVIDADAIAREIMRPGER
FT                   AYQRVVERFEQRVPQLVQANGELNRAALGAWIFQHAEERQALNAITHPEIRKRIFFRVV
FT                   DCYMRMHPMCVLDIPLLFETGLDVFCGVTVSVVCDQKVQIERLLLRNAELTREEAEARI
FT                   RAQMSMEERIELSDYVIPNNDNYEVLFETVDQAVTYIKPYLLTVMLHYFLPFGIVSALA
FT                   VVLSKYYKKTVAGTSRRKRRKAKERAAKKRAAEQKAALKASQPPLYKRLLSRKAE"
FT   CDS_pept        814514..815689
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750177"
FT                   /locus_tag="AGL109W"
FT                   /orf_name="AGOS_AGL109W"
FT                   /product="AGL109Wp"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS54382.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059830"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="UniParc:UPI00002533F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Q1"
FT                   /transl_table=1
FT                   /translation="MGVPWVYMLGSAPIGRLLSFQLAKAARQPVVPHVVVLLQDANKMG
FT                   RFLEGQSRLAVHEGDQERQQQFMASCMPPVTSSGEKIGIENMVVAETGQQAFSVGLKKY
FT                   KASLTAASAVVLVNPRFGLVHHLYKHVWPEAAERPRLYLATGGQQEVWRRGEFGAELRG
FT                   RPPVRLTVSAVPRELEQYEHAGARQRLEAEVASVGLLQMLGDCCDDPAALVQPVFVTFG
FT                   AHMLGRLEQLLIAAAVEPVAALYGCSSYGELLGIKEVDRVLRALLAEGIRVIRVAFPFL
FT                   PTVEGHEAVLNVDVLYKQLLTAVQAKSARRPRMGQSIDELNITPVRTTCGFLTALARQH
FT                   KLHAPLHFLISSLARGKAELRKNRLFQQIDLEQLDAVRSTTPIAIKEHQSV"
FT   CDS_pept        complement(815677..817041)
FT                   /codon_start=1
FT                   /gene_family="HOG000001042" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622494"
FT                   /locus_tag="AGL108C"
FT                   /orf_name="AGOS_AGL108C"
FT                   /product="AGL108Cp"
FT                   /protein_id="AAS54383.1"
FT                   /db_xref="HOGENOM:HBG059831"
FT                   /db_xref="HOGENOM:HBG203201"
FT                   /db_xref="InterPro:IPR016852"
FT                   /db_xref="UniParc:UPI00002533F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Q0"
FT                   /transl_table=1
FT                   /translation="MTDKAVAKLIEWLKTSELTFISDKIEIVQDAASGRGVRLKQCHIN
FT                   SNEEIIGIPSEFQLNFHSVLHHLSQFNRKLVVPGVTVTEPEGDADAEDPRTRAYGVLDA
FT                   NTVLQLSSFQLLALYILAEWVLLKTWGCETQSFWQPFFEIFPTSADLRAIPAYYSLQFA
FT                   STSKELLPLLPPASACHCRRICELVQGDWARIRGILEQWNILFADRETITLEQQFEHFL
FT                   HIYFVINSRCLYTPVPLKDNRDDNFTMVPYVDFLNHITTVSEHCYPKVESVRRLYGGVG
FT                   RFSIKCGPHAYRVPMEEVFLNYGAHSNDFLLNEYGFTVDENEWDYIDVTEVVVSMIEKP
FT                   EHVEFLREHDYYGDYTIAFDSVSFRVLVALALVATDDYERVNKYMMGYITDDYFGPRYS
FT                   SLLLEVLQRARQFCEAALESAKKMTTADRYCTESVIAIYKGYLRILRHHLDSHTD"
FT   CDS_pept        817185..818213
FT                   /codon_start=1
FT                   /gene_family="HOG000248573" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750178"
FT                   /locus_tag="AGL107W"
FT                   /orf_name="AGOS_AGL107W"
FT                   /product="AGL107Wp"
FT                   /function="octanoyltransferase activity"
FT                   /biological_process="lipoate biosynthetic process "
FT                   /biological_process="protein modification process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54384.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0009107"
FT                   /db_xref="GO:0016415"
FT                   /db_xref="HOGENOM:HBG059832"
FT                   /db_xref="HOGENOM:HBG395385"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniParc:UPI00002533F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q750P9"
FT                   /transl_table=1
FT                   /translation="MLRYAMTPRRSIWTPLQVNQGVMVRMVMHRPILGHLSRMRYSSTS
FT                   PKDAQAITYPVTEKARVLEHIHFKKRCTFKEGLQIQELYVMHALEAKRMQSKIAQRLRQ
FT                   RAETATNTDLLLDWPAPAKCISTPRPTVLTFEFEPTYTGGKRIKKTITKDEVQALESFT
FT                   PPGSEGYPSPKFVQVERGGQVTFHGPGQMVAYIVLDLKAFHGFTVRCLVSAIERATINT
FT                   LQCAPKHEASRNATRRRNDKLGIKAIQTSENGVWIDEKRKIASLGVNVRRSITSHGVCI
FT                   NVNPTLQYLNHFTMCGLPESSATSIHELVPSATCGVGDIAATFVNQFRMLLGIEEIVRS
FT                   DI"
FT   CDS_pept        complement(818562..819974)
FT                   /codon_start=1
FT                   /gene_family="HOG000065944" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750179"
FT                   /locus_tag="AGOS_AGL106C"
FT                   /product="AGL106Cp"
FT                   /protein_id="AAS54385.3"
FT                   /db_xref="HOGENOM:HBG059833"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI0001DB2BD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q750P8"
FT                   /transl_table=1
FT                   /translation="MTSEDAQARSRLTRMRSNSKSNGSSAPPSPPAGATTVNETANSGG
FT                   NKGGGRGVLPPVRNRYTHIIVLKSLNSTFETKFLVVPFKPDGLKLGRPVVNSSGNNGGE
FT                   HGVNAKDVQPHVRPDNGHFDSRVLSRNHASLSCDGESGKIYIRDLKSSNGTFINGTRIG
FT                   QADVELKIGDVVDLGTDIDAKFEHRKISALVEDISVIPLIHEDLGTIVAGGNGNGVTGD
FT                   GIYKTAGAGIDVSHMAASNAQRAAFEAAMFGDVNNLDLEEAVLGSETEILSGIFINNSI
FT                   GTSPNLINVIKTLITELTLEQTEYLKLKSIENFLINFTNNQEYLNKLRIEQNDAKLVQL
FT                   QFNLKQKLTEKHEKLLCERNTQLTELQKERDQLKKSLDQKNQEANHELENLRRELDDVN
FT                   TRLEVEKYKNTQFSKKSEKADPVKEAHEKRELLAGYLSGVNFGTKNMLVFGTVSIGIFA
FT                   AAIKYITMKGGA"
FT   CDS_pept        820160..820606
FT                   /codon_start=1
FT                   /gene_family="HOG000154374" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775041"
FT                   /gene_name="SPC19"
FT                   /locus_tag="AGL105W"
FT                   /product="DASH complex subunit SPC19 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS54386.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG192650"
FT                   /db_xref="HOGENOM:HBG203202"
FT                   /db_xref="InterPro:IPR013251"
FT                   /db_xref="UniParc:UPI00002533F9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750P7"
FT                   /transl_table=1
FT                   /translation="MDISLDESCVALESSVKLLGKTLERLAEQGEHSRRLTSTLLRSKR
FT                   VFELVSEYDLQRARLDVIEEVEPVVEKLCSKLEKSLNKLERERATLQQTYELNQLRLNN
FT                   RLAGSGGRRPVVMGTSTTEELGRLREAKQRKAALEREIAEVRGT"
FT   CDS_pept        complement(820608..821627)
FT                   /codon_start=1
FT                   /gene_family="HOG000001043" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622495"
FT                   /locus_tag="AGL104C"
FT                   /orf_name="AGOS_AGL104C"
FT                   /product="AGL104Cp"
FT                   /protein_id="AAS54387.1"
FT                   /db_xref="HOGENOM:HBG059834"
FT                   /db_xref="HOGENOM:HBG203203"
FT                   /db_xref="UniParc:UPI00002533FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Z8"
FT                   /transl_table=1
FT                   /translation="MTTEIYEDDHFDPGKEAGGAGDRELRWLVEEIVKPQLPNVIDNIE
FT                   ACLAQLVSDETFKMPISNGASDDTQPMMRGTLSRKQGRIVDFQALVRFPQFHRGKTVMY
FT                   KMKEQGGEFPLQQIETICTSLYKVLDLLDELLSLADMQQFVERFGELLVLLTRAISVLE
FT                   NPPHVLLFPEDNNTAVKTMFHENTQCESTHHLVSIELVLFKNELMIEFRNLVKVTKRPW
FT                   CQVDPATGTSFVDRLRQRLRTQRHVPIKAVMEEEGVQIEEPSLVTSLISHLNTNGERIT
FT                   LAGAQDLLNRCVTFDGRVVMECEKVTVRTSDPGLICVSTKLNALVSRLSTHYTNLRVM"
FT   CDS_pept        821752..822723
FT                   /codon_start=1
FT                   /gene_family="HOG000194110" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750180"
FT                   /gene_name="COQ4"
FT                   /locus_tag="AGL103W"
FT                   /product="Ubiquinone biosynthesis protein COQ4,
FT                   mitochondrial"
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS54388.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="HOGENOM:HBG059835"
FT                   /db_xref="HOGENOM:HBG326467"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="UniParc:UPI00002533FB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751B5"
FT                   /transl_table=1
FT                   /translation="MLRGKATVAAAQPRRTFVLAGMLSLGQLVIGREARLADAMARGDL
FT                   HNKNEDYQAKQLQELEARLQGLRNTRPSAPRYEGHVPLWWHEKALLFGISGLRSFFHPE
FT                   NGMNIVQLGEAAAIPCFLESLRRTMLSDATGRRILREQPNISEPDLDMDKLAQLPTNTL
FT                   GHTFYRWLRKEGVTPDTRAPVTYIDDPVHAYIFKRYRQCHDFYHAITGLPIIIEGEIAV
FT                   KALEAANIGVPMAALGALLAPLRLRAAQRERLRNIYLPWAIETGLSAKPLINVYWEELL
FT                   EHDVDQLRAELGIRVPPDLRLIRQEQLQRRRSFKMKYESFEN"
FT   CDS_pept        823121..825196
FT                   /codon_start=1
FT                   /gene_family="HOG000094005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775042"
FT                   /locus_tag="AGL102W"
FT                   /orf_name="AGOS_AGL102W"
FT                   /product="AGL102Wp"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54389.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG104526"
FT                   /db_xref="HOGENOM:HBG124587"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI00002533FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q751B4"
FT                   /transl_table=1
FT                   /translation="MMELEQVLAQMPLLLSYPAMLLSHDLILTPKTSAAGAAKDQQMTQ
FT                   AVPLLLRHLVVPLLTSCVTVSVTQYVLRSFMQKKVLTFLVVFITLALSSFLGPIQASVL
FT                   SVSLLQILLAQHVSLRYYVVFPGLSLAMDYVNGVSYYNTVVSYCVICVFLLLHRKYRNG
FT                   AATHFAKYQVPRLFFLVVSLVSLVLTFVWVDYVETVDINYSMFLVFLGCIFVALVTFQD
FT                   VSREIECNDGSTAKFEVWKVPYAPAVVGVLSLGLQVLSFNIISATFQGNVIMFVFLVLS
FT                   AVVPHTLEFSTTCSHDATQVDKHCGFAHEHDDNHAQTDSQAHENSRFGVNVTYLLQQLA
FT                   LDKENRAIFSFLLLNFTFMLIQLLYSFRSRSLGLLSDSLHMALDCTSLFLGLLAGVLSK
FT                   NPATDMFPFSLAYLETLAGFTNGVLLIGIVSSIFVEAAGRILHPVSLHGTNELLVVSVL
FT                   GLLVNLVGLFAFDHSGHGHDNENLKGIFLHILADTLGSVGVIVSTMLTKMFGSQIFDPL
FT                   ASIFIALLILLSSIPLVKSTSAGMLLRLNDKNHNTVKDALTQIMSTPGVTGYTTPRFWP
FT                   LVMPAAGGHSHAHGHSHSHSHSHSHSHSHSHSHSHSLPSTSDQNDACGGSAKDRKQLIG
FT                   YIHVQYLEGENSTIIKKRVEKIFENLGIQAWIQVEPNESNCWCRIPSSVPKSAPLM"
FT   CDS_pept        complement(825325..827220)
FT                   /codon_start=1
FT                   /gene_family="HOG000184377" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750181"
FT                   /locus_tag="AGL101C"
FT                   /orf_name="AGOS_AGL101C"
FT                   /product="AGL101Cp"
FT                   /function="DNA topoisomerase type I activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="DNA unwinding involved in replication "
FT                   /cellular_component="chromosome"
FT                   /protein_id="AAS54390.1"
FT                   /db_xref="GO:0003917"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006268"
FT                   /db_xref="HOGENOM:HBG286281"
FT                   /db_xref="HOGENOM:HBG525547"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="UniParc:UPI00002533FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q751B3"
FT                   /transl_table=1
FT                   /translation="MRVVCVAEKNSIAKAVAGILGGGNTRTRSSPSKYIKNYDFTYNFA
FT                   WAQGGERCEVTMTAVAGHLMSQDFGPQYGWNKCDPRELFGAEILETPTREIAENITREC
FT                   RGAEYLMIWTDCDREGEAIGWEIARVAMQANTRLVRSRIHRAVFSHLGREHIMRAANSP
FT                   SQIDMNAVDAVKARSEIDLRAGYAFTRLLTATLRAKVEQDMPAANEKKRALISYGTCQF
FT                   PTLGFVVDRYERIQNFVSEGFWYLQLLIEDPQCARKVTFSWDRGHLFDRLCVLCLYETC
FT                   IEATGNKALVSSVTAKDTSKYRPLPLTTVELQKNCSKFLRMSAKQSLDAAEKLYQKGFI
FT                   SYPRTETDVFSKQANLQGLVQQQTEHSQWGAYASKLLSGEGSNRFQWPREGKHDDQAHP
FT                   PIHPVLCAQPDANLSVDEKRVYEYVVRHFLACCSQDAKGRSSKIKLKWHTEEFSATGLQ
FT                   VHEENFLEIYTYQKWTSSEQLPTLPLNSQVEFAKAEMKSGKTSPPKYITESELIMLMDA
FT                   NGIGTDATIAEHIEKIQERQYIKAEGTAKNKVFKPTMLGRSLVHGFEDIGLEESFAKPF
FT                   LRRDMELDLKRICEGTKDRNSVLANLIGMYMDYYDQTDRQRSKLIHCYERIKQES"
FT   CDS_pept        827553..829880
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079297"
FT                   /gene_name="EBS1"
FT                   /locus_tag="AGL100W"
FT                   /product="Protein EBS1"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54391.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG059836"
FT                   /db_xref="InterPro:IPR018834"
FT                   /db_xref="InterPro:IPR019458"
FT                   /db_xref="UniParc:UPI00002533FE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751B2"
FT                   /transl_table=1
FT                   /translation="MTLTPMEDKGIIPNFNDFKRQLAELLQSRSTVEDITLLQGFLQLV
FT                   HSKTQQWRGAEGLPATPDLLDAVWKEIHYPIFKWFQQWRAHLLEAAEGGPQERTYISFR
FT                   RMNGKLNKIFKIIRQFYNGLVQQLFDRYDFGKLLPAGVIRELNVQSGGELQTLDDSSYF
FT                   TILCVMSLQRCLLYLGCCHRYKCCCSKLSKRFHISDFDDSMRYFMLAKQIVPSVGETYL
FT                   QEGLVYVQTGNYGHAAYAFMRGSLSRMPTDAGIPNLESIVADASSGLFAKHQGILKRLR
FT                   SKESDSNKLINREVLEFYFLALFSSVYAPESWSKQGSDIRHCTEILFEKVRSRYARNVR
FT                   LILQDVLLFIGGFDLVIKKAKAMGLNRSDTLPSNCTAFLETAFDFFSHVIDSVVLKEWQ
FT                   SFDTWEYLALVRVICVWIKSHSIVTQFAHRHTQFCQSVAHLLNNILAHTEYQQLMDVEH
FT                   RPKRDYFFQEDIMLKDFSAIGHTLSDFNDVDLFQMENLPDRLAGLVDDKLTAKEEGLLK
FT                   LHAIVFIGKKFLANNDVNIVWCDESKRFNSLKPDVPLRTCSPPKAKTPPPSTSDYTPAG
FT                   AKQTKKSKPKRNSRRVQSLSSLEAKLMERKGLRQSVAEGRVYSGCSVPAAPMSFDVAPS
FT                   AHLYQDRAAGTSATQEAATYYNQGYNGPMQLGSTEILNSRSPSGNNRIAFHPSHQAYMQ
FT                   MIQTPQPQAWPTAYGHNAYYSQPTQHPYPMSSQLAQFQNGPIPFVAGPYAMYMPPPGPG
FT                   MVVLNNGHPMIPNESPPQQHYP"
FT   CDS_pept        complement(830333..832576)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750182"
FT                   /locus_tag="AGL099C"
FT                   /orf_name="AGOS_AGL099C"
FT                   /product="AGL099Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54392.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059837"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00002533FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q750P6"
FT                   /transl_table=1
FT                   /translation="MDAQRTISKEVARGAESSGEKDAPERRRETVQRLQMPSSASGEPP
FT                   VSKPTTVPHNTPIISPSDSPRDGHSTGGSVGSSGSSPSPAAAAGALGHLPPQTAAARRI
FT                   SRSEKLSSAAVHVTPAASSGYNMGLGFTPNQRVQLPTIASLLAATGAGGMAAPPPVGCR
FT                   DGLRGEPLSIMDRGSMFMTSDSRGSARDAIRTPVERIPSSAPGHTSSAAAGGRLGRPHE
FT                   GELSARPETVSGSLCSSEASGALPRSTASTASNVSVGGSTGSAGSATSEAGDARRRSAV
FT                   DAGPVDGRTLSSIDANTALTPKRLHFNNSRDLIDPYTSEQHLSDVKINITSLLNSRGGT
FT                   GEDPYSLRAGGEFVLPVSANNNMMSIAPTSKSSATGGVTFQSQPPPSTGQLPPPSSASS
FT                   STHFLEPFSNGLMMDNDTQQQSTANGLNGSATMHTQRQTRFINSKFDEMRQRLLLTKPA
FT                   ARDDELGAAAIISQMRSSPYHTDFSSADANSRPVSSSINIQRNLKPVVQILQRENGTLV
FT                   KEEPNDQVLTDDELASSGEDDGLGDTITWNKGGKRQISRRKSALASSTAPSSASAAFKS
FT                   RSKRRRRSSGQSSMESLLSAAELLEMEANSKKNNRVFRTQPPHLTPTGKSPTSLSSSFA
FT                   VPDSSNKESPDKNLEEQFPNNISPKYDDAPNKKKAGAGTRSRTGCWICRLRKKKCSEER
FT                   PQCSNCLRLNLECVYDIIKPDFISDPDKKSEKLEEIKRRTKEAKRMAMKKKEW"
FT   CDS_pept        833135..834478
FT                   /codon_start=1
FT                   /gene_family="HOG000242438" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622496"
FT                   /gene_name="BNA5"
FT                   /locus_tag="AGL098W"
FT                   /product="Kynureninase"
FT                   /EC_number="3.7.1.3"
FT                   /function="kynureninase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="NAD biosynthetic process"
FT                   /biological_process="tryptophan catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54393.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006569"
FT                   /db_xref="GO:0009435"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0030429"
FT                   /db_xref="HOGENOM:HBG000049"
FT                   /db_xref="HOGENOM:HBG523016"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001DB2BD1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750P5"
FT                   /transl_table=1
FT                   /translation="MEKARALEEQWPGARDAFHVPSYASLGLGDQTAAVRYLCGHSLGC
FT                   MPRKTRGSVEAELSAWSARAVEAHVRHPGGTEWVNTDLPLVPQMARMVGASQQEVAVMG
FT                   SLTANLNALLVAFYRPRGRRTKILLEKQVFPSDFHAFWNQAALHGLDPAATLVQVAPRA
FT                   GEHTLRTEDIVAAIETHRAELALVCLPGVQYYTGQLLDMASIVAAARREPSIVVGFDLA
FT                   HAVGNVQLQLHEWGADFACWCSYKYLNAGPGGIAGLFVHERHHGGTLPRLAGWWGTNAA
FT                   TRFEMRQTYDPLPDALGFRQSNPSVLDVAALRASLEVFEDFGGMERVRARSLALTGYLY
FT                   ELLTQSVFYRPEVGADGVGFTILTPANPAERGAQLSLLFWPHSDDPDKNTMPRVFADLR
FT                   QNGVLGDERHPDVIRLTPCALYNTFMEVFESVQLLNAALERLAPESAV"
FT   CDS_pept        complement(834661..837951)
FT                   /codon_start=1
FT                   /gene_family="HOG000265621" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775043"
FT                   /locus_tag="AGOS_AGL097C"
FT                   /product="AGL097Cp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /biological_process="cation transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54394.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0006812"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006414"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001DB2BD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q750P4"
FT                   /transl_table=1
FT                   /translation="MSKSQKVAISGGTDVYERTDFHALPAHEVARLLGTDLRRGLTAEE
FT                   ARARLEVVGDNTLGEEEGINVRAILLKQMCNAMILVLIISMVIALAIKDWISGGVIAFV
FT                   VALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQVRVGDT
FT                   VPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGRA
FT                   TGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPL
FT                   HRKLAKLALILFAIAVLFALIVMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMS
FT                   AGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRS
FT                   NVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLH
FT                   TATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTTEQDEEDSDSSQQN
FT                   DAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTG
FT                   VTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLI
FT                   FQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPK
FT                   EVVDIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDG
FT                   VNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVL
FT                   QLLAANVAQAIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVVTSCLPAMGLGLEKAAPDI
FT                   MEKPPNDSKAGIFTWEVIVDMIVYGLVMAVCCLGCFVSIIYKDGHGNLGTNCNVEYSDS
FT                   CKSVFSGRAATFATMTWCALILAWEVIDMRRSFFAMKPETDTPYTQVFKDIWSNQFLFW
FT                   SVIFGFTSVFPVVYIPVINTKVFLHIGIGYEWGIAFAFSLVFWLVAEFWKFAKRRYYRN
FT                   KDRAINPESDLENRRLHDPFEKYSSTLSRATTNIGTFRVTANSEKDIT"
FT   CDS_pept        838509..840152
FT                   /codon_start=1
FT                   /gene_family="HOG000193875" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622497"
FT                   /locus_tag="AGL096W"
FT                   /orf_name="AGOS_AGL096W"
FT                   /product="AGL096Wp"
FT                   /function="phosphatidylinositol phosphate kinase activity "
FT                   /protein_id="AAS54395.1"
FT                   /db_xref="GO:0016307"
FT                   /db_xref="HOGENOM:HBG059838"
FT                   /db_xref="HOGENOM:HBG588608"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="UniParc:UPI0000253402"
FT                   /db_xref="UniProtKB/TrEMBL:Q750P3"
FT                   /transl_table=1
FT                   /translation="MERQPESLRSANQFSASSSPTSVESIGTAMKALGERRSLVERGSY
FT                   IEDLEDERVLLNRTLSGRRRVARRATSVQQKHARIFAAEEQGENARGAEAAPVRRRSSQ
FT                   FLNDGAMKASESATAELKKMRESLLIKREMKRKQRHLLDDDRVLVGNKVSEGHVNFIIA
FT                   YNMLTGIRVAVSRCSGLMKPLSQRDFHQTKKLAFDYHGNELTPSSQYAFKFKDYCPEVF
FT                   RELRARFGLDPADYLMSLTSKYILSELNSPGKSGSFFYFSRDYKYIIKTIHHSEHKHLR
FT                   HVLHDYYEHVKANPDTLICQFYGLHRVKMPISFKNKVKNRRIYFIVMNNLFPPHLEMHT
FT                   TFDLKGSTLGRYTKVSKEDEDARPVLKDLNWLEQHMNIQFGPHKGRVFLNQLKKDVDFL
FT                   SRLNIMDYSLLLGIHDINLAAANSEDIHAMIPESSAKHALTSAFPANSNSNININNVIT
FT                   NASNNHFFQRDEGGIRASDAENKDLNIIYYIGIIDCLTNYSLLKKLETFWRGLSHDLYA
FT                   VSAVPPNDYGLRFYKFIEDSVTQGKTGHRD"
FT   CDS_pept        840531..840845
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059074"
FT                   /locus_tag="AGOS_AGL095W"
FT                   /product="AGL095Wp"
FT                   /protein_id="ADJ41736.1"
FT                   /db_xref="UniParc:UPI0001DB2BEE"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGF9"
FT                   /transl_table=1
FT                   /translation="MNQGYGYNDKSGRGYGQGYGQGYSQGYDQNTYPDAHGRGGYGQSG
FT                   YGRGGYGGGYGGGYGGGGYYSGQQQPIYHQQPPRNDGDTCCKMCCSVLLCCTLYRVFCG
FT                   "
FT   tRNA            join(842778..842814,842881..842916)
FT                   /gene_name="tRNA-Ile"
FT   CDS_pept        843063..845258
FT                   /codon_start=1
FT                   /gene_family="HOG000216610" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775044"
FT                   /locus_tag="AGL094W"
FT                   /orf_name="AGOS_AGL094W"
FT                   /product="AGL094Wp"
FT                   /function="binding"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="RNA metabolic process"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="AAS54396.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG175379"
FT                   /db_xref="HOGENOM:HBG445046"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000253403"
FT                   /db_xref="UniProtKB/TrEMBL:Q750P2"
FT                   /transl_table=1
FT                   /translation="MAGKKQRAKGQSGNANSAGKRNEVVQDERLQAVVLTDSFETRFMP
FT                   LTYEMPRCLMPLANVPLIEYTLEFLAKAGVHEVYLICTSHAEQVQEYIDNSKWNLPWSP
FT                   FKVSTILALEARSVGDAMRDLDNRGLITGDFILVSGDLVTNMEFDRALEAHRARRAEDK
FT                   EHIVTMCLSTATQSHRTRSCEPAVFMLDKSNDRCLYYQDIPLASSKRKTAVDIDPELLE
FT                   GVEEFKLRNDLIDCHIDICSPLVPAIFQENFDYQYLRRDFVKGVLSSDLLKKHIYAYIT
FT                   KEYAARVESWQTYDAISQDFLARWCYPLVLDSNLLEDQTYSYESKHVYKEKDVILAQSC
FT                   KIGKCTAIGSGSTIGEGTFIENSVIGRNCQIGANVKIINSYIWENSIIGDNSVLNHSIV
FT                   AAGAKLGSAVTLEDGCVIGFNVVVASSKTIPSGTRISAAPITVSSMSVPTPSYSSDEDS
FT                   DEDSGLHPATRSKSTAKAVQLVGESGVGYIYESDDSDDSEETDDCDGAGANTLCTRMDE
FT                   LYLSDSSIYSASKTKKRRTLSTASYYTDWEDGSDASEEEEDFEKEAIATVERAMEHNHD
FT                   IDTALLELNTLRMSLNVTYHEVRAATVSAMLKRVYHFIATQTLGPKDAVAKVFAHWGPL
FT                   FRRQAFTAAEYVDLMDVILHRVVSMRFDRPDFILFCVYSCLYDSDILDEDVVYQWWAAA
FT                   AADPAHADVKTLTAKWVDWLQTADEESGDDSGDDSDE"
FT   CDS_pept        845744..846319
FT                   /codon_start=1
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750183"
FT                   /gene_name="CDC42"
FT                   /locus_tag="AGL093W"
FT                   /product="Cell division control protein 42 "
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAS54397.1"
FT                   /db_xref="EMBL:AAG41247.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI000006A506"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HF56"
FT                   /transl_table=1
FT                   /translation="MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVM
FT                   IGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVVSPPSFENVKEKWFPEVHHH
FT                   CPGVPCLIVGTQIDLRENKMVIEKLQRQRLRPITPEQGEKFARELRAVKYVECSALTQR
FT                   GLKNVFDEAIVAALEPPVIKKSKKCTIL"
FT   mat_peptide     845744..846307
FT                   /gene_name="CDC42"
FT                   /locus_tag="AGL093W"
FT                   /product="Cell division control protein 42 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HF56 "
FT   pro_peptide     846308..846316
FT                   /gene_name="CDC42"
FT                   /locus_tag="AGL093W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HF56 "
FT   CDS_pept        846798..848474
FT                   /codon_start=1
FT                   /gene_family="HOG000226729" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750184"
FT                   /locus_tag="AGOS_AGL092W"
FT                   /product="AGL092Wp"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54398.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012715"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI0001DB2BEF"
FT                   /db_xref="UniProtKB/TrEMBL:Q751B1"
FT                   /transl_table=1
FT                   /translation="MAQVFNNQRSDTLFLGGEKVSGDDIRNQNVLAALAVANVVKSSLG
FT                   PVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVII
FT                   AAELLKRANELVKNKIHPTTIITGFRVALREALRYIEDVLSQPVDALARETMVNIAKTS
FT                   MSSKIIGSDSEFFSSMVVDALLAVKTQNGRGEVKYPVKAVNILKAHGKSACESVLVQGY
FT                   ALNCTVASQAMPRKLTGSVKIACLDINLQKARMAMGVQINVDDPDQLEEIRKREVGIVL
FT                   ERVKKIIDAGAQVVLTTKGIDDLCLKAFVEANVMAVRRCQKEDLRRIARATGAVLISSM
FT                   SNLEGDETFEPSYLGTCSEVVQAKFSDDECILIKGTAKHSSSSIILRGPNDYSLDEMER
FT                   SLHDSLCVVKRTLESGHVVAGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAAMLVIP
FT                   KTLAVNAAKDSSDLVAKLRSYHAASQQAKPDDLKKRKYRNYGLDLIRGKVVDEVGAGVL
FT                   EPTISKKKSLKSALEACIAILRIDTMITVDPEPPKEDPHAH"
FT   CDS_pept        849059..851659
FT                   /codon_start=1
FT                   /gene_family="HOG000001044" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622498"
FT                   /locus_tag="AGL091W"
FT                   /orf_name="AGOS_AGL091W"
FT                   /product="AGL091Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54399.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG192605"
FT                   /db_xref="HOGENOM:HBG203209"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000253405"
FT                   /db_xref="UniProtKB/TrEMBL:Q751B6"
FT                   /transl_table=1
FT                   /translation="MLSVREQVAEKLHLTSRKRNCILGKNSDMALEMQENAGRNMHSQY
FT                   SPRDSDRPRKRIEKVIELIEVDGKKVSKTATGKRKFHNKSKNGCDNCKRRRVKCDEGKP
FT                   GCQKCLKMRLSCVYTPAKPRKKKDRDVETVIKYVTRGNDEKDDGDVDTVIKYVTRGNDE
FT                   KDDSRDELGQQDNQNAPLAANLAVSGSQIEGAVPQTSPSVTPDASLLPPLFVGQNSQQL
FT                   QQQLMQQPHLLPQLMTLSNSERFATFELPNSPIPLQATAMNTTNSINSVFTNTRFASNL
FT                   LQQISQSPDQADLSSSVSKNGINLKQFGGPFPSAGIGGVTYDFQELIGIKAMTTKEPEV
FT                   TSQQQQISNVVTGNTSMLSKQPLVQCSSLEQQHSRASGRSTQHQPRQAQQRHSGSQPDH
FT                   QHRHQQLQQSHMPQLQDVQIQQTAAQQSPSIPVQDSLSQRGQSSATAVLSSLGSNGGSA
FT                   NMMDNPTISPIVLPMSPMSKASESVLVNNTSSTGVGDVSNSASRAAAGAKTQQNTSTRR
FT                   DSISASDNQLSEDTDGQMCTSDGCGILSFSKIIEFTQNSTLNLVDLRLFHHYCTKVWPT
FT                   IISAGISEQHIWSEHIPELAFRYPFLMHALLAFSATHLSRTEVGLEPFVACHRLESLKL
FT                   LREAVLQICEENTDALVASALILIMDSLANAASPNPAISSAAISPSAWIFHVKGAATIL
FT                   TAVWPLTPTSRFYNLINVDLSDLGDIINSDNGTVSELVCFDNSISDLYPVEIDSPYLIT
FT                   LAYLDKLHKEKDRSGFILRVFAFPALLDKTFLALLMTGDLGAMRIMRSYYKLLRGYATE
FT                   MKDRVWFLEGMTQVLPQDVDEYSGGGGMHMMLDFLGGGLPSMTTTNFTEFVYNE"
FT   CDS_pept        851806..852849
FT                   /codon_start=1
FT                   /gene_family="HOG000191277" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928054"
FT                   /locus_tag="AGL090W"
FT                   /orf_name="AGOS_AGL090W"
FT                   /product="AGL090Wp"
FT                   /function="ATPase activator activity"
FT                   /function="chaperone binding"
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54400.1"
FT                   /db_xref="GO:0001671"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG175235"
FT                   /db_xref="HOGENOM:HBG324693"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR015310"
FT                   /db_xref="UniParc:UPI0000253406"
FT                   /db_xref="UniProtKB/TrEMBL:Q750P0"
FT                   /transl_table=1
FT                   /translation="MVVHNPNNWHWVDKNCIDWAKKHFAEKLAGLSSGNKTDGEYAEIA
FT                   AVNSVEGDCEVNQRKGKVISLFDLRVVLSVRGHVADGTDWEGSITIPEVAFDSAEDDYQ
FT                   FEISIYQETSKLAPARPLVREKLVPQLRAAFAVFGKELLQAHGKDIQVPQDQVRSSFTK
FT                   ANQESSFVGTDATAAAPGARMASAPAASAPRATAAPAYAKAAVSNTTSIHIEPTFNVAA
FT                   ADLFHTLLDKQRITAWSRSHIQADRNGPELAVGETARMFGGNVTSTLLEAHEPERLVFN
FT                   WRLADWSPAQVSKLAITFHESPEFHETKMVVSWSGIPIGEEEKVKANFEEMYVRAIKLT
FT                   FGFGSVL"
FT   CDS_pept        853141..853881
FT                   /codon_start=1
FT                   /gene_family="HOG000091084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750185"
FT                   /locus_tag="AGL089W"
FT                   /orf_name="AGOS_AGL089W"
FT                   /product="AGL089Wp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="AAS54401.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="HSSP:1G65"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI0000253407"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N9"
FT                   /transl_table=1
FT                   /translation="MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCT
FT                   VLVNQKKVPDKLLEPSTVTYLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGY
FT                   DMPVHVLAKRFANLSQTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKAT
FT                   ATGPKQQELITALEKHFKKLQKDRLDEDSWEKVVEFAIGQMINSLGTDFSSKDLEIGVA
FT                   VAGKFFVLSQDQVEERLVAIAEQD"
FT   CDS_pept        complement(854010..854699)
FT                   /codon_start=1
FT                   /gene_family="HOG000113307" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750186"
FT                   /locus_tag="AGL088C"
FT                   /orf_name="AGOS_AGL088C"
FT                   /product="AGL088Cp"
FT                   /protein_id="AAS54402.1"
FT                   /db_xref="HOGENOM:HBG059839"
FT                   /db_xref="InterPro:IPR013895"
FT                   /db_xref="UniParc:UPI0000253408"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N8"
FT                   /transl_table=1
FT                   /translation="MSETRSYYSVISDLSCFEASDKVSFTREQLMELTQQEVDAREMRD
FT                   NLERSEWETRKRLPMHSYLGQLAARDAEEAAKHPGYYTLQHTLLGGYVPRHQLESLSST
FT                   DFAHYLHKVLECEGPLDSYGKYVNVGRIPIGSAEVAAESPMPLAVKAPVPMPGLLGTPG
FT                   SSSSTKVQTPSSSATPSAGTPPIVNTTIKKAGESHIKKVVLCKLCKKRFSGPRRFTEFS
FT                   NHMCMKG"
FT   CDS_pept        complement(855115..856503)
FT                   /codon_start=1
FT                   /gene_family="HOG000177774" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775045"
FT                   /locus_tag="AGL087C"
FT                   /orf_name="AGOS_AGL087C"
FT                   /product="AGL087Cp"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54403.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG051733"
FT                   /db_xref="HOGENOM:HBG592488"
FT                   /db_xref="InterPro:IPR001171"
FT                   /db_xref="InterPro:IPR018083"
FT                   /db_xref="UniParc:UPI0000253409"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N7"
FT                   /transl_table=1
FT                   /translation="MSEKPENAKTKVGLPTGRYLKPEEIEYEFGGPAGVLGMCLGFPAI
FT                   MYYMWVSVEHYGGLPAWPAAGQGAWEFVRELLLHVAADATPRLSTWALFCAFWAMQVVF
FT                   YYTLPGVWTKGQPLTHLKGKQLPYFCNALWSFYMTLVVVLGLHFGGVVPLYILLDRFGE
FT                   FMTCSIVSGFAFSIGLYLWTLFVSHDYYRMTGNHLYDMFMGAPLNPRWGILDLKMFFEV
FT                   RLPWFMLFLLSLGASLRQVELYGRLSPQLAIVLLAHWLYANACAKGEELIVPTWDMAYE
FT                   KFGFMLIFWNIAGVPFTYCHCTLFLDRRAPAEYAWSPAYNVTLLVALLGAYYFFDTTNA
FT                   QKNAFRKHLAGDTSIRRTFPYLPRQILQNPQYITTKNGSVLLVDGWYRYARKIHYTADW
FT                   VQSLVWALCCGFSSPFPWFFPVFFFVVLCHRANRDNIKCKRKYGADWDRYCKLCPWIFI
FT                   PYVF"
FT   CDS_pept        complement(856918..859125)
FT                   /codon_start=1
FT                   /gene_family="HOG000115799" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079298"
FT                   /locus_tag="AGOS_AGL086C"
FT                   /product="AGL086Cp"
FT                   /function="RNA binding"
FT                   /protein_id="AAS54404.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG059840"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB2BF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N6"
FT                   /transl_table=1
FT                   /translation="MARVPIVDEPQASEVPETINAALDQLHLDDLEDPKEAAPSAERKD
FT                   VGAAATAGPSSMPLQPNGLFPPPPHPQMMNPFLPYPLMHIPHHNGFFPPGDGPILPLDS
FT                   SAAGDFGNSIVPTPPQTSGLEVVPEPLWSASQDYQFIHGYPFAEVAAGKTGIAPVGSVA
FT                   GASLQEDDQLPRSVHEPGVAHRRQTFATIPNPELLNVTSAPPAAMSGSSGPTEEKTVEG
FT                   EAKEGEFNNPGYPQAAYPYGGPLLQPNPVLPGHPPPSGPGPNYGLPSPFPGYGFTSPFS
FT                   PVPGTSPLATSQQGKGIPPPNGNGSSTPIDGTNGWMYPPHGNHPFPAHLVPHPQIMGGP
FT                   SASPHYLNGPRSRNNHSGKRGHTGGHQSSHGGAGTGDNHKYRNGNHHHHHNHHHHNRAD
FT                   DAARYADAKLEDYIGKLYSLCKDQHGCRFLQRQLDVAGPDAATSIFEETKPYVVELMTD
FT                   SFGNYLIQKLVERVSAEQRITLVKSSADQFVSIALDPHGTRALQKLVECISTEEESRII
FT                   IASLKNSVVQLSKDLNGNHVVQKCLQKFSSADSQFIFDAACADCVKIATHRHGCCVLQR
FT                   CLDYGSDQQRDQLCAQVLANVDALTLDPFGNYVVQYILTKEAELPPPTYTTKIVDTLKP
FT                   RVIELSLHKFGSNVVEKILRTSAVAELMISELLATGGQPGVEQLLHDGFGNYVLQTALD
FT                   VSKAANSFLYTRLTDLLKPALVGPIRNTPHGRRITSIIQLE"
FT   CDS_pept        complement(860027..862756)
FT                   /codon_start=1
FT                   /gene_family="HOG000160005" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750187"
FT                   /locus_tag="AGL085C"
FT                   /orf_name="AGOS_AGL085C"
FT                   /product="AGL085Cp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /biological_process="cation transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54405.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0006812"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="HOGENOM:HBG706356"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000025340B"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N5"
FT                   /transl_table=1
FT                   /translation="MSGAVMEPKREEVVKPVMSDDEEEDIDQLIEDLQSNQGLDEEDED
FT                   EDLAPGSARPVPEELLQTDPSYGLTSDEVSRRRKKYGLNQMSEANESMILKFVMFFVGP
FT                   IQFVMEAAAILAAGLEEWIDFGIICALLLLNAAVGFIQEFQAGSIVEELKKTLANSAVV
FT                   IRDGSLVEIPANEVVPGDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAVDKRY
FT                   GDATFSSSTVKRGEGFMIVTATGDSTFVGRAAALVNKASAGSGHFTEVLNGIGTILLIL
FT                   VILTLLVVYVACFYRSIDIVTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKKKAI
FT                   VQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEADDLMLTACLAASRKKKG
FT                   LDAIDKAFLKSLINYPRAKAALTKYKVLEFHPFDPVSKKVTAIVESPEGERIVCVKGAP
FT                   LFVLKTVEENHLIPEDVKENYENKVAELASRGYRALGVARKRGEGHWEILGVMPCMDPP
FT                   RDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGS
FT                   ELADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGA
FT                   TDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAIL
FT                   NQSLNVHLVVFIAIFADVATLAIAYDNAPYDPQPVKWNLPRLWGMSIVMGILLAIGSWI
FT                   TLTTMFMKKGGIIQNYGAIDHIMFLEISLTENWLIFITRASGPFWSSIPSWQLSGAVFI
FT                   VDVIATLFCVFGWLHEKNVVDAGVLRPRTHIVTVVRVWIFSFGVFCIMGGAYYLMFTSK
FT                   SFDRFMNGKPLREKPSGRSVEDFLVAMQRVSTQHEKEN"
FT   CDS_pept        complement(863025..863552)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622499"
FT                   /locus_tag="AGL084C"
FT                   /orf_name="AGOS_AGL084C"
FT                   /product="AGL084Cp"
FT                   /protein_id="AAS54406.1"
FT                   /db_xref="HOGENOM:HBG059841"
FT                   /db_xref="UniParc:UPI000025340C"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N4"
FT                   /transl_table=1
FT                   /translation="MPHARHLPRAGLCRRPRVYFFLHAASRLPDWAARSNVLPAGNSER
FT                   ASMAWHPDPWGSRLRSDSCNQSAPCRRDRAATASCGILLIAAFAHPDTAAVAAARTVRT
FT                   LCAHWAAVRVGEKRCGVHHRSAAREIPAVESARDPRTEILAAGGECPDRARHLRGRASL
FT                   RKEKKSSSRQQV"
FT   tRNA            complement(863577..863649)
FT                   /gene_name="tRNA-Ala"
FT   CDS_pept        864033..866603
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750188"
FT                   /locus_tag="AGL083W"
FT                   /orf_name="AGOS_AGL083W"
FT                   /product="AGL083Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54407.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059842"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000025340D"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N3"
FT                   /transl_table=1
FT                   /translation="MNGATATATAAVGAEEEGGAREGSRRRDSVESAGDGRRRTKVSRA
FT                   CDQCRRKKIKCEYQEDAQSCSGCRKNSERCAFERVPLKRGPSKGYTRGEGAGDGARETE
FT                   GARGELDTSRADGKAAPVSLPPLHYYLPISNGQPGGAPAQAPAAPFPPMKQQFWKVPYY
FT                   ENQMQRRSSLESVNSDASGPQSQQETYAASSASTSSHQRTSRSYFPSSDGASALFQEPC
FT                   SSSYPPPLVRSSSTGGQLQQLPAPQYPYSQFAVALSGSTSASSQSVQLRTSATGSTSLP
FT                   EDSSPSSSNAYSPQLRAHCMSESLTTPTAGSKTGGSVKRRKRLSEPADPIVPLSAREPR
FT                   QAGHIGLPLQAQQATGKTGVICGKLSDAELIDAYYEYVHVNYPIIPINKETLTNEILLV
FT                   NTQPISEVHEMNNYILYWFRVALELLLHVASDKTNQDTASGMDSNAVHDGGLYAHRGDF
FT                   KQNEEHHVPHQSQLLAALNDCFRKLLDIHPKICAYQESTSPKVTTIYLSTYIIINYMLA
FT                   MLGEDNTFVLGTSVTVFNEFKIYRLLVLHEVADEPGDDSADVERHGFELLYKRLYYSLL
FT                   VFDALQSCCFGAPRLASLPISHLVEPLFAPPPPLDSAKWAVESDAARREPLLASIRLGA
FT                   LLTELCETRVLAGALPRAPTPALRAPRPFRVAPPADDSVPGAFFHALAAQRALLDRLLA
FT                   IPAHPAFAADAPPDATVDLCAQLGDAICRFTSCVLDTLVRAGPRPASPFAAALSRALHH
FT                   AINLSRNIPTSLIGCIIGTAVHHSRDRDLIVALSRCMSDMIQIQGLTHCLRPCAPPRPR
FT                   ARVSCDLRRLYGHDGPPASPHQVMLHQFIDIAWRLLRNDELGWF"
FT   CDS_pept        866907..868406
FT                   /codon_start=1
FT                   /gene_family="HOG000113618" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750189"
FT                   /locus_tag="AGL082W"
FT                   /orf_name="AGOS_AGL082W"
FT                   /product="AGL082Wp"
FT                   /function="nucleotidyltransferase activity"
FT                   /protein_id="AAS54408.1"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG316482"
FT                   /db_xref="HOGENOM:HBG394789"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR016267"
FT                   /db_xref="UniParc:UPI000025340E"
FT                   /db_xref="UniProtKB/TrEMBL:Q751A1"
FT                   /transl_table=1
FT                   /translation="MLSVGRKHNKTHSTYAFESNTNNVAASQMRNVLNKLADSVKDEKT
FT                   RCRFENELDSFFTLFRRYLVEKSSDTTLEWEKIKSPSAEEVTAYSDIGASENLASLEKL
FT                   AVLKLNGGLGTSMGCVGPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNT
FT                   DADTEHLIKKYSANRIRIRSFNQSRFPRVYRDSLLPVPQDYNDKLDAWYPPGHGDLFEA
FT                   LHASGELDALLAQGREILFVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTRADVKG
FT                   GTLISYEGQVRLLEVAQVPKEHIDEFKNIRKFTNFNTNNLWINLKAIKRLVESSSLTME
FT                   IIPNKKTITRNGNEIEVLQLETACGAAIRHFKGAHGVVVPRSRFLPVKTCSDLLLVKSD
FT                   LFYLEHGALKLDPSRFGPNPLIKLGSHFKKVSGFNAHIPHIPKIIELDHLTITGNVYLG
FT                   KNVTLKGTVIVVCSDGQRIDIPNGSVLENVVITGNLQILEH"
FT   CDS_pept        869107..869778
FT                   /codon_start=1
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928055"
FT                   /locus_tag="AGL081W"
FT                   /orf_name="AGOS_AGL081W"
FT                   /product="AGL081Wp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS54409.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG467264"
FT                   /db_xref="HOGENOM:HBG742904"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000025340F"
FT                   /db_xref="UniProtKB/TrEMBL:Q751A5"
FT                   /transl_table=1
FT                   /translation="MDGLLINTEDIYTVAISKLLAQFDKGPLTWDVKIRLQGLPGREAA
FT                   QKLIDHYDLPLTWEEVEKRNIALQDGLWKDSALLPGVGKLINYLKARDIPIAVCTSSSR
FT                   LKFEGKTAHLRDVFDKFDIVVTGDDERIPQGRGKPFPDIWQLGLKLLNDNFGASILPAE
FT                   CLVFEDGIPGVESGKAFGAYVVWVPHPESLSVTGDTSAVISGKGEMLRSLEHFKPAEFG
FT                   L"
FT   CDS_pept        complement(869922..870884)
FT                   /codon_start=1
FT                   /gene_family="HOG000210451" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622500"
FT                   /locus_tag="AGL080C"
FT                   /orf_name="AGOS_AGL080C"
FT                   /product="AGL080Cp"
FT                   /function="magnesium ion binding"
FT                   /function="ribose phosphate diphosphokinase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="AAS54410.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004749"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0009156"
FT                   /db_xref="HOGENOM:HBG247648"
FT                   /db_xref="HOGENOM:HBG519284"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniParc:UPI0000030CFF"
FT                   /db_xref="UniProtKB/TrEMBL:Q751A4"
FT                   /transl_table=1
FT                   /translation="MATNAIKLLAPDIHRGLAELVAKRLGLRLTDCKLKRDCNGEATFS
FT                   IGESVRDQDIYIITQVGSGDVNDRVLELLIMINASKTASARRITAVIPNFPYARQDRKD
FT                   KSRAPITAKLMADMLTTAGCDHVITMDLHASQIQGFFDVPVDNLYAEPSVVKYIKEHIP
FT                   HDDAIIISPDAGGAKRASLLSDRLNLNFALIHKERAKANEVSRMVLVGDVTDKVCIIVD
FT                   DMADTCGTLAKAAEVLLEHNARSVIAIVTHGILSGKAIENINNSKLDRVVCTNTVPFEE
FT                   KMKLCPKLDVIDISAVLAESIRRLHNGESISYLFKNNPL"
FT   CDS_pept        complement(871164..872684)
FT                   /codon_start=1
FT                   /gene_family="HOG000190616" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622501"
FT                   /locus_tag="AGL079C"
FT                   /orf_name="AGOS_AGL079C"
FT                   /product="AGL079Cp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54411.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG142394"
FT                   /db_xref="HOGENOM:HBG604662"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011422"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0000253410"
FT                   /db_xref="UniProtKB/TrEMBL:Q751A3"
FT                   /transl_table=1
FT                   /translation="MNYSIVIEVQGRDSVREAHRSFTLEAQQVLEDQQDDAEPPEETLS
FT                   IVNMRLKDDKIVSRWMGHGTIRLFKCKEPGATAPFESEEDLLRVPGDNTMCSILFVPGY
FT                   LNCGELLHWFLGPTVLKQVSHFRLVRLHDRQGEYMVLIKFRKPQDAKRFQSEYNGKRFN
FT                   SLDGTTCHVVYVKEIIFKDTLFPDPNKDFPYLLRDPFTNGSGMVELPTCPVCLERMDSD
FT                   TTGLITTACQHTFHCQCLDKWKDGRCPVCRYSNARECEDGANQSHCDVCGSSENLWVCL
FT                   ICGHMGCGRYNSKHAIQHYESSSHCFAMDIATKRVWDYAGDNYVHRLVQNEVDGKLVEI
FT                   GGITSKRTQEYHLEYVQVLISQLESQREYYEAKLEAATPEPLPDLTEKFEQLRLEAGQR
FT                   SKKQEQAIADLSHQLQEERLMNTGLRENLEHLSSELDSLRNRHTSLIAENEELQGTVKD
FT                   LMFHLQSGQMLRDVPDATEGSLVVQTEKEPTPKKKHNKKKPPHRFGKS"
FT   CDS_pept        873071..876184
FT                   /codon_start=1
FT                   /gene_family="HOG000144378" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750190"
FT                   /locus_tag="AGL078W"
FT                   /orf_name="AGOS_AGL078W"
FT                   /product="AGL078Wp"
FT                   /function="binding"
FT                   /protein_id="AAS54412.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059844"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016441"
FT                   /db_xref="UniParc:UPI0000253411"
FT                   /db_xref="UniProtKB/TrEMBL:Q751A2"
FT                   /transl_table=1
FT                   /translation="MAQDPAMVSGNDAAAFRTLKPFCVALSKLAFLPQQSFDGDSIELA
FT                   TSLEALRLQLQKCRETHKVVSPKIADYVFVPISSLLKQDSLCERSTGAVLGVIGELVKL
FT                   CWSEAGTLPLPLAQQLLTLCAFLASPERGNSPILAKPGDFKWIAVDTLGALLQAIAVQK
FT                   TAGVYDFNVTTHSSPALGHAVTILLDVLLHEVEDSALELRVVEILGMLYRDMIGDGEVL
FT                   SYILPGNVSTFTKLLLKPGLTVNYMVVCALLDLFADLLCLVYGDASLGLSLRPIGSLQD
FT                   ALESGKRGAPGDAHGAITWPADRQGPHRNESWLRGTSGQLKKALGGLIPKLLMRSNQKI
FT                   NEHLNRFAQTVLKTCGDSLLQCQDELIKALLGTDDGGDPTLDLVRFRPTLTSLLEKDTE
FT                   KLGEMIRLGSINELRIMKNLLAALGLVQNLESGFLTHVLTKLHSELYLHLQLEVPSIKN
FT                   TKVLEQSGRLIVTSFDLESEDCYVRQLLRYIGKDTENAIEALVRGIGARCKTETLDDIV
FT                   GWLLSSHSEPLPSALAIWLSSQLLQGYILQPSVKDQCEEYLVFDEDSDNTPLNCTYALL
FT                   EQCTQLLTTSTTSISEVTKGTLSGADEMTALLCLDGFRTAIKVMQEDFRDELIEYLYPL
FT                   VDSLASSSQDIRSMAQLAILELSGVLYGGSVRTLLLDNTDYMIDCISLRLENCVTDRVA
FT                   TILGVLCKIVGFEIVEQFQDVINQIFRMLDYYHGYQDLTLEFFLLFEVIVEEIRNKYMS
FT                   QKTDLLLPSSTHASRSNFQPWGNTNLDQMLLLLTPQKESAVDSPEDPSHDHFSASQFFK
FT                   DRLEADSDDEVDETDDAQAEPQADIWESPIPREPYRILLQFINYCDRLLTHPSKHVRIQ
FT                   ILRLLQKLIPMLATQYNTMLPKIARVWDLLVDLATGSDPALLKETFAVLTLAVSHSGDF
FT                   LNKRFIDFWAKLRLESSLFGQQRARKMHQFLSKPPLDLQHTSSPLREAQLSLCSLLVAG
FT                   IANCELLLSEKKLADMLSFIKACNATDHLILQHKLSMHCIDILYSFSA"
FT   CDS_pept        876482..878284
FT                   /codon_start=1
FT                   /gene_family="HOG000094280" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928056"
FT                   /locus_tag="AGOS_AGL077W"
FT                   /product="AGL077Wp"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54413.2"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG059845"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="UniParc:UPI0001DB2BF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q751A0"
FT                   /transl_table=1
FT                   /translation="MVDDSYYITPHETALAVVATAMKKARLQLDTLVVNSLVGGVLFST
FT                   GGMLYLAGHSDSPGMMASAPGLANLLGAATFVLGLFFVVINGADLFNSNILFFSVALLR
FT                   RAVSIYDLLVSWIVSWFCNLAGTLFVCYVICHLSGATASESWVENSRVIVASKVSHSFV
FT                   QILIRGMAGNFYVCLAIYLQLMVKPLHVKLIVMSLPIFTFVSMGFTHVIADMYLVMMGM
FT                   INGADLTVARCIWAVFIPGTLGNIIGGFAFGAIVPFYLHLIVVERDRKKLSLPEYDARD
FT                   EQPELNIDSRVVRVPKEQAQDKGVTDLLSAYYPDEQLHAMPDSEARSQSMPVVSRTTTR
FT                   RSHASSFAAPSAAATRSPPGVFPVRGMARPLTRERHIANAADDSAPYLALDSSSTTSSL
FT                   RSSSDSTQPPTAARRRHSLPGTLWESPDQEEAQYLYDGGYDVRGHTLGSRLERALTWIT
FT                   SPARLPSPEPFVAEKAAPGSPRARRASFASRFRSFGRAFMPSRDPDDIHTIHRKLSEAG
FT                   VTAVAADASDNIAGVVNYDGIALPANNSPFYRTQPQLRPVVPLAARPSFETAAARSSKR
FT                   LSQLRNMVSFDNDDFEEQSIREPR"
FT   CDS_pept        878521..882327
FT                   /codon_start=1
FT                   /gene_family="HOG000248675" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750191"
FT                   /locus_tag="AGL076W"
FT                   /orf_name="AGOS_AGL076W"
FT                   /product="AGL076Wp"
FT                   /function="binding"
FT                   /protein_id="AAS54414.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059846"
FT                   /db_xref="HOGENOM:HBG203413"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000253413"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N2"
FT                   /transl_table=1
FT                   /translation="MSKGQSTLKFNKNLVPSVQDAISSADLVTRLAQLHEELSMLEQGQ
FT                   VKLKSLEKCRADLINKKLVRSKDTGVQAFTACCLSDVLRLYAPDAPYNEDELAEIFGLF
FT                   IGQFRLLADPENGYYVQQTYLVTRLLEFRSIVLITDLSGSAKLIEEMFEVFYDKERNTF
FT                   EPKLTKIIGSLLGETISECDTVSMSVLRKIFNKFLTHDFGPLRSLQASARDPAFDFSLT
FT                   ICQSYSNRLGRQFTKFYSEILYGITNPGSAGSGETAGLQSTLDSEFKTLLKLHKLTANI
FT                   WEHVPELLGSVVGFVHQELCSDNVPLRIGATRLVGDLLAAPSAANFVTMHTDTYNAWMS
FT                   KIADIDATVRREWVKAIPKILDNRSDLATDICKGLNKTLMDTDDVVRLCSLEALKELTV
FT                   PTIWENLRDPTLYTELLQLTREKNKDIRETCINVVTNLYSESLQTIPRTQVNTEVWEVV
FT                   DKVPCVLFNLYYINDTNINFQVDNVIFERLFPLQPDDSVRVQRLLHLLKSFDQKAFSSF
FT                   YAFNKRQLQMSTVLTKFIEFCDIINSGEAENEIRLKLNKTIEWLVFSLPTQIDCKAILE
FT                   KFTELNDRRIQHLIKVSIARDVKYSTMKNSITELFSRLKDEELFRKKGVKIGSSFTRDA
FT                   FQAVIKVLIYRSAPLIYNTSTIPLLLGTAGDSKELEIKKQLVEHISIVNPSVFKDQMES
FT                   LKEIVKRLDDPSSSPEEAMTTYEALKTMYKISKSLPDSFDASDEFFLTRLKDFAVDGSA
FT                   TEAKYAVKLIALTPGKTEILKSIKTQILPLDISRSKNFESHVCVLAQIFKIEPRILEDD
FT                   STEIVGYLIRNVLLANQRVGDLKKDNTIWVSDMQLEHEEYLPLAAKLYSLKLFTNKLRS
FT                   IADDVNHDEIAQALTEKTMKLFFYLLASGGELVSEDNEENYPTPNAYQTKLRCSAGLQV
FT                   LKTARIPNFNRFILPPDVMKLVNLVEDECLEVRKTFLDRLRTYIGNEHISIKFLPLVFF
FT                   MAYEPDSELKQSIKTWINFTFNKPAFQKGTFFERALPRLVHCIAHHPDVTDGLNDKDET
FT                   YLNSVATAIDYLIFYFDAVATQQNICLLYYLAGRIKQYKDNIEDESAAESPHGRNNASH
FT                   IYVIAELAQLIMSELKNQRGWNLPVYPGKLNLPSDLYQPFPNMEEAQRNAFMSYISDQH
FT                   VETLTVNIRAKVSRLSNRANSHRQGQRKRIQEAQRPSSASSKTKKKRKVVDEGSEDEDT
FT                   PSSAGDYRPKSRSLNAGPVRKSSRQRKNINYHEENDDESENEG"
FT   CDS_pept        complement(882479..884263)
FT                   /codon_start=1
FT                   /gene_family="HOG000066043" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750192"
FT                   /locus_tag="AGL075C"
FT                   /orf_name="AGOS_AGL075C"
FT                   /product="AGL075Cp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54415.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059847"
FT                   /db_xref="HOGENOM:HBG203412"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI0000253414"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N1"
FT                   /transl_table=1
FT                   /translation="MLRSRPKRTGSNNVDYNLRKSRIIKEEDGGRSAKRPRAAAEEERR
FT                   ERTAEACAGPVIQEVGGATTFYEPGTADPVNGVTGLRLSELPGERVKREALGNGRQVRD
FT                   IPREAEERYQRALVRDADGSDSFMRSALSPQDVHAAERARTAAARRPGLQPRRSSCPTV
FT                   SGNGVPKQKRIKAIKDPESKLFGQNSTANHVHIPELRSAGANIENDDFCSSCMQTGIFL
FT                   CCDTCPKSFHFACLNPPLDPDRLPEGDWSCHECRFKQMYPTKAAAGKAEKRFLAEHQDT
FT                   PGISLFGKLLFQLQSMNSKQFGLAPQIKDTFANVHTGPHGEYQDDTMKEPLSDKQLFNV
FT                   PYGQSVTKFDSYNPDTHFENPDESELLICYKCNTTRMGTWDHPETERLIMKCDYCNTPW
FT                   HLDCLPVPRASRKNLGSKWKCPLHAIPPYQKRRLAKGQEYVLQPLGAYNDGDVEIELDT
FT                   TPIEAEIGKDMQCAWENGRRFNNISLLQEQNVKLEFLDKVYRAKQAQRTHELREETILI
FT                   EKMHAPPDDNKTKSWLYFSLPEKMRKLWDFQELCVVADKELKNTYISPDEIKQLQLLKR
FT                   LLESKPRKDVFSFLGLDN"
FT   CDS_pept        884748..885113
FT                   /codon_start=1
FT                   /gene_family="HOG000194121" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079299"
FT                   /locus_tag="AGOS_AGL074W"
FT                   /product="AGL074Wp"
FT                   /function="DNA binding"
FT                   /protein_id="AAS54416.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG411861"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="UniParc:UPI0001DB2BF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N0"
FT                   /transl_table=1
FT                   /translation="MDPELQALREARLAELKNKQGGEARAGEGVQQYMAPEALERLARV
FT                   ALVRPERARAAEAYVQQLAARGVLRARISEQQIVEILDGMARDEQRRTETKIIFDRRGE
FT                   PDRTAGTSADSDDDFFD"
FT   CDS_pept        885220..887253
FT                   /codon_start=1
FT                   /gene_family="HOG000250947" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750193"
FT                   /locus_tag="AGOS_AGL073W"
FT                   /product="AGL073Wp"
FT                   /function="copper ion binding"
FT                   /function="primary amine oxidase activity"
FT                   /function="quinone binding"
FT                   /biological_process="amine metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS54417.2"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008131"
FT                   /db_xref="GO:0009308"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG061830"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="UniParc:UPI0001DB2C0F"
FT                   /db_xref="UniProtKB/TrEMBL:Q750M9"
FT                   /transl_table=1
FT                   /translation="MPHIFDSVSDDEIRTTARVVKALHGDAKIQFSQIDRLDPPKQLAL
FT                   EYLAAERQGSALPEVPRRTYCYYYRNQTVPLRTAVVDVAVGAVLSDEAAPKGVVGPMCP
FT                   EGMQAAESAVLAHPVVQQEIALLGLDKLHYDHPRLGRLRYKVTCDTWMYGRDTPGAGPP
FT                   LVQAYMYVQLDHPDANHYSMPLRFSPVFEYLTHKFVRIDYLPTGADAATLQKTLPFKQV
FT                   KSLEYHPNLLDDATPRAGLKPLQISQPSGVSFAVEGSRVTWQGWDFRVATNVREGFALY
FT                   DVHFKGRSLFYRISLNEMTVPYGDGRPPFHRKQAFDLGDCGFGATAGSLGLGCHCVGVV
FT                   KYLDTRRTDLDGNPVLVPSSVCMHEQDYGILHLHRNFRNNSEVVTRRREFVVQCVATVA
FT                   NYEYILNYVFDQAGAITVQVRATGILSTVPVDDDVNTDFSTIVGPGVTAPFHQHLLSFR
FT                   FDTRLDGDENTVVYDDYVADAPGGDMNRYNVAFRQKRTVLDRSGYIEQSPFTNRAFKVI
FT                   NEKSINPVTRRPVAYKFDMPARQMLIALPDSFNARRAKYSTQQFWVCRHADDRRYAAGE
FT                   FTNQSERDSGLSVWADGSESVRNTDIVVWPTLALTHAPVTEQFPVMASDFMQFLVTPAS
FT                   FFTENPALDIPMANNAFHGSAYYEDNHAAAGQDAAACCKGNL"
FT   CDS_pept        887391..887936
FT                   /codon_start=1
FT                   /gene_family="HOG000012418" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22059075"
FT                   /locus_tag="AGOS_AGL073WC"
FT                   /product="AGL073W-Cp"
FT                   /function="heme binding"
FT                   /protein_id="ADJ41737.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI0001DB2C10"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGG0"
FT                   /transl_table=1
FT                   /translation="MDKDSEASQRRKLLSPFRQPGCSTLPPPVAAPSSSPRVPARSKVA
FT                   LKPGHSALDWHALSESAGARGRFVHGLEPGLPWWDHFCELQHPAALHQLERGVPPHRIL
FT                   PPLRIDAAVLKACAASYWCVLRGRVYCITDYLDFHPGGVAILAGSCKGRDVTKLFERYH
FT                   RWVNFERLLECCQVGVYV"
FT   CDS_pept        complement(888191..889315)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059076"
FT                   /locus_tag="AGOS_AGL073CA"
FT                   /product="AGL073C-Ap"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ADJ41738.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI0001DB2C11"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGG1"
FT                   /transl_table=1
FT                   /translation="MNVPNMGSPDAHGAHGYYEEEGRGGGQGMAGNVGGNPAVMIAGPG
FT                   GYYMAPVYPAGMPALPQQNTPQFSDAMFNSFLAQFGGQRQGGMSGGQVAPVGQVAAPVG
FT                   QVTAPVGQQQVLPAQGQGGGSQRYFHAAMAAGGGPTMLEFQPQFAYAMAPQASQPAASY
FT                   LPAGGAWGARRGARPYGGAAVAAAPKKMSTTQSRIEKRKRLKKQGPKRPSSAYFLFSMS
FT                   IREELLRQYPDAKVPELSKLSSARWKELSEEDKKPFYEQFKDNWEKYRVARKEYEATLP
FT                   PKRPSGPFIQFTSEMRPKLLKDNPDKSLIEITKLVGEQWRSLPPEEKQKYTDAYKQKLK
FT                   EWEEFYPDEDLDEAAHAAGGLAAASSKIPVNSEH"
FT   CDS_pept        complement(889596..891044)
FT                   /codon_start=1
FT                   /gene_family="HOG000184683" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059077"
FT                   /locus_tag="AGOS_AGL073CB"
FT                   /product="AGL073C-Bp"
FT                   /function="electron carrier activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ADJ41739.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="UniParc:UPI0001DB2C12"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGG2"
FT                   /transl_table=1
FT                   /translation="MATGSTVQERGGTEPHTEEEEEDALDQVCRGFPPLALPGEAFSAV
FT                   AALLRTLQATAAAGERPAAAPKAAAAAAPTAGLDELAALARWDGALAEDEGALRARLQR
FT                   IHALAGPDARAKARAAQALMSRAHAAAAAPPPPPPPPPPPSYHPSGALGCAHYMRNCAL
FT                   LCSTCHTWHVCRLCHDAVADHPLQQPPPTRVACMFCSAVQPPAAACTACGRRLARYFCA
FT                   PCVLYDNDDAKDIYHCDRCGICRLGLGLGHDFFHCDGCGACLAIELRGNHRCTEAATRA
FT                   PCPICADDMFTSVRPVMYMSPCGHAIHKHCFAAHTRHSYKCPHCRVSVLNMEARFRVLD
FT                   RELADAPLPEPYALWRCDILCNDCAARSTCRFHILGLRCGHCASYNTRQLRLLRPDDPA
FT                   PDAPDDTQAAQRASLLRALFHHETVSPLIDPSHVTAGIDDYLRRVPAAPSLPSPATEAS
FT                   ARLVALGRCLRHLLAPPESPPRGP"
FT   CDS_pept        891170..891673
FT                   /codon_start=1
FT                   /gene_family="HOG000066042" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775046"
FT                   /gene_name="TVP18"
FT                   /locus_tag="AGL072W"
FT                   /product="Golgi apparatus membrane protein TVP18 "
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54418.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG053911"
FT                   /db_xref="HOGENOM:HBG395726"
FT                   /db_xref="InterPro:IPR019365"
FT                   /db_xref="UniParc:UPI0000253417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750M8"
FT                   /transl_table=1
FT                   /translation="MALSWKSFVNVPGILADLRSFNFSVYGRWFGYINILLCLALGIAN
FT                   IFHFSIVIAFAIVAIVQGLLLIFVEVPILLKICPLSDNFIGLVKKCDTNGRRTLLYTAL
FT                   AIVQYASLSVQVTSLLAVAIGLTISAIFYGTGYLKKQEFLEGNVIRNPTDPAFMREAAV
FT                   REVL"
FT   CDS_pept        complement(891884..893074)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079300"
FT                   /locus_tag="AGL071C"
FT                   /orf_name="AGOS_AGL071C"
FT                   /product="AGL071Cp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54419.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059848"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000253418"
FT                   /db_xref="UniProtKB/TrEMBL:Q750M7"
FT                   /transl_table=1
FT                   /translation="MDYESQQQQQQAAAGPGGPAGAGPAGPAGGGGGTAGGPSQLHVQQ
FT                   YQRHVGGELYDAKYVPNVPVPMPMSMSTYPTPSTTPYYFHEDPHSQVVYHQLQQQLPHL
FT                   MSQPQGGGVAAQQPYYSWGMPHSYQYSVVHAQVAPGQGPGQGAAQGGTQYAQQVAIPPP
FT                   AAGLGGMGAGQLMDLNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRH
FT                   KRKDNLSQHLKLKHAEMLLERLSSNPNTPTSLINRLHSSDAAAGSAAAAAGTPAAFSIK
FT                   DMIDSGMLSKNEVKKTLNSLINPEVGDSASHHQLGPSGGDGAGISSLSSSASSASSASA
FT                   ATAAPISSSVSSAGHATSAGHAASAGTSSIPPPLAVSVAPAIAGSGGLASMGNLHP"
FT   CDS_pept        complement(893543..894106)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059078"
FT                   /locus_tag="AGOS_AGL071CA"
FT                   /product="AGL071C-Ap"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="ADJ41740.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001DB2C13"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGG3"
FT                   /transl_table=1
FT                   /translation="MHAHAAAHAAALAAFPPTLHGLARAPAAPARLPAAARRRLAADLT
FT                   ALVAAGLAPLYRAHARLLYPRLRDPAAWPRCKRAELLDPAALHILYRDPAGRLACFISL
FT                   LLPGPADPVLYILELHVAAPFRRRGLAAALLDAATRTARAAGLTRLELTVFTANRPALA
FT                   LYARAGFRPRRALHPDLTIMVCRL"
FT   CDS_pept        894253..895284
FT                   /codon_start=1
FT                   /gene_family="HOG000246647" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622502"
FT                   /locus_tag="AGL070W"
FT                   /orf_name="AGOS_AGL070W"
FT                   /product="AGL070Wp"
FT                   /function="phosphatase activity"
FT                   /protein_id="AAS54420.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG059851"
FT                   /db_xref="HOGENOM:HBG603876"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000253419"
FT                   /db_xref="UniProtKB/TrEMBL:Q750M6"
FT                   /transl_table=1
FT                   /translation="MNSLSYLTGATQHAAGKGDGRWPGSERGLAKVREEQDAARAGVGA
FT                   GAAWVWRVLFFLPKWLVVKPVVLVWFVLTFPLSLIEQTSSKEADGAPGPEAAEEEQLAE
FT                   AVEDDDLAGESMVLQEDSVKSSRPSTSRSSYTSTRLGKFLFPKKLIPQSILQTDRKKLL
FT                   VLDLDETLIHSMSRSTSSVSNSQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVSKWY
FT                   DLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQDI
FT                   IIVDNSPISYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGER
FT                   AFI"
FT   CDS_pept        complement(895396..897180)
FT                   /codon_start=1
FT                   /gene_family="HOG000194625" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750194"
FT                   /locus_tag="AGL069C"
FT                   /orf_name="AGOS_AGL069C"
FT                   /product="AGL069Cp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS54421.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059852"
FT                   /db_xref="HOGENOM:HBG330531"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000025341A"
FT                   /db_xref="UniProtKB/TrEMBL:Q750M5"
FT                   /transl_table=1
FT                   /translation="MGFLGIVQPRSGDGESQELPTLDVTGTFAMTREAVEAMRHAGHDT
FT                   GVDDLQRTKKGIVLNPQPSKHTRDPLNWPIWRRDLALVCVGWHCFVGGGQTSMLAAGFS
FT                   KLSAELHVPISQVSFLVGPMMLALAIGSVVASPTAVLFGKRMVYLMGILIFLGGSIGCA
FT                   LSNSFASLLIFRMVSGFGLSTVESLPSATIAEIYFAHERAYRLGLYTLLLLGGKNLVPL
FT                   LGSLVFENLTTHWLFWILTIIAGVNFVLHLLFVPETFWDRTPVPNERSLEETIIARETQ
FT                   AVVCNLSHRTPSLGESTSQSEDDHIGKDPPKQLYDQKNDDATEAPSRIRSHINSMTQSH
FT                   LTTGLGIFHGRHTMDKWRMVLLRPFVLCSYPAVLLGALMYAFAVVFLIMVSQVIDHAYK
FT                   DLYGFSSASVGLVYIAPFVGGCLGSLCAGKLSDLLVRSLAMRNHGIYEPEFRLFMAIPA
FT                   VISTAAGLLGFGFSLKNQAHWIVPTIFFGVLGFGSSMCSTTGITYAVDSYKHFAQESLV
FT                   TFNIFKNVLGFAFSFFNVNFSLQAGYDKAFLCYTVIELVLGVCAIVIYRWGKLCRSWTD
FT                   RKALMQFSYHRGERESSV"
FT   CDS_pept        897851..899716
FT                   /codon_start=1
FT                   /gene_family="HOG000042487" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928057"
FT                   /locus_tag="AGOS_AGL068W"
FT                   /product="AGL068Wp"
FT                   /function="NAD+ or NADH binding"
FT                   /function="malic enzyme activity"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS54422.2"
FT                   /db_xref="GO:0004470"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG005452"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001DB2C14"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Z9"
FT                   /transl_table=1
FT                   /translation="MLRCIRRFSSRGAAASAVATGIPVGREAKRLMSKPLVTRLSVDGP
FT                   IECPLSGMQLLNSPLFNKGSAFTQEERAAFGLEGLLPPQVNTLDEQVERAYKQLCYLKT
FT                   PLAKNDFMTSMRMQNKVLFFELVRRHIRELVPIIYTPTEGDAIAAYSHRFRRPEGVFLD
FT                   ITEPDSIEERLASYGEDKDVDYVVVSDGEGILGIGDQGIGGIRIAISKLALMTLCGGIH
FT                   PGRVMAVTLDVGTNNKKLARDELYMGNRFARVRGKQYDEFLDKFIKALKKRFPSAVLHF
FT                   EDFGVENGRPLLDRYRNELPCFNDDIQGTGAVVMASFLAALKHTDRNLLDSKVLVYGAG
FT                   SAGIGIADQIVNHMVSYGASVDEARSKIFTMDRRGLIMDSMRAGSTRAQQAYAKPDDEW
FT                   EGVNTKSLVEVVSRIKPTCLIGCSTQAGAFNKAVVQEMHKHNERPIIFPLSNPTRLHEA
FT                   VPEDLLEWTNYQALVATGSPFHPVNGYRISENNNCFSFPGIGLGAVLARATIISDKMIS
FT                   AAVDQLASLSPLKPGDSRPGLLPPLEVINDTSAKVATAVILQALEEGLARVEHEAVPNS
FT                   TLGERVRVPRDFDKCLEWVKVQMWKPVYRPLLKVQHDPSVHTFQH"
FT   CDS_pept        900043..901488
FT                   /codon_start=1
FT                   /gene_family="HOG000246773" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622503"
FT                   /locus_tag="AGOS_AGL067W"
FT                   /product="AGL067Wp"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /protein_id="AAS54423.2"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG191988"
FT                   /db_xref="InterPro:IPR002853"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="UniParc:UPI0001DB2C15"
FT                   /db_xref="UniProtKB/TrEMBL:Q750M4"
FT                   /transl_table=1
FT                   /translation="MISKISASSCTGIGKREMDRPIDDTVKSLLQFVVRGFYSNSYVLV
FT                   LDAIMFHSVLSEEDLAHLLGIKRPELRSLITTLVDDMLVASHSQQEFAYNSRSLRRYYY
FT                   YIKYPQAIDAIKWKVHQLVSKMKDDLDKNSAPQGYMCPVCHAKYSQLEAISLLNFEKTQ
FT                   FLCSLCEEPLIEDDSGKKSKEKQMRLNRLMDQVQPIIDYLKKIDDSMIEENTFETALAR
FT                   LIPPQNNSAASYTVNPRTRRSKMFTPGEALDNESSRRAGARSQATLHVNITTASDEQAQ
FT                   KELQERKAEEKRKQNALPSWHEKSAIGKSLGRLDGEEDDPAQSAASVATTEVKDEETSG
FT                   FLQPPETKLSAELGDDLEDQFTAQNQQNMANTEAERTLAEYYAKLAKKQAMEDGDDEEE
FT                   EEEEEEFEDVIAENDGEDEDVDMADLEDIELDNVGAKDPTQDFSKDRTPNTATGTNFSS
FT                   ASSNTKQTFSENEEESDAEFEDV"
FT   CDS_pept        901626..902978
FT                   /codon_start=1
FT                   /gene_family="HOG000174058" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079301"
FT                   /locus_tag="AGOS_AGL066W"
FT                   /product="AGL066Wp"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS54424.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG072594"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001DB2C16"
FT                   /db_xref="UniProtKB/TrEMBL:Q750M3"
FT                   /transl_table=1
FT                   /translation="MSFNEKVKWVLGTAVATLVTIKSVEAVYRLYAAKQNTSRSISGEE
FT                   KDVRLAKRIRESRAYDEELYREQLARNYAFLGEDGMARLQEQYFIVVGAGGVGSWVVTM
FT                   LVRSGCRKIKVIDFDQVSLSSLNRHSCATLNDVGHSKVEVLKSHLLKIAPWCEIEAVNE
FT                   LWHIDSAERLIFGNDGQDKPTFVIDCIDNISTKVDLLEYVYRKGIPLISSMGAATKSDP
FT                   TRINVGDLSTTEEDSLSRSVRRRLKQRGITKGIPVVFSAEKPDPKKAKLLPLPEEQYLM
FT                   GKVDELSALKDFRVRVLPVLGTMPGVFGLTIATWVLCSIAGYPMEPIEGKNRIKLYDGI
FT                   YHSLAGQMSRIGMPDQRVPVSVADVAYLVEEVYRGKSPVSGYSTRLTLSKWDPSQPVSL
FT                   QNVVLLTKEEQTAHEARILNGDERLEDVYSPEVIALVHQRLQEENYYSQFR"
FT   CDS_pept        complement(903124..904131)
FT                   /codon_start=1
FT                   /gene_family="HOG000165726" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775047"
FT                   /locus_tag="AGL065C"
FT                   /orf_name="AGOS_AGL065C"
FT                   /product="AGL065Cp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS54425.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002167"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000025341E"
FT                   /db_xref="UniProtKB/TrEMBL:Q750M2"
FT                   /transl_table=1
FT                   /translation="MSGRQRGSGPVDKSSVDYIVKSGLAGGIAGSCAKTLVAPLDRIKI
FT                   LFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQ
FT                   IRSVVIPTWRHESHWRRLLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMAC
FT                   IYNERPSEALRKWYIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPML
FT                   EPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPT
FT                   RRHFVGINEIAKIIYTEGGWRGFFVGLSIGYIKVTPMVACSFFIYERTKWYLQI"
FT   CDS_pept        904784..905674
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622504"
FT                   /locus_tag="AGL064W"
FT                   /orf_name="AGOS_AGL064W"
FT                   /product="AGL064Wp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS54426.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000025341F"
FT                   /db_xref="UniProtKB/TrEMBL:Q750M1"
FT                   /transl_table=1
FT                   /translation="MARSREGADAARSFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGS
FT                   GESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAGVRFLGFDALRRALQDERGALS
FT                   GPRGMLAGLGAGLLESVLAVTPFEAVKTALIDDRQAARPRYQHNGRGAARNYALLLREL
FT                   GLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSG
FT                   IVTVYATMPVDTVKTRMQALDAARYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSG
FT                   GIVFTAYEKLLVLLP"
FT   CDS_pept        complement(905724..906581)
FT                   /codon_start=1
FT                   /gene_family="HOG000246772" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622505"
FT                   /locus_tag="AGOS_AGL063C"
FT                   /product="AGL063Cp"
FT                   /protein_id="AAS54427.2"
FT                   /db_xref="HOGENOM:HBG059853"
FT                   /db_xref="InterPro:IPR019325"
FT                   /db_xref="UniParc:UPI0001DB2C17"
FT                   /db_xref="UniProtKB/TrEMBL:Q750M0"
FT                   /transl_table=1
FT                   /translation="MSDNVVIGPSSQPHEREDTEQLLEQPAGPATGREAFKTKLRRHLD
FT                   VVARHFNILDRLFKRQPGAEAGVQFGAHADGVFSNLTAKPDRGHEAVDGDKPPTYDEAA
FT                   ADVVPPYYGIDDEGVALYYNEICIDGLPVGNAVNFLWNLIISASFQFVGFLLTYILHTS
FT                   HAARQGSRFGLGLTFAGYGYSMIPSDVTSKVGKDRDIARVELDDPNEFEDSHLYSPLAQ
FT                   PAQDRFESQLSHGLMEKRRSIPALAIVLEILGLAIMCKSVYDYIVVKRMERRFLTASDG
FT                   ESPA"
FT   CDS_pept        complement(906858..910190)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750195"
FT                   /locus_tag="AGOS_AGL062C"
FT                   /product="AGL062Cp"
FT                   /biological_process="chromatin remodeling"
FT                   /cellular_component="nuclear chromosome"
FT                   /protein_id="AAS54428.2"
FT                   /db_xref="GO:0000228"
FT                   /db_xref="GO:0006338"
FT                   /db_xref="HOGENOM:HBG059854"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="UniParc:UPI0001DB2C18"
FT                   /db_xref="UniProtKB/TrEMBL:Q750L9"
FT                   /transl_table=1
FT                   /translation="MNNQNPFANIGTPSFNLSQIPQHILQSLTPMQLQMIQQRHRQILM
FT                   QRQQHQMGAGGAAGAASSAEGIGNQDGHQAGSQHQSPNVMTPVGAGGMGTPGMSGMMER
FT                   SGSNQGVYLNVAQKAQLLKAQQQQLALMQQQQIQQAQAQQSPQAQQAQQGLHNQQAQHS
FT                   PRNAQVKQAQQSHQVQAQQSQQNQPSQQTQQVQQMLQRQQQQQETQRQQKQQQQQQQLS
FT                   QSPQPGQSPVVTPSINLPVQIAQLPPHLQLQWLNNLKQQAISKNNGNAVAMITQLQQQV
FT                   QMSIQQKQQQQQQHQQQQQQQQQHQQQQNQQHQQQQHQQQQHQQQHQQNQLQQKQQQQQ
FT                   QQQQQQNQQHQQLQQQQLQQQPQQQPQQPQQPQQPQQPQPQPQPQPQPQPQQPQQPQQQ
FT                   SQQHQQQQQQQLQQQLQPQPQPHHHHHHQQQKQQLQQQQQQQLQQQQQQQQQNQQHQQH
FT                   QQQNQQHQHQQQQQHQQQQQQQQQSPQQQSPQSQVHGNLPDLSKGGMSPSMQMSPNPQA
FT                   QGPQPTQQVPHYMSHLPSGSQIPRQSTPQSSGTPQPLQKQLLPQGQMGTVNHASEHSNN
FT                   LQISSSVPPNVSVSHMGTSTEADLPKFQTIYEDPKETLLTSSDAWSRSLKAQNIDPPSD
FT                   LLLYEQIISRDQLNSLQLVRERNGYEPMSKFGFSNKEYLTRLLQDLNYYKELKNTRMKS
FT                   ITNTSQGTVSKSIWGDGYSGYGNGFTNTVTNVVIGGELSGEYISLNDVYDVTMQHDIEE
FT                   LVPIRLEFDTERDRFSLRDTFIWNKNEKLVKLEEFVMRTLEDYRFAQPTQYCDAVLNAI
FT                   REQLNEFQTNPFKHIRNANRIGGDDLRIKIRLDIVVGQNELLDTVEWDISNPDNDPEEF
FT                   AQVMCEELQLPGEFMTAIAHSIREQVHVYHKALALIGYKFDGSFIDDDDIRSRFLPVIT
FT                   LDEVFRASSDCKTYTPNLLEISAPELERLEKDKDRDTRRKRRQGRFNRRGAVAFPDAMP
FT                   DLNDIPKTFRIPVPSTILPGGVDLGPPVGSYTVVSTSSQQPRPPKPRPVEAPCRIITHE
FT                   RGRSLLLSIRLRAPVATAQKAPATAPGVAPAVPPVVLSDNPTPPYPYAVPSQLDAQDSP
FT                   RHR"
FT   CDS_pept        join(910629..910663,910723..912043)
FT                   /codon_start=1
FT                   /gene_family="HOG000033979" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079302"
FT                   /gene_name="APM3"
FT                   /locus_tag="AGL061W"
FT                   /product="AP-3 complex subunit mu "
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus"
FT                   /cellular_component="clathrin adaptor complex"
FT                   /cellular_component="cytoplasmic vesicle membrane "
FT                   /protein_id="AAS54429.2"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="GO:0030659"
FT                   /db_xref="HOGENOM:HBG059855"
FT                   /db_xref="HOGENOM:HBG204234"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="UniParc:UPI0001DB2C19"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750L8"
FT                   /transl_table=1
FT                   /translation="MYTSIYITDSKKNLVFEYLLTSQAPTFQQLCSKIAGRDAAMDAMV
FT                   AISKDMSLYRQAVGPEKLWYWALCQACGDPLEPQMFLAQYHQVLIEYFDKEALTVKKLV
FT                   NNADRLALLLHAMLDAGEVAVTDSNRLRQLVPLRNDLSTILNSATKTLANTVKYADSKQ
FT                   LFGAPVATGKVEAGQTVPWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSG
FT                   KIDVKCYLSGNPTVQLKLRTSGHPLDNSALHRCVELGEAGVATMNFVPPDGRFTLAEYA
FT                   IDLSAISQAARRLTNLGLVTVSLASGLGQHRDEFEIKVIIGNSTQVAAIEDLRITVYFP
FT                   DISDAAKIKILRTTHGGWESDLSRVRGVWAFDKQTAVGSVPVLRGCVENPESTPHAPPV
FT                   FPSHLAVSYSHVGQLPSGIRVDTIALSDLPPGSKPFKGVKYTSRAGDYIVRA"
FT   CDS_pept        912431..915106
FT                   /codon_start=1
FT                   /gene_family="HOG000170895" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750196"
FT                   /locus_tag="AGL060W"
FT                   /orf_name="AGOS_AGL060W"
FT                   /product="AGL060Wp"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS54430.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG037639"
FT                   /db_xref="HOGENOM:HBG327812"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000253423"
FT                   /db_xref="UniProtKB/TrEMBL:Q750L7"
FT                   /transl_table=1
FT                   /translation="MSLTFNDRVVIITGAGGGLGREYALDYAKRGAKVVVNDLGGTLGG
FT                   SGHDTRAADKVVEEIRKAGGTAVANYDTVTDGDKIVKTAIDAFGRVDVIVNNAGILRDG
FT                   SFAKMTEKNFSAVVDVHLNGSYKLCKAAWPYMRQQKYGRIVNTASPAGLYGNFGQTNYS
FT                   AAKLGLVGLSETLAKEGHKYNIKVNVIAPIARSRMTEGLLPDHVIRVMGPEKVVPMVVY
FT                   LTHENTEVTNSIFEPGAGYYTQVRWERSSGGLFNPDEKTFTPEAILHKFPEVLDFKDKP
FT                   FKAVEHPYQLADYNDLISKARQLPPNEQGSVQVKSLKDKVVIITGAGAGLGRSHALWFA
FT                   KYGARVVVNDLKGADGVVAEINSQYGEGRAVADSHNIVTDAAAVVETAMKAFERVDVLV
FT                   NNAGILRDRSFVKMTDDEWNSVLQVHLLSVFALSKAVWPIFMQQRSGVIVNTTSTSGIY
FT                   GNFGQANYSAAKAAVLGFSKSLAIEGAKRGIRVYVIAPHAFTNMTKTIFGETEIKSSFE
FT                   PSQVSPFVVLLASNEFARKYRRSVGSLFEVGGGWIGHTRWQRAKGAVSLELATAEFIRD
FT                   NWATITDFSKPSYPASIDAAGNDMMKAIMTATALQSSTGALKYTSRDSIIYNLGLGANT
FT                   TELKYVYENHPAFQVLSTYPIVLAMNAGFVDFPSFADNFDYNMLLHGEQYMKLNQYPVP
FT                   TEGSVKVETAPVASTNKGKKAALIVIGYKVIDAKTNKQLAYTEGSYFVRGAQVPESKKV
FT                   LTERPTFSTTSFSSPDREPDFEAEIDTSVHQAALYRLAGDYNPLHIDPKVSSIARFPKP
FT                   ILHGLCSLGCTAKALFEKFGQYDELKTRFSSFVFPGDKLKVRAWKEDGGIVIFETIDLD
FT                   RDMPVLTNSAIKLVGSQSKL"
FT   CDS_pept        join(complement(915802..915819),complement(915452..915679))
FT                   /codon_start=1
FT                   /gene_family="HOG000163401" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775048"
FT                   /locus_tag="AGOS_AGL059C"
FT                   /product="AGL059Cp"
FT                   /protein_id="AAS54431.2"
FT                   /db_xref="HOGENOM:HBG059856"
FT                   /db_xref="InterPro:IPR019182"
FT                   /db_xref="UniParc:UPI0001DB2C1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q750L6"
FT                   /transl_table=1
FT                   /translation="MVAVCCYFSKLSAKPAMRFGRAPMSTFISYLPNLALWGGAYVAGL
FT                   AVFTEAWPTFQDAFYKKLPVMGSHWQKTIPPEDSPI"
FT   CDS_pept        complement(916450..919359)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750197"
FT                   /locus_tag="AGL058C"
FT                   /orf_name="AGOS_AGL058C"
FT                   /product="AGL058Cp"
FT                   /protein_id="AAS54432.1"
FT                   /db_xref="HOGENOM:HBG059857"
FT                   /db_xref="UniParc:UPI0000253425"
FT                   /db_xref="UniProtKB/TrEMBL:Q750L5"
FT                   /transl_table=1
FT                   /translation="MDLPTTPTSTASSSPDSSSIQLGENRLQKVITPTQTLQRSISAAS
FT                   ESRPHTTNGSYWKEKALGRLKRPSILSPKMKRFRRVRASSAPSSRESQQKSPPDTFPRK
FT                   NSTPSSMAELSLRKPVSELSSMPFGGDPSLAQEPDIIEQIKWRKNAAYQNKLKEIAANS
FT                   PVHLLYQSWKETRGYSNSVSVFWNHMKFYFKTQFDKDDYVPFNPDTYTISEEYEDISKF
FT                   ECFGRAVSLDMKELTPDWRKFLPSPPTSSGSKETKPEGAAKVAFGPRQEFEVQEFDSEA
FT                   PATSCSRGGVERPSTSMKGSLKPPSRHTLEDEKFCYRQTTEAVAYPNDCIRGLIYKLYN
FT                   VVGYDTELADVNDLAFNLEVLVACIASNNKKVMRRLLDKNKETAFLRNSIRDLCYQINE
FT                   MQITIEELDFKVSQLDEKLNSEREVLKRKAKAQKEELAYYRNFYDKRFTALFNEQSSLI
FT                   NDMNKFFKESNYPTWNSDTQSVIRSFATTIDSRIGEFGIFHAMNRELISENERLRKELN
FT                   IYKDSPYLEKECQRLVQTIEEKNETVAQLMKIKENYRDLLVKKAAMQKELGVLRDHAEE
FT                   LERQMSSMEDAHRKQVRELSKLPLKQRRKTLGFFNEKLYQEEIHSLELQLEEAHDKLLI
FT                   SAEEISELHEKIAHIESEKNAIIDEKKDIVESLMSAKAEFQQREQEHLTATEQLETESE
FT                   IKNRVLTKCLHIINRYQFELQSSNCEKKRDKFRTAFHYITRRQKDLKEISDWIETEVMK
FT                   QLTSRPASQKAEEEDPNTLSTPGNSPYRTQSSSIYSTMQEVNTLATPVPIQPFSPAPLL
FT                   LTNFNAHMTKEKDVAIGPPPSPHADHDYSSDETVALVPDEPSPVDDTPGLESAENHESA
FT                   TVDTERPESVSRLPMDFRYGLDGLGAQRMSQLMKGRPRTESTEELDSTNHASLKISENS
FT                   GTMWSNIDKSHEYKDADKEKEKVTPTRFIELISSDDESF"
FT   CDS_pept        920110..921783
FT                   /codon_start=1
FT                   /gene_family="HOG000238475" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928058"
FT                   /locus_tag="AGOS_AGL057W"
FT                   /product="Isocitrate lyase"
FT                   /function="isocitrate lyase activity"
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="AAS54433.2"
FT                   /db_xref="GO:0004451"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="HOGENOM:HBG056305"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="UniParc:UPI0001DB2C1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q750K8"
FT                   /transl_table=1
FT                   /translation="MASVWRRSLKTLSSYPRPSGSSAKRFVEEQTTELEQLWSSPRFQE
FT                   ITRPYTPLDVVKHRGSLGRVGYASSVQAERLHDLLEDKFHKREAVSTLGVIDPVQMTQL
FT                   ARCEGIEAAYVSGWACSSTMVGSTNEVSPDFGDYPYDTVPNQVERIFRAQQMHDRKAFL
FT                   ADGAEGRASTDYLKPIIADGDMGHGGSTTVMKLAKLFAEKGAAAIHLEDQMHGGKRCGH
FT                   LGGAVLAPTYVHISRLIATRLQWDIMGTQNLLIARTDSANAKLIASSSDPRDHEFILGT
FT                   TQPAAQPWAELVLDMEAAGCTAQEIAAAEQEWFDECPLLTFDQAAEQQLSSSEYGAYGA
FT                   RKKELCSQLGRPYLALREMRHIAEAVAPHKSVNFDWDAPRTREGHHMLHGCMELAVRRT
FT                   LAFAPYSDLLWLETKTPDLRQASAFAAAIHRAYPHAKLVYNLSPSFNWTAHGYDDRQLR
FT                   AFIPSLAAAGFVLQLVSLAGLHSDALAFWQLAAAFPADGMLAYVQHVQAPERRSGCDVL
FT                   LHQRWSGVDYVDSLGNLVQNGASSHTRGAGGDSFTESQFQ"
FT   CDS_pept        922385..923575
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750198"
FT                   /locus_tag="AGOS_AGL056W"
FT                   /product="AGL056Wp"
FT                   /protein_id="AAS54434.2"
FT                   /db_xref="HOGENOM:HBG059858"
FT                   /db_xref="UniParc:UPI0001DB2C1C"
FT                   /db_xref="UniProtKB/TrEMBL:Q750K7"
FT                   /transl_table=1
FT                   /translation="MEDVAARTVNSGDNSYQLRAATAVCRGYTVYQAVDKRGRRCVVKE
FT                   LHGVDAASIPPSVQERELERFMVGEDAFVVYGRGELEEEGLDYFNYLSGDAEEAESGRA
FT                   DGRTARDAGQGVAGNGPAACGGDGEAPASILEKPRERQRQGSCVFVPSEPQGPVKRAHC
FT                   GKSISRLPRTPLPRASVRVQDRGGCATAARSALRDAAPTSGNNDYYEDEDADEEDDEDE
FT                   DEDDEDDEDDEDDEDDEDEEDEEDDEDEEDDEDEELLPDDSLPKFLSPCVFLNEYPQKK
FT                   PQEESFVLTPVCHPTSEYAIPPSPAPLLKERKVLPRTPMPHQFPKAKRRGPSPGTSCFA
FT                   ASVACSPYDLSPAGHPTSPMSHLGSSLLSFECSGGIELNLDANKMLNRRKLRNGKI"
FT   CDS_pept        complement(923783..924787)
FT                   /codon_start=1
FT                   /gene_family="HOG000141840" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622506"
FT                   /gene_name="YFH7"
FT                   /locus_tag="AGL055C"
FT                   /product="ATP-dependent kinase YFH7 "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /biological_process="cell killing"
FT                   /protein_id="AAS54435.1"
FT                   /db_xref="GO:0001906"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG059859"
FT                   /db_xref="HOGENOM:HBG203601"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="UniParc:UPI0000253428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750K6"
FT                   /transl_table=1
FT                   /translation="MDYEDLKKRVWDLLAQNIESNYRVAVVVVGHPGSGKSTMAQRLKR
FT                   DLNQEFQSHLKARRGGLRISAGIAAESLDETVPVASGALVEEARRGFFAHVEDPGFKPH
FT                   KFYDGDGTAVIFGRGGLPNSVRIASEALDPASSVNIAEVVPMDGFHLSRAHLDHFADAA
FT                   AAHKRRGAPWTFDSNNYLQLCKLLAATCKWKPAKRPKGETLMETICDTFAQCPVISYPG
FT                   FDHAAKDPVRDQHVLTGFTRVLIFDGLYLLYDQENWAHIYHSLASTGAVLVVNVTASEE
FT                   TRETRVATRHFAAGLVGSIEEGVRKFRENDLLNAKLIEEHTLGGVPTLILSND"
FT   CDS_pept        925346..926386
FT                   /codon_start=1
FT                   /gene_family="HOG000247865" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750199"
FT                   /locus_tag="AGL054W"
FT                   /orf_name="AGOS_AGL054W"
FT                   /product="AGL054Wp"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /protein_id="AAS54436.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG398137"
FT                   /db_xref="HOGENOM:HBG615986"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="UniParc:UPI0000253429"
FT                   /db_xref="UniProtKB/TrEMBL:Q750K5"
FT                   /transl_table=1
FT                   /translation="MFRPITSQVGKRLGLAAQMKSSAVTGRWASTLAFIESHKPGEIAT
FT                   SSLSTLEAAKRLGNPVTALVVGHKLAGIAQALQSVDCSQLQRIVVADSADYEHYLPERI
FT                   APLCVQLLKDPEYSHFVVAASAVGKNILPRVGALLDVQPVSDIVAVKDQETFTRPIYAG
FT                   NVLVTVQDPQATKLLSIRASAFPAVGPGSNSASVESAPEVAAAAIDVAWQSNKLLSSDR
FT                   PELGSAKRVVSGGRGLKNKETFDELLEPLATKLGAAIGATRAAVDAGFCDNSLQIGQTG
FT                   KVVAPELYVAIGVSGAIQHLAGMKDAKTIVAINKDPEAPIFQVADYGLVGDLNAIVPEL
FT                   TQKLAK"
FT   CDS_pept        complement(926467..927312)
FT                   /codon_start=1
FT                   /gene_family="HOG000228370" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750200"
FT                   /locus_tag="AGL053C"
FT                   /orf_name="AGOS_AGL053C"
FT                   /product="AGL053Cp"
FT                   /protein_id="AAS54437.1"
FT                   /db_xref="HOGENOM:HBG301472"
FT                   /db_xref="HOGENOM:HBG715231"
FT                   /db_xref="HSSP:1LFP"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="UniParc:UPI000025342A"
FT                   /db_xref="UniProtKB/TrEMBL:Q750K4"
FT                   /transl_table=1
FT                   /translation="MQTVFRPLRSVILTPARGLARSSRLQSGHNKWSTIKHDKAKNDAE
FT                   RNRLFTRMANQISVAVKQGGSADPTLNLRLAAAIEAASKANVTKKVIENAIRKGVGEGG
FT                   ARDNAEACMYEAIGPGGVAFVLEALTDNKNRTVSLVRAAFNKHGGNMSPAQYFFERRGY
FT                   VAIQPPASCESYDAVFEVVSEVEGVEDLELWAEENFEAKEGFAAETYEVKTEPTATNRV
FT                   ATLLKERNFLVRDVGIGYEPKPDMAVEIADAEVAKKHKKLLAQLDEIDDLTEVYMNLKH
FT                   "
FT   CDS_pept        927661..928017
FT                   /codon_start=1
FT                   /gene_family="HOG000056545" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079303"
FT                   /locus_tag="AGL052W"
FT                   /orf_name="AGOS_AGL052W"
FT                   /product="AGL052Wp"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V1
FT                   domain"
FT                   /protein_id="AAS54438.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033180"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG370747"
FT                   /db_xref="HOGENOM:HBG402579"
FT                   /db_xref="InterPro:IPR005772"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="UniParc:UPI000025342B"
FT                   /db_xref="UniProtKB/TrEMBL:Q750K3"
FT                   /transl_table=1
FT                   /translation="MAENRTLIAVIADEDSITGLLLAGVGQVTPSTQEKNFFIYNEGVT
FT                   SREQVSEAFEKFTSVRDDIAILLINQHVAEEIRAQIDNFTEPFPAILEIPSKDHPYDPE
FT                   KDTVLRRVRRLFGE"
FT   CDS_pept        complement(928099..929913)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928059"
FT                   /locus_tag="AGOS_AGL051C"
FT                   /product="AGL051Cp"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54439.2"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG252834"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008957"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniParc:UPI0001DB2C1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q750K2"
FT                   /transl_table=1
FT                   /translation="MSIEVLLNVGKLDASLALLTTQNHHVIEFPTVLLPDNIKAGSIVK
FT                   IQVTKDFKQEQLERERFAKIQDKILEKYGTMEPKAPQLRLVNVTQTSCVLEWDPLDVGS
FT                   AQLTSLILYKQHARALNIPNPLNSTSTKVSGLSIDTEYEFQLKLSTTSGKLWSNTLKVR
FT                   THKMTDMSGITVCLGPLDKNGGITREQVVASLKAIGAKSPQKKVSLDTTHFVCGEEVEE
FT                   DNRELMRAKNGNIPIVRPEWIRACELEKRIVGVRGFYLDVDRSTLESYRFTSSDEPRST
FT                   DAPQDFPTGGQETWPEGVGPSVSDSISAHRTSDEPARNELSDDTVASIAPEETNPELEV
FT                   PQQPEPDIVETIEGPASEKPDRVEDNVAEEPMENVVEEPIDSPSKGTEIRTHHADDNRN
FT                   ETAVLDGDKQDDYSGVNTVDSAVKDDSVPAETQNLQNKDGEATEPVVANAAPPAEFGSP
FT                   VEAAPPAESTPPKAKTSLESPVVLTDAPAQGTAKNSPPGKDDVPAKDPLEPSLPIETAN
FT                   LAGSEPELNTGEPAASTDEVPPAASNDGPDAAPSAVDEAAGPSNGPSVPGTPIASVNKN
FT                   SSAVNVSPAKSTGSPQKGKNKKKKGKRA"
FT   CDS_pept        complement(930224..931675)
FT                   /codon_start=1
FT                   /gene_family="HOG000020208" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079304"
FT                   /locus_tag="AGL050C"
FT                   /orf_name="AGOS_AGL050C"
FT                   /product="AGL050Cp"
FT                   /function="4-aminobutyrate transaminase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="gamma-aminobutyric acid metabolic
FT                   process"
FT                   /protein_id="AAS54440.1"
FT                   /db_xref="GO:0003867"
FT                   /db_xref="GO:0009448"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG408326"
FT                   /db_xref="HOGENOM:HBG483813"
FT                   /db_xref="InterPro:IPR004631"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000025342D"
FT                   /db_xref="UniProtKB/TrEMBL:Q750K1"
FT                   /transl_table=1
FT                   /translation="MAIFSKETHFEMTSVSNSYYPDEPTAPKVVTDTIPGPKSQEAIRD
FT                   LEGVFDSRAAYFVADYDKSIGNYIADVDGNMYLDMYAQIASIALGYNNPELIKAATSSE
FT                   MVRALVNRPALGNFPGCDLREILARLLRLAPAGQDKVWSGLSGSDANELAFKAAFIYYR
FT                   SKKRGYDKEFSAEELSSVMGNSAPGSPQLAVLSFKSAFHGRLFASGSATCSKPIHKLDF
FT                   PSFPWPHADYPSYEYPLNDHTEVNRKEDDRCLAIVEEIIKSWHVPIAALIIEPIQSEGG
FT                   DHHASSYFLQRLRDITLEHGVVYIIDEVQTGVGATGKFWCHEWANIQPPCDMVTFSKKF
FT                   QSAGYFFHDPLFVPNKPYRQFNTWCGDPAHMIIAGAIGQEVIDKKLPDQCARVGDYLYT
FT                   KLDALRAQYPHLMQRLRGRHRGTFIAWDLPDTETRDHMLKKLKLAGCNVGGCAERSVRL
FT                   RPTLAFEEKHADVFVAALEHVLTEL"
FT   CDS_pept        complement(932033..932947)
FT                   /codon_start=1
FT                   /gene_family="HOG000248042" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750201"
FT                   /locus_tag="AGOS_AGL049C"
FT                   /product="AGL049Cp"
FT                   /function="FMN binding"
FT                   /protein_id="AAS54441.2"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="HOGENOM:HBG190556"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI0001DB2C2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q750K0"
FT                   /transl_table=1
FT                   /translation="MIHQMAPWVPIFVQSVKNHPQPFTPFSFSTVDPDTLRPRCRTVVF
FT                   RDFLFHDRKTNILTFTTDLRGEKVKEIGSYPGKRGTLAPFEGCFYFPQTGEQYRISGSC
FT                   FVLSEGQLPVVATEYDWKPRGPDVIPYPILAPSVCGHNAGLMETLAAAHEAELADYRNK
FT                   AADVREDHSAAQLSRISTQSSGDDIVLMVQDYRPPSAREWKLELSRQWGQLSRNMKSQF
FT                   RRPHPGTPLTTTMAQKLDKIQRGVDGAGEDTGRENFGLVCLCVDQVDYLNLKNGSGGER
FT                   WRFIRTPDEITGFETWQEQEICP"
FT   CDS_pept        join(complement(933589..933621),complement(933358..933537))
FT                   /codon_start=1
FT                   /gene_family="HOG000072575" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059079"
FT                   /locus_tag="AGOS_AGL048C"
FT                   /product="AGL048Cp"
FT                   /protein_id="ADJ41741.1"
FT                   /db_xref="UniParc:UPI0001DB2C2F"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGG4"
FT                   /transl_table=1
FT                   /translation="MRAAQVLLNATKKKSGISVPLELAPLFVAMGAAVCSAAWFSYKHL
FT                   TSGGLRIRENPNLSALDKVLQQKDE"
FT   CDS_pept        complement(934014..934964)
FT                   /codon_start=1
FT                   /gene_family="HOG000165726" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622508"
FT                   /locus_tag="AGL047C"
FT                   /orf_name="AGOS_AGL047C"
FT                   /product="AGL047Cp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS54443.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000253430"
FT                   /db_xref="UniProtKB/TrEMBL:Q750J8"
FT                   /transl_table=1
FT                   /translation="MGQPENYIQTVYKNDGFIAFVAGGVGGAVSRTVVSPVERVKILLQ
FT                   VQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFH
FT                   VGQSGHEQLRSWERLVGGALGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRR
FT                   PPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSV
FT                   AAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGL
FT                   RGYYKGLTANLVKVVPAMAVQWFVYELISENMHGL"
FT   tRNA            936332..936403
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        join(complement(937538..937587),complement(936518..937487))
FT                   /codon_start=1
FT                   /gene_family="HOG000203695" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079305"
FT                   /locus_tag="AGL046C"
FT                   /orf_name="AGOS_AGL046C"
FT                   /product="AGL046Cp"
FT                   /function="GTP binding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54444.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG012988"
FT                   /db_xref="HOGENOM:HBG329490"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="UniParc:UPI0000253431"
FT                   /db_xref="UniProtKB/TrEMBL:Q750J7"
FT                   /transl_table=1
FT                   /translation="MSELDSKATILLMGLRRGGKSSICKVVFHNMQPLDTLYLESTTNP
FT                   TSEHFSTLIDLGVMELPGQLNYFEPSYESENLFKSVGALVYVIDSQDEYLNALTNLAMI
FT                   IEYAYKVNPRISFEVLIHKVDSLSEDFKLDTQRDIMQRTGDELLDLGLEGVQVSFYLTS
FT                   IFDHSIYEAFSRIVQKLVPELPFLENMLDNLVQHSKIEKCFLFDINSKIYVATDSSPVD
FT                   IQTYEVCAEFVDVAIDLQDLYKNPNEEHEMKSVSTLVNGVVIYLRQMIRGLALVALVRP
FT                   VDSSMSSAEYDTSMESCLTVMDYNIDIFKKGLEQVWDRARVARADGETGSQENPHTTF"
FT   CDS_pept        937971..938750
FT                   /codon_start=1
FT                   /gene_family="HOG000247848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079306"
FT                   /locus_tag="AGL045W"
FT                   /orf_name="AGOS_AGL045W"
FT                   /product="AGL045Wp"
FT                   /protein_id="AAS54445.1"
FT                   /db_xref="HOGENOM:HBG247204"
FT                   /db_xref="HOGENOM:HBG397922"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="UniParc:UPI0000253432"
FT                   /db_xref="UniProtKB/TrEMBL:Q750J6"
FT                   /transl_table=1
FT                   /translation="MSQNGFDQKKKSILSGINSEGPDLSPKGDIDSLCIPIIELINSHK
FT                   DMVTTSSCSGRVSVFVEGRKAGSKPGGKGEGGRWLFVSHDKELVRGWRAAHDLDWDAAR
FT                   AGDGDSNGRFMLYKFEPFILHVKCRDFAAAARLLRVAMACGFRESGIGSNNLVGIRISI
FT                   KLDVPIGRLDESTDRLRMFVSPEYVDLLDELAVGKFMENERKMQELYEAIDEEIIRGLP
FT                   VPVTSKDDDKARRRERKRREGLERQRQLQEAAREDIL"
FT   CDS_pept        complement(939109..942180)
FT                   /codon_start=1
FT                   /gene_family="HOG000065985" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079307"
FT                   /locus_tag="AGOS_AGL044C"
FT                   /product="AGL044Cp"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="AAS54446.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG124481"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022745"
FT                   /db_xref="UniParc:UPI0001DB2C30"
FT                   /db_xref="UniProtKB/TrEMBL:Q750J5"
FT                   /transl_table=1
FT                   /translation="MSDSANEQESGQPVGGPSRHFGGKQNGARGQFHKGCGSGPARAQG
FT                   QKHYATARPYQGKGHGKGARGQRAEYGGLQNLPPYMQYYPSAVANGFAAPGPGGFYSYS
FT                   PAPYYPPATMGYESAVPSAMLNPKYKMSQESSESSTPSSATTTPVAKKIEITNKSGDHV
FT                   DLSAIHLAQHATETTPMTTAGATVSTFNEGPVPTGEEKKTDENTKKAQLDFLAEVKRRK
FT                   EMLAKKKAVDDADETIEDDALDRAKSTAGDKSLQHQASPESEPREVSTPVGEPQEEPET
FT                   SVVSEKDEPTEEGEQSITTTVKEEEQPVVEAAKPEEPLLAKSEEEVPLEKPEIADAAAE
FT                   SQPTESPAPAAAASSTSDATLAPEPEKEPVVLTFAEKMKLKKAKEAPASAASAASNAEE
FT                   VTNEHVDTGSRTEAAVSEEDHLDTMDATAEAEQSKLIDEPDMKADDATFTAGEKSTPEP
FT                   TTAVAGEEKSQEPEEVEEADDDRMTISELLEKLEKLPAVEDIYTFKYPESVQPPSDRFK
FT                   KTSVKYTYPPEFLLQFGDKVNVKLDDTWKESVFKKIVFPPGSVKSSRGKGGDKFSGSNF
FT                   KKSGSMRLGDRSNSKSMSKRSKSKRMADDGKNRAYTSRKEREAKQEAEDKDVAPLVPSA
FT                   NRWIPKSKLKKTEKKLAPDGVTELLDKEEAERKMKSLLNKLTLEKFDPISEEIINIANQ
FT                   SKWEENGESLKVVIEQIFNKATDEPHWSSMYAQLCGKVVKDLDKDIQDKENEGKVGPIL
FT                   VLHYLFDRCQTEFQKGWADKLPTSEDGSTVEVKLMSDEYYKAAAAKRRGLGLVRLIGFL
FT                   YRSNLLTSKMMFQCFRRLMKDLTGTPSEETLESVIELLTTVGEQFERDSLTTPNGSTLE
FT                   GSALLDQLFFMLDQVMEDCEISSRIRFSLLDLKDMRNASWNGGKKDEGPKTIAQIHEEE
FT                   AAKKAAEERERRMRGSSRSASRRQNNSMGGRTGSRKDAPPPSKDDFITMRSSSSKYPPQ
FT                   QKHQKEEAAAPQASSNMFSALMGHEDEDDEEDDE"
FT   CDS_pept        complement(942596..943813)
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775049"
FT                   /locus_tag="AGL043C"
FT                   /orf_name="AGOS_AGL043C"
FT                   /product="AGL043Cp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54447.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI0000253434"
FT                   /db_xref="UniProtKB/TrEMBL:Q750J4"
FT                   /transl_table=1
FT                   /translation="MAAIQVSTVPVNTHDSGVKPYFEQKIQETELRIRTKTANLRRLEA
FT                   QRNALNDKVRFIKDELRLLQEPGSYVGEVVKVVSDKKVLVKIQPEGKYIVDIAKDINVK
FT                   DLKVSQRVCLKSDSYVLHKVLENKVDPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVI
FT                   ELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYI
FT                   GEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRTMLELLNQLDG
FT                   FETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRIHSRKMNLTRG
FT                   INLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMNKNDETAIS
FT                   VAKLFK"
FT   CDS_pept        943947..944558
FT                   /codon_start=1
FT                   /gene_family="HOG000192807" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079308"
FT                   /gene_name="ALG13"
FT                   /locus_tag="AGL042W"
FT                   /product="UDP-N-acetylglucosamine transferase subunit ALG13"
FT                   /EC_number="2.4.1.141"
FT                   /function="N-acetylglucosaminyldiphosphodolichol N-
FT                   acetylglucosaminyltransferase activity"
FT                   /function="carbohydrate binding"
FT                   /biological_process="lipid glycosylation"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="AAS54448.1"
FT                   /db_xref="GO:0004577"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0030259"
FT                   /db_xref="HOGENOM:HBG298336"
FT                   /db_xref="HOGENOM:HBG629711"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniParc:UPI0000253435"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750J3"
FT                   /transl_table=1
FT                   /translation="MSTTTKSKMEGPKTVVVTCGATVPFPGLVNAVLDRRVLAELAQCG
FT                   FSRVMVQYGRGFAAEFERQVGAAGAVRAACDAEGLEGCDAHAWRWQGLEIIGFAFHAQM
FT                   ESLIGTSAALVVSHAGTGSILDALRQQKPLIVCVNEALLDNHQEQIARRFEALGHLWAI
FT                   RADVDELAGALARSTRETLAPLPPAYKQGFAELLQDVAHR"
FT   tRNA            complement(944582..944653)
FT                   /gene_name="tRNA-Asp"
FT   CDS_pept        complement(945586..949287)
FT                   /codon_start=1
FT                   /gene_family="HOG000198689" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750202"
FT                   /locus_tag="AGL041C"
FT                   /orf_name="AGOS_AGL041C"
FT                   /product="AGL041Cp"
FT                   /function="ATP binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54449.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG053752"
FT                   /db_xref="HOGENOM:HBG395754"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000253436"
FT                   /db_xref="UniProtKB/TrEMBL:Q750J2"
FT                   /transl_table=1
FT                   /translation="MSKTKKHHAVRVIENMSELVLNIIIGNIHCKQCEFHLTSILSKFF
FT                   YLGGTEEAPKNFSESGDRWYGKRIITSLLFFKPPKKITVTQWSINAGLGLVTLRIPINA
FT                   GSDRNIKSKFEAAYFSMLKRELNRAGFDVCHINVTYNLPNEGVRNEGEIINIADANRKV
FT                   SSKSKQAHLEYCSSCLEAEKYSSSSGESSIQVMKPKIYRATFLISDQAIDSNNRGSSED
FT                   VIRNVLKTSAVDENGMELTPGKLSVLLSNKLYAQSVADALRDNNFQAQLVDMKPVVNEL
FT                   KYKITAIIGGITCASCCNSITAAASKLDFIADVAVNAVTKTAIFISDVNNERAINCLRD
FT                   VVEECGFEFELVGVPQSTIHSSVQTERRVVTIEIDGMYCQSCPQRVVASLENYNKANIE
FT                   VTQVPTLKSPHLTFSYVPNQSNGTTIRALVEHVRTSILPANSSYQISVKVVEGSLLDSK
FT                   LKDLNEREQKSIMRCLIFAAIVAIPTFVFGIIGMSLLPGEHRFRKWLEKPLWVKNVPRV
FT                   IWILLILSTPVYFSVAEQFHAKACRELHFLWAYQKSWTARLFKFGSMNLLVSLGTSVAY
FT                   FASILLLILSALKKDANHHKGSPDTYFDSVVFLTLFLLIGRLLESLSKSKMVKTLESLT
FT                   SLKQRTGILMQADGARDFKKETSVSAEMLELGDHILIKPGASPAVDALIVQGETEFDES
FT                   SLTGESRPITHFPGDQIFAGTVNVGQCAVIAKVSTAPGNSLLDHVISAVRDGQLRGAPI
FT                   ERIADVLTGYFVPFIVLLAILTWAIWLILGFAGVLSQEKLDGSVGGWPFWSLEFAIAVF
FT                   VIACPCGIGLAAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTGTLTKGCA
FT                   PEVTDYAIYPDPRIHKILGKVLHEFGLASKHPLSHSMKCFALKTLGEDLSDINVLEIKE
FT                   IPGKGMTGVIEPSPAQPSGFRDELVPSEVIVGNEKFMAENGCQLSPDQESLLYSWKIEG
FT                   RSIIIIGMNFPEGAATQCFIPTLFLAVRDELRPEAKEVVQALHERGIECWMISGDNSLA
FT                   ANAVALEVGIKHVIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGI
FT                   SLASGSDLAMISCDFVLLSKKNPLTGIVVLLQLSKKVFRRVKFNFVWALVYNIICVPIA
FT                   AGVLYPYKETRLSPVWASIAMAASSVSVVLSSNLLRFYRPSKIVPRSQMLPQHTTRNEA
FT                   RRLQWPSK"
FT   CDS_pept        complement(949548..952649)
FT                   /codon_start=1
FT                   /gene_family="HOG000162582" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079309"
FT                   /locus_tag="AGL040C"
FT                   /orf_name="AGOS_AGL040C"
FT                   /product="AGL040Cp"
FT                   /function="binding"
FT                   /function="glutamate dehydrogenase activity"
FT                   /biological_process="glutamate catabolic process to 2-
FT                   oxoglutarate"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS54450.1"
FT                   /db_xref="GO:0004352"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0019551"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052776"
FT                   /db_xref="HOGENOM:HBG330596"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016210"
FT                   /db_xref="UniParc:UPI0000253437"
FT                   /db_xref="UniProtKB/TrEMBL:Q750J1"
FT                   /transl_table=1
FT                   /translation="MPQQTNLKFPDIASLSISSFSDYHSVSFSGKDVQKEEVIDILDQQ
FT                   GFMPETLMEQEVDWFYESLGIDDLFFSKESPNSIANIIHTLYAAKIESFARTRIGEGDE
FT                   TMAPGVFSIRKKVVTDNHAVFIETGHDLDNQIDAKYMDGTKAYRLVSYYGENNLKLVFL
FT                   YETKYPSDARTVDAEALVRGEIDLISDVIMSEVTSTENKKLYGQLMHLVAEREGPVIKT
FT                   FNSVANRDEVRLIVAFRKNTTKRYYSALTSLLHYYHLKPSKIFAETFANDVVIYSIYLN
FT                   HSEQQEEIVQNLSLSILQVEREASLLYAIPNNFFDLYRLRQFSPQEAIYAHSGSIFVNH
FT                   FINRLGQDYHTLVKQLNVRPSDTTMLEVLNNLKKKLRNETFTQQMIIDVLHKYKEIVSK
FT                   LYKNFAQVHYTSAKTSRFEKTLSYQRMSKLEPFKDDTEFELYLTKVIANDSPDLLILRT
FT                   LKLFNEAVLKTNFFITRKVAISFRLDPTLIMPVAEYPDTPFGVFFVVGSTFKGFHIRFR
FT                   DISRGGIRIVCSRSQDQYDMNSKMVIDENYGLASTQQRKNKDIPEGGSKGVVLMNPGLT
FT                   TPTDTFVAFSQYVDAIIDILIQDPKKEKYVDLLDREEILFFGPDEGTAGFVNWATNHAR
FT                   KRGCPWWKSFLTGKTADLGGIPHDEYGMTSLSVRSYVNKLYETLDLKNTKMNKFQTGGP
FT                   DGDLGSNEILLSTANEQYIAIVDGSGVICDSSGLDKDELRKLARERKMVSNFDKSKFSN
FT                   CGFFVSVDDVDIMLPNGTIVSNGTTFRNRFHFDIFKFVDRVDLFVPCGGRPSSIDINNL
FT                   NYYIDPKTSKCRIPYIVEGANLFISQPAKVALEQHGCILFKDASTNKGGVTSSSMEVLA
FT                   SLVLSDDDFLGKFVEVDGKRTPLYEEYVREIQEKIQRNAIAEFDSLWVLNKATGEPISE
FT                   LSNVLSQTINKLNDDLINSNELWLNDLKLRNYLLLNKIIPKLLIDVAGPTNVLNNVPVP
FT                   YLKALLSSYLSSSYVYLHGLDVNMGKFLEFIGELKRDAENVQLV"
FT   CDS_pept        953204..956221
FT                   /codon_start=1
FT                   /gene_family="HOG000094523" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750203"
FT                   /gene_name="NPR3"
FT                   /gene_synonym="RMD11"
FT                   /locus_tag="AGL039W"
FT                   /product="Nitrogen permease regulator 3 "
FT                   /biological_process="meiosis"
FT                   /protein_id="AAS54451.2"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="HOGENOM:HBG059862"
FT                   /db_xref="HOGENOM:HBG203824"
FT                   /db_xref="InterPro:IPR005365"
FT                   /db_xref="UniParc:UPI0001DB2C31"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750J0"
FT                   /transl_table=1
FT                   /translation="MPRIGQLGDAVCPQRPSKAGRARAQGQRRSRGPAIHVALETEVEE
FT                   GKSSGQQVQEAVSRAWGRARMYTNLPKACLTGIVLTISTHSGPQVVYHYPPVKQPVEAR
FT                   RGRKVDSRNERVRSWQAGRMPSAASGAVDAVGEGVDGLEEESSESELDRSSGLSESEVS
FT                   TDWADYSMSSSDSESEMREDGGGESSAVGGSSAAEGGEESLAEGADSSIAWPGPSESYN
FT                   QLLESQSMVGSSANVAAASTKPKSIKSRHSQISANKLFQYLTNTSDADSRRQSVFSKLT
FT                   GNEDSETIRLTDSVNLLDLESLLEDLEPGLADVDISELLDVEVFQPGRFQDVSKIFNFD
FT                   AEFVAELCSPPKEMCNTRFELTVDDLCFLGLPIHVDESGRWRKQKVKRQQTNTRSKRSS
FT                   SGGKPDAGSRTSVGLPHGTQERQPSTDQSGSGAPYLAQSSSESGQLRDPEQSDDVEDLQ
FT                   KAVHMFHVCFIMNPQLVEYNERIDDMYHYIVTRLSLILRYIQDKKGYVVRECAKILKTR
FT                   DRILKKSLKLKKSHGQALQGRYLYECILKSSSLARALTKCFNSIINNEIVTLDIDNHKV
FT                   ISLQIPIKNEFSSLPDLKINPVLRGSYLTSLLNDSFLKQPVDFAAGSMMPGGDVMHDDN
FT                   DVLDYALLLLDDTPKIIKDLEFSSFGSDLANVIMINLVKNLKPTVSLRSYLPLVSNLLE
FT                   ANLSLSARAAGSRHAASNAADSHSTPLQHSMIRSIVLHLVYWRYARIILPLSSKNTYIV
FT                   SPLAPIRGTAADDFENTDMVKQGCKALIYQHQDLFHEKFPTLPTLPSFLSSISTCKPRS
FT                   FGHLIPSKDHNLLYLSVLAWLIRYGYLTQLLTFVWLRVDRRIKIAVDEDLEREGVRTWN
FT                   SIVKKEHRQNPHDNVAAPTREPASSAIDETASSSEHGDANISDGQESLDDYLFKESDYT
FT                   IILEPKTATALEKRWLFKCIENQPTEMQLLFRKVIKYFNGKTPLELVEIKENIPKQELK
FT                   KLIACLDKYVVELKHW"
FT   sig_peptide     953204..953266
FT                   /gene_name="NPR3"
FT                   /locus_tag="AGL039W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750J0 "
FT   mat_peptide     953267..956023
FT                   /gene_name="NPR3"
FT                   /locus_tag="AGL039W"
FT                   /product="Nitrogen permease regulator 3 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750J0 "
FT   CDS_pept        complement(956464..958602)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079310"
FT                   /locus_tag="AGL038C"
FT                   /orf_name="AGOS_AGL038C"
FT                   /product="AGL038Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS54452.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG059863"
FT                   /db_xref="HOGENOM:HBG203819"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000253439"
FT                   /db_xref="UniProtKB/TrEMBL:Q750I9"
FT                   /transl_table=1
FT                   /translation="MTNYSILASDSRLSLSTSSEQVSGLLAADLAPIKPKEMAHALAEP
FT                   ANNELESEEEEEDDDDDDDEQLLDDIYEEAQDPVDSGTSASVATAASSSVAGAPGALPG
FT                   SNPAREAGSGAAGVTAGTAPGGVGADASGSGAVGGGPGAGGSDQGSDPKTWRGRPSSCV
FT                   FVASLAASLTDDDLCVSVTEAFKKYGELSMVKVLRDPSNRPYAFVQYTNDNDAKRALKQ
FT                   AQGTLLNGRTIRCEKAKVNRTLFISTRNRKAPEVTSDEIIQLCSSFGELEQLVASREYA
FT                   FKKNYYPIDRSSAWFVQFAYRDDAIRAFINLKPGYDWTVEWAQNIEVPKRLNLLRKTKV
FT                   RGTKSGNSESEEDEEEYEDEDEDEDDEDEDDSRDILIDKKSIFVSQLDPSVTKEKLTQR
FT                   FSKHGKVEDVNLIFKDNNTKVFAFIKYETEEATATALERENHASFLNRTMHVQYREVGG
FT                   HRSRRFRGQRRNNYRRHNMHHVHGPRLSLAPPPINIGRRASTGSFQTLPYSPYQYFPPP
FT                   KSNSNFLKDKRHKSFVACGAGSRANDGGEGSEFGFNLETSSELSGSAGNDDGASTYATT
FT                   NYNGSSAGGATVTTKGNNSVRRKNSGKKRFYNGHNNNGSGSNMHLHGFDPYYYQPPYYY
FT                   PMDYSIPPPPPGSNPNQPFYFYYPIPPPPNGSMNGNMPMNPVPGLMPPMLDQNYMPMEM
FT                   GQDASSGNGNELPQSLDY"
FT   CDS_pept        959315..959842
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750204"
FT                   /locus_tag="AGL037W"
FT                   /orf_name="AGOS_AGL037W"
FT                   /product="AGL037Wp"
FT                   /protein_id="AAS54453.1"
FT                   /db_xref="HOGENOM:HBG059864"
FT                   /db_xref="UniParc:UPI000025343A"
FT                   /db_xref="UniProtKB/TrEMBL:Q750I8"
FT                   /transl_table=1
FT                   /translation="MVLLSLPIVCETRDRVSRYSQAARCTTAWRANLFSKWNTKTVLFS
FT                   GHISELFLSCFRYLSLRPRQLGMTAVSALGGGGRAAASVGIVAASGWPRAATGTHGSAA
FT                   AEGTQARGHAPLFCPTQHFLPICWCDRETITDRIGRIARDSHGADRRLGYDRLGLCDCC
FT                   GGGQRGALHAAP"
FT   CDS_pept        complement(960420..963134)
FT                   /codon_start=1
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751259"
FT                   /locus_tag="AGL036C"
FT                   /orf_name="AGOS_AGL036C"
FT                   /product="AGL036Cp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="transcription factor binding"
FT                   /biological_process="protein metabolic process "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54454.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008134"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="HOGENOM:HBG229122"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="HSSP:1KHY"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="UniParc:UPI000025343B"
FT                   /db_xref="UniProtKB/TrEMBL:Q750I7"
FT                   /transl_table=1
FT                   /translation="MNDETKFTNKALDIITIAQKLAQDHQHSTLVPLHVLAAFVETPAD
FT                   GSMGYLQNLIEKARYDYELFRRTINRQLVRLPSQTPAPSTIAPSQSFVQLLEKAAKLSE
FT                   QQKDSFIAQDHLLFALLEDATVAQIFKECSVEPEAVKQQALVLRGNQKIDSRGADTSTP
FT                   LEYLSKYAIDMTELAREGKLDPVIGREEEIRSTIRVLARRIKSNPCLIGEPGIGKTAII
FT                   EGVAQRIIDNDVPKILQGSKLFSLDLAALTAGAKYKGDFEERLKGVLKEIEESKTLIVL
FT                   FIDEIHMLMGNGKDDAANIMKPALSRGQLKVIGATTNNEYRAIVEKDGAFERRFQKIDV
FT                   AEPTVRQTIAILRGLQGKYEIHHGVRILDSALVSAAQLAKRYLPYRRLPDSAIDLVDIA
FT                   CAGVAVARDSKPEELDSKERELQLIQVEINALDRDKDSDPTTKERLMQAKQKEASLMEE
FT                   LEPLRQRYEEERRSHEELTKAKAKLEELENKALDAERRHDYGTAADIRYFAIPDLRKRI
FT                   GELEVEVAEEEQRLGQNTMIQNVVGSDAIAETAARLTGIPVNKLTESENEKLIKMERVL
FT                   AEQVVGQVEALKAVSRAVRLSRSGLSNPKQPASFLFLGLSGSGKTELAKKLAAFLFNDE
FT                   DAMIRIDCSELSERYSVSKLLGTTAGYVGYDEGGLLTNQLQRRPYSVLLFDEVEKAHPD
FT                   VLTILLQMLDDGRITSGQGKTIDCSNCLVIMTSNLGASYIASQPGARIEPATRDVVMAA
FT                   VRAHFRPEFLNRISSIVVFNKLSRKAIHKIVAIRLAEIEARFRDNDKHYKLDIAPDAVD
FT                   FLARHGYSEDMGARPLNRLIQTEILDKLALRILKGEIKDKETVKVTYAADRDALAVLAN
FT                   HPPSAGSHAEDMDIDDWDDLDNDDLVDGPAALD"
FT   CDS_pept        complement(963688..965373)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079578"
FT                   /locus_tag="AGOS_AGL034C"
FT                   /product="AGL034Cp"
FT                   /function="metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /protein_id="AAS54456.2"
FT                   /db_xref="GO:0006801"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059866"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="UniParc:UPI00015A2495"
FT                   /db_xref="UniProtKB/TrEMBL:Q750I5"
FT                   /transl_table=1
FT                   /translation="MKTANVLTAFAASTALSANPASAFITNGAGAPQVDDNPKDACYVA
FT                   EFPQAGSDKVAGYVTFTAYEGMTKVSVDLATVVNPEDEGFSYHVHEKPIESGDECACYG
FT                   NGDELDPYTGIASCSDVKDKSLCKVGDLSGKYGNIESNVFKAKYLDPYLGLYSSSPSFI
FT                   GGRSLTIHNGDKRLACANIVPCSEMKSSEPVCALPPRPVPVTPSEPTPCPEDQQPTKVP
FT                   DEPEETPCPEETPEPEAPKDKKGKKGKKGKKGKKEKPEDKPEDKPEEQPEDKPEDKPED
FT                   KPEEQPEEQPEDKPEDKPEEPEDKPEEPEEQPEGPGVPAPKEPETPEGETPEGPTGPGV
FT                   PAPEAPEAPEAPEAPEAPEAPEGPTGPGVPAPEAPAPEAPEVPEGPTGPGVPAPEAPAA
FT                   PEAPEVPEAPEAPEAPEAPEAPEAPEAPEVPEAPEAPEAPSVPSPAPEVPSGPGVPAPA
FT                   PTSVPDGRPAPVIPSRDAIVSEAPATTTYATETTVSIEPTSAPQESSKPSTTSSTFRNG
FT                   TVTGSATTSVKKTIAISQSVNAGAYVTNGLTVGGILMFILSLLA"
FT   CDS_pept        complement(966027..966824)
FT                   /codon_start=1
FT                   /gene_family="HOG000216851" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079579"
FT                   /locus_tag="AGL033C"
FT                   /orf_name="AGOS_AGL033C"
FT                   /product="AGL033Cp"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="AAS54457.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG059867"
FT                   /db_xref="HOGENOM:HBG202531"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="UniParc:UPI000025343E"
FT                   /db_xref="UniProtKB/TrEMBL:Q750I4"
FT                   /transl_table=1
FT                   /translation="MMVYYYLSKVPAASHRRMGAVLCRTAALLGKRTTTIDNKRQLQLH
FT                   SQQTKSKTYEKPAVPRGWSFDSQPVGSSGASHDSSEAKGDEHPRTKWASYSLSRSDAPQ
FT                   GHHAGSDAAAHVTKRSDSATNKEVRSHAAAPAAANATGAGASSTKKPRRKLRPKKALIK
FT                   LSPDALVHLKALLDQPEPQLIRIGVRNRGCSGLTYDLQYIKEPGEFDEVIEQDGVKVVI
FT                   DSKALFSIVGSEMDWIDDKLSSRFVFKNPNSKGTCGCGESFMV"
FT   CDS_pept        complement(967168..969339)
FT                   /codon_start=1
FT                   /gene_family="HOG000255713" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928314"
FT                   /locus_tag="AGL032C"
FT                   /orf_name="AGOS_AGL032C"
FT                   /product="AGL032Cp"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS54458.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG007470"
FT                   /db_xref="HOGENOM:HBG315401"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="UniParc:UPI000025343F"
FT                   /db_xref="UniProtKB/TrEMBL:Q750I3"
FT                   /transl_table=1
FT                   /translation="MTTRTVDVKGSMASMSGSSMLATMVPTVGQRPFKPCANCNCTPGQ
FT                   LWRQGRRTSQFLRRISNSRKASSPAGSRGGSNESIYSSDSLWQTKLVTTTERLLALRKQ
FT                   MAAEELCCYVIPSEDEHNSEYVGPADLRRQFITGFSGSAGVACVSRDMLNFNTDSPEGK
FT                   AVLNTDGRYFNQARQELDHNWTLLRQGEDSMTWVDWCLNEAYDMSISLGGKPARIGIDP
FT                   KLIVDSRVLSIKKQIADKTKGTNAVIELVPVEKNLVDAIWAEFEEPPKRELYPLVLLPS
FT                   VISGESYQTKRQRLMKQLKENYAGHTAFCVTALDEICWFLNIRGSDVEYNPVFYAYFVI
FT                   HQDSSVLYTDNPLSEEIEKYLADNDVAVKSYAEVWSDLKELDVKLESAKEAILLPSTAS
FT                   WAITSNVSNATYKLVSSPLAAFKAVKNEVEINNARASQVKEAVCLVQFFAWLEEELVQK
FT                   EKLIDEYKAATKLHEIRKTQKNFVGNSFETISASGSNAAVIHYSPPSEGSAMICPYKIY
FT                   LCDSGSQFLEGTTDITRTLHFSTPTQEEVDSYTLVLKGNLALERLVFPEGTTGNSIDVI
FT                   ARQFLWEQGLDYRHGTGHGIGSFLNVHEGPIGIGPSVAYAKYPLAKGNIISNEPGFYKD
FT                   GEFGVRIENDMLVLEAEDLKFGTRKFLKFENITLVPYCRKLINPKLLTPEEIQQLNNYN
FT                   SRIWSAVASHLQPQSISYKWLKRETAVYR"
FT   CDS_pept        969843..970289
FT                   /codon_start=1
FT                   /gene_family="HOG000175654" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928315"
FT                   /locus_tag="AGL031W"
FT                   /orf_name="AGOS_AGL031W"
FT                   /product="AGL031Wp"
FT                   /function="actin binding"
FT                   /function="growth factor activity"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54459.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008083"
FT                   /db_xref="HOGENOM:HBG197657"
FT                   /db_xref="HOGENOM:HBG756690"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR011171"
FT                   /db_xref="UniParc:UPI0000253440"
FT                   /db_xref="UniProtKB/TrEMBL:Q750I2"
FT                   /transl_table=1
FT                   /translation="MSQLYQLSDHTRAAIRQFRLATSRADALQTLVLAIRPRPSYEIVV
FT                   DNDATEEAAGEVSGLEDLAEVLPDNTPRFVLLAYPLSSDGRQRTALVLLHWKPATVVSQ
FT                   EWKMLYAGATELVRSECAPNKFLEVSSGLEEDADVEDLRSQIEA"
FT   CDS_pept        join(970472..970492,970782..971216)
FT                   /codon_start=1
FT                   /gene_family="HOG000180723" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751260"
FT                   /locus_tag="AGL030W"
FT                   /orf_name="AGOS_AGL030W"
FT                   /product="AGL030Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS54460.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG008284"
FT                   /db_xref="HOGENOM:HBG747651"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="InterPro:IPR023029"
FT                   /db_xref="UniParc:UPI0000253441"
FT                   /db_xref="UniProtKB/TrEMBL:Q750I1"
FT                   /transl_table=1
FT                   /translation="MGRMHSKGKGMSSSAIPYSRNAPAWFKGSSGSVIEQIVKYARKGL
FT                   TPSQIGVLLRDAHGVTQSRVVTGNKILRILKSNGLAPEIPEDLYYLIKKAVSVRKHLER
FT                   NRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN"
FT   CDS_pept        971352..972386
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622769"
FT                   /locus_tag="AGL029W"
FT                   /orf_name="AGOS_AGL029W"
FT                   /product="AGL029Wp"
FT                   /protein_id="AAS54461.1"
FT                   /db_xref="HOGENOM:HBG059869"
FT                   /db_xref="UniParc:UPI0000253442"
FT                   /db_xref="UniProtKB/TrEMBL:Q750I0"
FT                   /transl_table=1
FT                   /translation="MDFTSDLNSRDSSNGSSAGGRSSSSPAGQLSSGQEFMNDDEIQIS
FT                   NLQETKDALLQQRAKLLALVANRKKELAAVQQRSANARQQQTDAEESLIPKDPGGLLEL
FT                   FTKALNTSTGLAEKRSTRTQINGASQLEEELLNKYDVLPLLNRNLRLAALVRSCPHMRI
FT                   ESANPSDMRIRYLVDYQDEDLFQLHCNIDIDSSTGYVRSFSDVQLISDMPEHTLGLLKE
FT                   YTIRTGNIAYLLFGCNEYTRLCIRRNAVLSSLQDSACKTIPHLKVVQHSMDLIKFAKNS
FT                   WQIEVRFDVLFIEERLPFPSSNIQATLYKNGAMMEDVQDILNGLIREYGVKEGILQLIR
FT                   SLYI"
FT   CDS_pept        complement(972409..974187)
FT                   /codon_start=1
FT                   /gene_family="HOG000066131" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928316"
FT                   /locus_tag="AGL028C"
FT                   /orf_name="AGOS_AGL028C"
FT                   /product="AGL028Cp"
FT                   /protein_id="AAS54462.1"
FT                   /db_xref="HOGENOM:HBG059870"
FT                   /db_xref="HOGENOM:HBG203595"
FT                   /db_xref="UniParc:UPI0000253443"
FT                   /db_xref="UniProtKB/TrEMBL:Q750H9"
FT                   /transl_table=1
FT                   /translation="MSNGRVYDPIHDVFQVQRPQDPAPPILSQSGLPGETAAGLGAGDE
FT                   QDQDDESTQSDELPQPVGYVAASAKPAMSASLSKKKGKEPSRYTRHLKKQDGEQFTRKD
FT                   IQFAFLYELLSDKRQIFENTCVGSFSISAGPPTAEILNVTDVTYTARNFIGNSRLTFSQ
FT                   LYVLTIASSKKCSKILRDKLLFDHQVAFSTCVLSLLVNFGRLNTTVNFFPEMTSQLRTF
FT                   HSIPCLQHQTRDPKSLQDTPRIKSILKTIPTGQETLKLSAWYSSSERHFRVNPVNLLFT
FT                   ICDNPQIVNEHFVSGYVDTDTTLFELFDSPKYQPKDRADFFLWLLYIHLETKLTPNDIH
FT                   NSLSLFGVEDKFPMRVATEEYDIDTESELIFGEHQNQRRLRFLKKHPRKSISEPQSSQQ
FT                   RESEQKEEDVDEDYAGSAPILETANDAGSRDPASKTTGSKHATRNSNMRPRTRVKVIHQ
FT                   ELQQDTPAITESPQQDQLHEEDVTTWAQEVDEMIEIDSKVKVAPNITHSEAQHLLLETQ
FT                   AIARKKRQELGLIKAFDEYEDVTLATVIGVRGKKRKKFNDGVLGYETDYMNHLNAAKKI
FT                   FLKKLDEPLPNENFCL"
FT   CDS_pept        975113..977746
FT                   /codon_start=1
FT                   /gene_family="HOG000166970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751261"
FT                   /locus_tag="AGL027W"
FT                   /orf_name="AGOS_AGL027W"
FT                   /product="AGL027Wp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS54463.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058312"
FT                   /db_xref="HOGENOM:HBG590918"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI0000253444"
FT                   /db_xref="UniProtKB/TrEMBL:Q750H8"
FT                   /transl_table=1
FT                   /translation="MDFQQVDTKEKNSDRLPSPCAPASEKDGKAGSQDVPLSDTQELSL
FT                   LDDEHLILLLHKMGYKHADLEDIPPVVHYLVARINELTIEKSLTILKKCAVDHAGDPNI
FT                   TEEEATDLERFTSGDFDHTDETEVFQLKLLAALFYYHSPYPEVRAVVGPGDDPTIPVET
FT                   FRCYFLTTTITIIGCGLTTFFQSRYPLIEFSSMAAQFLFFILGTLWSKFMPAVRIPIFP
FT                   GYGFQLNLQTSWSKKEQMFATLLYSITTGVFYSYFNILTQDMFYNDPTSLGFQIILSLS
FT                   LQFMGFGLAGLLRPFVVFPARALWPLSMPTIALNNALLAQDVGKGTSIRKVFFYFGIGM
FT                   FIYNWFPTVFADVLSNLNWLTWIKPNNFNLAAITGGRYGIATNPLPTLDWNYITHWALA
FT                   LPFYTVFLQYLGSLLSVVIIIAVYYTNYMECQYLPIFGQPLYSNEGKFFDASKVLTDFK
FT                   LDWQKYQQYSLPYYSAGNIVGYGSFISLYTLLAAYSIITEYEILGGACKRLGVGLWSLT
FT                   KLDTWRNLHKNDSSILEGYDDAHCREMRKYPEVPEWWFFAIFLISLVLAIILVTTYKTN
FT                   TPVWGIFLAVGLNVAFLLPLTTLQSTTGASLGLNLLVQMITGYLLPGNPYALMIIKAFG
FT                   YNIDGQADNYLSNLKMAHYCKIPPVPLFRGQLSMVLLQVIVSLAVINWQIHNVPDFCNP
FT                   KNRSGFICQGPRTYYNASIVWGIIGPKKVFSYLYPMMKWCWLIGALLGVLFGGWCRLSR
FT                   KYKLYYPRSFNPVVFVTGMISLMPPYNLRVYTSKLYVAFIGQYWLRRYHLRIWEKYNYV
FT                   VAAAFNCGVIFSAITIFFAIQYPEIRLDWILNTINDVGIDATPTPLKDVKLTERGYFGP
FT                   PRGSLP"
FT   CDS_pept        981484..983124
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751262"
FT                   /locus_tag="AGOS_AGL026W"
FT                   /product="AGL026Wp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS54464.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001DB2C32"
FT                   /db_xref="UniProtKB/TrEMBL:Q750H7"
FT                   /transl_table=1
FT                   /translation="MVQHDSPVVTPNPEKLDEKVRAEYVGNIEPQDVSLKYTDPNGFDD
FT                   SKASESESEQAVPVKPKSIFETREQIPDSLAHLTTEELEKLASKTRLRMDFRILIMLCW
FT                   IYICNQLDRTNIASARLGGLEEDLKLTSLQYQTAVSILFVGYTIFQVPSNIVLNRLGKP
FT                   RLFISVLMTLWGGISACCAAAHSFASLAVLRVLIGVVESGFFVCCLYYLSCWYTKKELT
FT                   FRNAILFSGSLLSGALSGLLSSAIIRGMEGVGGLQPWRWCFLLEGLLTVVTVPFSYIVL
FT                   PDNPSNTRFLSQMEKDIVIWKLKMDVGEYDDDEAVLHEHNNYRFALKLAVRDPKVWLIA
FT                   GTVSCLVASSGVQNFYPSVVETLNYSRTKTLLLTAPPFFIAMICTWCWARHSDITQERF
FT                   FHMLIPVPVAIMTYLVAMLSTKTAPRYFAMCLMPASIYSSYIICISWISHIVPRPPLKR
FT                   AVSLAMMNTVANVMLIWNGFLYPKHSAPSYRIAMSFNICAECLAVIFALTLRLYLIRLN
FT                   KKIAAGTMDWHKEMGADGRNINKSFRFMF"
FT   CDS_pept        complement(983628..984305)
FT                   /codon_start=1
FT                   /gene_family="HOG000144377" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622770"
FT                   /locus_tag="AGL025C"
FT                   /orf_name="AGOS_AGL025C"
FT                   /product="AGL025Cp"
FT                   /protein_id="AAS54465.1"
FT                   /db_xref="HOGENOM:HBG059871"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI0000253446"
FT                   /db_xref="UniProtKB/TrEMBL:Q750H6"
FT                   /transl_table=1
FT                   /translation="MTAQSKEVAPTVPEGWKAVFDEEYKTWFYVDLKSRKSQWEAPAGT
FT                   SWPAKGAPDAPPAYDTAVARAAAHGAQAVAPQPDYGTQAGYAPQGYGARAGYTPQPGYG
FT                   AQPGYGTQPGYGAQPGYGAQPGYGAQPGYAPQPGYGYAPQPGYGAAPGPYAQQPAHGYP
FT                   AGAAAAPQNGGRNNMMMGGLMGAGVGLMAGSLMTTAMYNHDEDVADAAYDRGYEDGFID
FT                   GDF"
FT   CDS_pept        984688..986958
FT                   /codon_start=1
FT                   /gene_family="HOG000111495" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751263"
FT                   /locus_tag="AGL024W"
FT                   /orf_name="AGOS_AGL024W"
FT                   /product="AGL024Wp"
FT                   /protein_id="AAS54466.1"
FT                   /db_xref="HOGENOM:HBG059872"
FT                   /db_xref="HOGENOM:HBG397858"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0000253447"
FT                   /db_xref="UniProtKB/TrEMBL:Q750H5"
FT                   /transl_table=1
FT                   /translation="MRKVTEREESHSRYSVSTPEYPLATVPVPYQYKIEKTISRDEAST
FT                   FLLGSLGHEPPSLKRRQDSEEPDLCEASSHKRSKTDADELTPNSGFEQLGYLKGGDAGG
FT                   SGGAADVQRADADAERAASDADRADAACAEGAQRDGEAELHDTTLSADEGAATGLGALV
FT                   GAVVEEALPISPLASPGYTPPFSGLQGGVEAGNSLVAHRSSLTLQDTMQNIATNAFLQL
FT                   PHSAFKNLVFQLLSKLNRSELSDLSTYLKDHLKRDFLQYLPMEVSMNILNNLDFEDICS
FT                   CLLVNRTWNNLIRNSPYLWKHMMLSEGFVTEDCFSSYCDSIPEKHRHLPNPSDRFRLDF
FT                   LENRWLLENWCNPCYRPGRTCLDGHRTKVVTCFQFEGNYIITGADDKRINVYDADREQF
FT                   KLELVGHEGGVWALKYAGDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVE
FT                   HGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVRT
FT                   VSGHGNIVVSGSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTLYDHKRKRCISASMDTTV
FT                   KVWDLSDINNNGPVSQINSTSALKVSGSVRTLCGHTALVGLLGLSDKYLVSAAADGSLR
FT                   GWDASDYSKRFSFHHTNQSAITTFFVSDNILVSGSEHQFNIYDLRTGRLVHRHLLNDAA
FT                   QIWGVKFNNRKLVVAVESEDHSYVEILDFGSRNRPVTYMSMRSPPSTSNSYWNQRGDPT
FT                   ASS"
FT   CDS_pept        987240..987656
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059080"
FT                   /locus_tag="AGOS_AGL024WA"
FT                   /product="AGL024W-Ap"
FT                   /protein_id="ADJ41742.1"
FT                   /db_xref="UniParc:UPI0001DB2C49"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGG5"
FT                   /transl_table=1
FT                   /translation="MAAEQSSSLLHSSPASRRQSGSLRPSDGHSSDVYSPSAALRPSAL
FT                   PITTGLLGCALVMVVSSLVIFLLGVNIVIQVRTMSRKSLRGAALKCLNLLLSLCAMYGI
FT                   YCLNLWTTRKLLASPSGTYSRLDNTGTDFELEQF"
FT   CDS_pept        988032..991700
FT                   /codon_start=1
FT                   /gene_family="HOG000195481" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079580"
FT                   /locus_tag="AGL023W"
FT                   /orf_name="AGOS_AGL023W"
FT                   /product="AGL023Wp"
FT                   /function="ATP binding"
FT                   /biological_process="chromosome organization"
FT                   /cellular_component="chromosome"
FT                   /protein_id="AAS54467.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0051276"
FT                   /db_xref="HOGENOM:HBG505437"
FT                   /db_xref="HOGENOM:HBG559513"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniParc:UPI0000253448"
FT                   /db_xref="UniProtKB/TrEMBL:Q750H4"
FT                   /transl_table=1
FT                   /translation="MGRLIGLEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDA
FT                   ISFVLGIRSSHLRSSALVDLIYRGRMEEGGSAHENNPKSAYVTAFYVKQDASGAERRME
FT                   FTRVIHNTGDSTYKLDGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIASQSGVDL
FT                   TKLFEQVSGSVQYQREYERLKDDYEKASAEYNESLKARRKMQIDLKSFKEGVQKEEQYI
FT                   SLLAERVKLQQQFMLWQLFHLQSKRSGLVASLKDSKAKLSQLKRQLSNEEAILGKSKSL
FT                   VAKEELLLARRRETLLQKQQDKARLNAQLLPVGSARQGTTRRMVNIEKRIDSLQRDIER
FT                   QESYVKQLKNQLKVVGKTKASFEAELEKSASGKFTLSEEQKKEYEELKEVYLSSGGSEF
FT                   EEKLAILQNKKEELSEEIAVFEKRIGISKTRAEHDLKVDIERLEVEVSERTGNLNDKNA
FT                   IHSEKVREWKQIQSEIESANNKEYELSYKLREVLAKLDDLSANQRETNKERKLRENVAT
FT                   LRRLFPGVRGLVHDLCRPKKEKYAVGVSTILGKNFDSVIVDSLSVAQQCISYLKKHRSG
FT                   VASFIPLDTIDTSSPTLPAGDNTGCILTLDAIEYESSLEKAMQYVCSDSIICDSLDIAR
FT                   NLKWNRNVKSKLVTLEGALIHRAGLMTGGITKNNTNRWDKEEYQSLLLLKDKISTELSE
FT                   LTTGIRTGSIKSRDYENEVSLLSTEISSLRSQLNQLNRSMKEALTELNYHDDLIEKEYS
FT                   PKVDSLHKMVEEVDGQMADIAKDKANLQASVYKDFSKKIGFDIGEYEQHTGGRLRKHSR
FT                   ELQQLQKEVMNIENKLEFETERLESTIKRQQKAREDLKKVQGELDSLTSQETDIQSNLE
FT                   QVTNQIAEETKVLEEAQEKLKKKGNNIKIIEDTINDLHDSIQTCKREITEWKEDIEKVG
FT                   IERVNILKNCKMTNIELPLDSSALEDLAIERIDAETIEAGNNISVDYSRLSARYKESSS
FT                   HHIRDEFESSIKAIDNTLTELQPNSKAVERFDEARDQFNAVSGESDKLKESERKAKELY
FT                   LKIKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGI
FT                   RYHATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERI
FT                   AAYIRRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVITTDLTQYADDM"
FT   CDS_pept        992102..998539
FT                   /codon_start=1
FT                   /gene_family="HOG000095237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751264"
FT                   /locus_tag="AGOS_AGL022W"
FT                   /product="AGL022Wp"
FT                   /function="binding"
FT                   /protein_id="AAS54468.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059873"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021843"
FT                   /db_xref="UniParc:UPI0001DB2C4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q750L4"
FT                   /transl_table=1
FT                   /translation="MNEHNLKAPIPLKNRRIAELSTTEMKLTRSSSSSDDLSTKRAKLF
FT                   NNLTNDCAPSGIPRPRSATPVLSERTGGLQTEDLVQQRLKYYNLDYVSDAEKHEQHIYD
FT                   PNSKWFSRKEKLKMPFEKQLPYTTESHKEQAKYLCHILVNLYIGISTLDIQGLITITSK
FT                   DLADFRKDIDELALNTDMFRLAAEEDLEVNDITNFDEDDEDEDDSQDYDGNDYDLGGPD
FT                   FGPSGKITAKSSSVINVNHWTNELKNCLHFDFPLSVRKSLAVVYYHLSLVQGQKIYRQM
FT                   HINMFESLVTDDDMGTNFRELLLEHGLKLDYKPMLAFLTEFLPCPESDYVRYDITSKAD
FT                   LQLFRLLLKLAHESKMFYDKEDRELLQNTMDRFIASFSPHTLSCVLPIITSFVPYHYQE
FT                   DRNVIDYFPFMFNIWSSTSASMVFDTHLYDFTGCVAEDAYLSLIKEKSPRLVRLSGISF
FT                   GPYGIFTEEQMDFILNRIQNHLRDDYQIHSYSRTVRPLIYSINGSYADQFFGNLSFLIK
FT                   SIETFVHPSNSGQWTKVIAKFVHGLIKMYHERWVKEKKLTETGFRKELWLTPKCNEQMV
FT                   DLFLDVLVLGSQNKDTDMANYYISSFAYLLDINPSNSHKIYDRVLIDLYDSLTDQYIHS
FT                   VHRVITSLKQFTRIVRYMVIHPLYRVHISNILTMLISKIGSNDISLTSNTINALVSIFT
FT                   FIPLENFVKEDEYLTFASQTVAFIQEHIFFLKDGGSSQDFKYDTETLDNAFRASTTEFE
FT                   NILKIYVDKLVELVDSDLEEGLITKINQTTMIMMESMPDSMFKHCCQLISKSFWNLDVF
FT                   SESSPNYELLTIPMGAAVRRDNSLSKKWFMDLSYNIRDQISRGAGSIRSSSEVQRRDLK
FT                   LVSYLSALNDITRQSHEAMLQYKDEFVDLLKFIQNTITNPPLDVITSMVLHCALSSLTS
FT                   IEVTECRLFPEDSKISNSDRWGGLQFDDRKYNDENTNFNWHVPCSEEVDFAIYLLESFS
FT                   EDYMKKITAMMENPNKESAYVDELKKCLLNITHSLSGASLLFDPDFNKEKSDPQLMDPY
FT                   KKKFLLLKQLREQNCDNQEIRLDIEQIRHESLDDDGDESAESLANQELAEDVNDEMPVM
FT                   EDPPIEDTEIPDIENISGVPSVVATPAPGSHFEDGTSAMNSAIVFRDLELFTCRYYFGN
FT                   TTEEKLSDNRYIRVHAIRAKIGKFFHTLFKFLKTNFTDNPGVFQILLHGMKVWFTDVGQ
FT                   ETIFKDDPSSFLDLEFLENIQSLAHSVSDPVTRTYLAADVHSHHDARVLLRSTNRVPSK
FT                   LESTLLRDVIDLAISVYPDIHKPAQGCMVHAMKQLLGSYSLTITKIIKELRQALEKEEY
FT                   RNVEVLLEVLFMKKIHRKLMSDYKNLGDLISLLLQACKVNDLDVAVYADKLLNSIATSF
FT                   KIPSSVCVINLDEIQALSPNDSFIDIQIDVVRKAKANKRDYYYSLLSAIQDSLLAYLNE
FT                   NAELGWKIPVFIVKFISRIQGSLEFSANSRVLEEVFALTKTKHPVIIHLAISNIVAISS
FT                   KILSIGDYDYDISNAFRSDFRRRYIELLDTTEPGFAKKFRDEMSNFDSSTYYIDALGYI
FT                   GWMAWGIPLPVVKNVDQIDLHLRPEDFEVLKNFGNRVSLPWLQELATLLIQDNESRGMF
FT                   SNSNVSFFSLLCRLISNDICGVTYDQLLQLCLSLYDKNDKASMIMSIEIFAGLMTAAKF
FT                   TTVEDLQKRDKFLDEFLSYCLDRELNQDSVDIWNMVCWWLPTYVDIRRLRPLFMKLLQG
FT                   GTELDINSDSSANQASKLTLLRSMLIMLEYKAPDLEDIFVNLVFDHPYDQVRQEVARLM
FT                   SALIQARISPSFESVDQLLASSRDRHLKRLPDSYETHICRLFDAIEQERRSLDNLTPQQ
FT                   VLRTKYYYMASTMLYWIAHIMKSPNQLVLVPLVSKHIAPFLLNLQKMRDTCKLAGISPA
FT                   SFYVSLSYTPLRRDEVPAFVGLLEKTDLTSSNELRTQLYFAENLYSHHMLCMGQRDRDR
FT                   ILDFVIACLFNENYVEVRTRAADVLSGIVHNLTDPACLPRLIDMFQRRLGAFDPAVHRK
FT                   GTAASHPRIHGSIIGLGAVVSAFPYAFPLPHWIPEQLSLLSAWTRAAGVSGTAAKDVIS
FT                   NFKKVRADTWHLDRYTFAPEQLEDLEGVLWRSYYA"
FT   CDS_pept        998909..999547
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928317"
FT                   /locus_tag="AGL021W"
FT                   /orf_name="AGOS_AGL021W"
FT                   /product="AGL021Wp"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="AAS54469.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:121P"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000025344A"
FT                   /db_xref="UniProtKB/TrEMBL:Q750L3"
FT                   /transl_table=1
FT                   /translation="MSGLRTVSSSSGAKNYDSIMKILLVGDSGVGKSCLLVRFVEDKFS
FT                   PSFITTIGIDFKIKAVDINGKKIKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDE
FT                   RTFENIRQWFTTVNQHANEEAQLLLVGNKKDMDTRAVTYEQGESLAKELGVPFIEASAK
FT                   DDENVSDIFFTLAKLIQEKIDNDKLVNNSGREGSVNISSGSNMPSSNCC"
FT   ncRNA           complement(999597..999997)
FT                   /ncRNA_class="other"
FT                   /locus_tag="AGOS_AgRUF20"
FT                   /product="AgRUF20"
FT   CDS_pept        1000113..1002647
FT                   /codon_start=1
FT                   /gene_family="HOG000209413" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751265"
FT                   /locus_tag="AGL020W"
FT                   /orf_name="AGOS_AGL020W"
FT                   /product="AGL020Wp"
FT                   /protein_id="AAS54470.1"
FT                   /db_xref="HOGENOM:HBG052918"
FT                   /db_xref="HOGENOM:HBG333008"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniParc:UPI000025344B"
FT                   /db_xref="UniProtKB/TrEMBL:Q750H3"
FT                   /transl_table=1
FT                   /translation="MLFGVKLANDIYPPWKDWYIDYDGLKKLLKESVIKDLGLSPKESK
FT                   RKGKGDTDEHWTARNESNFVEALDRELEKVYSFQSGKYTEIMGKLERLEEELDGADALQ
FT                   SLDLGHIREELEQALTEAQELDRFSRLNFTGFIKIVKKHDKLHEGYPSVKSLLQVRLKA
FT                   LPFHSEEYSPLLYKISFLYDVLRKSTDTASKSLIESSKLSSFTSEDMPTYRTYKFWIHP
FT                   DNLMEVKTRILRHLPVLVYMAAPPESGDVMGPLNPGAVDEEGSVPSSASSFDATAHQTK
FT                   SLDNVVTTLYFDNEEFELYNNRLLKATSSPTVMLWWTGKLINLSDVFLEKRVPLESKDT
FT                   DTIDREEVRLKLKKKFISGFIFNGDPEFKEKMSAKLRERGSREAEISKFCEDVDSLQKF
FT                   ILQNELQPVLRTLYTRTAFQIPGDDRIRITIDSNIMYIREDCFDEDRPIRDPKNWHRPE
FT                   LDAAVQNPMKFLRPGEYTKFPYSVMEIRVRTQAPSLTNLVTGVGPLIPSQYSEWFYELT
FT                   NSHLVKEVPKFSKYIQGVASLFGEDDRFDMLPFWLPDLETDIRMNPDQAYEEERKRLEQ
FT                   HGVQQAAAARMRRLSLLSHPGGASLEKDSNRQPQRANEPPRVADLEDSDTSEEEAERDA
FT                   QPRKPRNRRKRSMFLTVLTGREPKLSGFDSEDEEVELPPGVKKPTTLIKNAGPVNVEAK
FT                   VWLANERTFTRWLTLATSLSVLTFSIFYSADRSAFPKVANTLSYIYFGLTVFTALWAYF
FT                   VHRRRLSVITERSGQHLDAPVGPLLLALVLVAAQCINFVAVFRGLAQKQNAVAGTLEAA
FT                   GLPFSADELSPPLAAIREFVFWVVGADRGPHL"
FT   CDS_pept        1003174..1004745
FT                   /codon_start=1
FT                   /gene_family="HOG000141768" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928318"
FT                   /locus_tag="AGOS_AGL019W"
FT                   /product="AGL019Wp"
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS54471.2"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="HOGENOM:HBG123954"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="UniParc:UPI0001DB2C4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q750H2"
FT                   /transl_table=1
FT                   /translation="MLDGIRKVLDGTRRSLLAWVYADTPASDTSEYDSGSSQARNIFHC
FT                   SCRDDEGAMHGEMGVLKKRLHSDDINVPQKRSRPAGQGSGFPEALPQKVAQTKEAALVE
FT                   KIDRLIAPASQLKLEKDPFNWDSPITTPSADRPSDAPERHFQYGTAFYRRRRRFQSLPR
FT                   AGAQRSLLADPADEISYLRMVFNGEYKPLKMIQEERKQQLRLLQMDSRDTGLKRSILNL
FT                   TERIRSVLIDTRQSQNQDADVMIVKERIIDPLSLKRKAFYAQKLKFDRSILSFEDEFKS
FT                   YKKLLEERKKIQDEIRKQQRGAVLVPMLTDSDMKDIQLTLARTDKGVLNNKNNFEVTVR
FT                   DFKTLAPRRWLNDTIIEYFMKQIELKYAHTVAFNSFFYSTLSERGYQGVRRWMKRKKVK
FT                   IQDLHKIFVPINLDQSHWALGIIDLTKKKVMYADSLTSRANSMSFAIMKDLQNYVIEES
FT                   GGSMGKDFELEHIACPQQPNGFDCGVYVCTNALYLSEDQALAFDHQDAARMRNYIGHMI
FT                   LSEGKK"
FT   CDS_pept        complement(1005021..1006043)
FT                   /codon_start=1
FT                   /gene_family="HOG000085952" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751266"
FT                   /locus_tag="AGL018C"
FT                   /orf_name="AGOS_AGL018C"
FT                   /product="AGL018Cp"
FT                   /function="NAD+ binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="AAS54472.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG267174"
FT                   /db_xref="HOGENOM:HBG641281"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="UniParc:UPI000025344D"
FT                   /db_xref="UniProtKB/TrEMBL:Q750H1"
FT                   /transl_table=1
FT                   /translation="MDPQELASINKVAKYIKNHPKAKVVFLVGAGISTSCGIPDFRSPN
FT                   TGLYHNLSKFKLPYAEAVFAIDYFQRDPKPFYTLAREMYPGKYIPSRFHYLMKLFESKG
FT                   YLKAVYTQNIDTLEREAGIAADYIIEAHGSFATNHCIDCDKTFPTETFKAMLESGEYAR
FT                   CEDCEGLIKPRIVFFGEDLPSVFYTSWDKLLSEMQAGKEDYLVIVAGTSLVVYPFASLP
FT                   SETPRKVHRVLMNMEVVGDFKTPRKTDIIIHGETDHIAEELARALGWYDELVDISSGRS
FT                   SSETTVVEKDTENQTDIKSASASVIKYKEVSSVSKEESSIDKIAEKILKLDLSRENSDD
FT                   "
FT   tRNA            complement(1006147..1006220)
FT                   /gene_name="tRNA-Asn"
FT   CDS_pept        1006555..1009575
FT                   /codon_start=1
FT                   /gene_family="HOG000248325" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928319"
FT                   /locus_tag="AGOS_AGL017W"
FT                   /product="AGL017Wp"
FT                   /protein_id="AAS54473.2"
FT                   /db_xref="HOGENOM:HBG436298"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="InterPro:IPR008616"
FT                   /db_xref="InterPro:IPR021846"
FT                   /db_xref="UniParc:UPI0001DB2C4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q750H0"
FT                   /transl_table=1
FT                   /translation="MKQRISSLDLQLLARELKAQLEGCRLANLYNVADASKQFLLKFTK
FT                   GESKISILIDCGLKIFATEFSRPIPPSPGPFVAKLRKHLKAKRLTTVKQVGADRILVLS
FT                   FADGLFFLVLEFFAAGNVILLDADRRILALQRVVRDHEQKVGEIYNMFDDHFLEDVSLP
FT                   VPKLDTHTLPVVQELLIKTKTAAEESKAVMPAAPVGGRKQSLKVPSIHKLLFSSYPYLS
FT                   SDLLNKILKEHGIDPSQSFLELFDSADQLVDILNIAEKEAYMLLTSEKKNGYILARENP
FT                   LYDEKKDAEGIRLTYEQFHPFRPYLPDGSQKKFEIVEVDGDYNRTVDKFFSTIDSTKYA
FT                   LRIQTQEQNARKKLEKAKAENQKKIQALVEVQHTNEQRGNAIINNIELVEEAKSAIQGL
FT                   LDQQMDWTSIEKLIKTEQAKSNRIARVIKLPLNLKANKISVELPLSNEDDESSDGSWGD
FT                   SESDSGFSSSDDELSDSGLSDFDAEVVRGSGSKNKKGKSKVSNKSITVSIDLSMSAYAN
FT                   ASSYFEMKKTGAKKQLGVEQNVQKAMKNIEQKIEKDLKKKLKEQHDVLQVIRSPYFFEK
FT                   YFWFISTEGFLVLMGKSGIETDQIYSKYIEDDDVYVSNGFGSQVWIKNFERTEIPPNTL
FT                   MQAGIFANSASEAWSKKVATSPWWCAAKNLSKFDDVGGGLLPSGAFRLKSDEAKNFLPP
FT                   AQLVMGFAFMWKIKTDDDQEAGYEEDMPAEIDEMGEVSHPSEEMVEESIGPADNLLPSN
FT                   SNQSINDIIDDIPRVVGSESPVEQTAGVSGLAETKESTHDSESVVVSIIENMNKNVRGK
FT                   KGKLKKIQKKYSNQDEEDILLKLQALGTLKGIEKQQKEKESEFAREQEREVKKKRREKQ
FT                   QQAQALKFTSSEKVKVNYKKIFKELKPVISADEEVLAPIPVFAPWPALTKYKYKVKVQP
FT                   GTAKKTKSVNDVLHYFQRRNVDPLQKDKEADWPVEHELLKVFKDQDFIPLICVDKLKVS
FT                   IPGGGEKQGSKTKSKKK"
FT   CDS_pept        complement(1009682..1010248)
FT                   /codon_start=1
FT                   /gene_family="HOG000214428" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751267"
FT                   /locus_tag="AGL016C"
FT                   /orf_name="AGOS_AGL016C"
FT                   /product="AGL016Cp"
FT                   /biological_process="transport"
FT                   /protein_id="AAS54474.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG326766"
FT                   /db_xref="HOGENOM:HBG353326"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI000025344F"
FT                   /db_xref="UniProtKB/TrEMBL:Q750G9"
FT                   /transl_table=1
FT                   /translation="MANLSLYAVEAVVILDNDGQRIYAKYFNPPHQAVEEDSLSSNVKL
FT                   QKELEATLFKRTHKQNADILILDEHLVLYKECADVCIYLLGPLDENEIVLQDTLGAMKL
FT                   ALEMVLNTDLDKRSLQDNYEIVCLVVDETVDDGIILETEARTIASRVTKSPTQETVVID
FT                   LSEKGLLSAWGFAKSKLAERLQQGL"
FT   CDS_pept        1010616..1011677
FT                   /codon_start=1
FT                   /gene_family="HOG000141699" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751268"
FT                   /locus_tag="AGL015W"
FT                   /orf_name="AGOS_AGL015W"
FT                   /product="AGL015Wp"
FT                   /protein_id="AAS54475.1"
FT                   /db_xref="HOGENOM:HBG123957"
FT                   /db_xref="HOGENOM:HBG203938"
FT                   /db_xref="InterPro:IPR006565"
FT                   /db_xref="UniParc:UPI0000253450"
FT                   /db_xref="UniProtKB/TrEMBL:Q750G8"
FT                   /transl_table=1
FT                   /translation="MSCSKDFYFGLLRVSMIQLLKAHGFDRARSSTVDMFTDLYVRFLG
FT                   LLASELQRLASARQQQDDTVCLQDLTLALQNLGLIRPADVLDVYDENPALPGDEGVQRL
FT                   KNWAVHDAAAVDARLVATPTPELLRVREGGGGKAGTKPLSLIPEYINQLNSGKKNEEEE
FT                   REETELVEAMINNGDMDDWVRFMVTRQRVHALRKLSGKMPRELESLPTIPGLKNSVLGR
FT                   GKGGANPEHFPADVIDEQNHELRSHAAELVSRLPASNKNNRLDAISLSFEEDPAYAPDP
FT                   MSLDDAIMDLDYLDDAVLEEEFGDHYKDFNEFESLEVADALKLTDTDLELGDYQDIRDA
FT                   FNNGDSPTYDTGI"
FT   CDS_pept        complement(1011773..1015411)
FT                   /codon_start=1
FT                   /gene_family="HOG000164239" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775321"
FT                   /locus_tag="AGOS_AGL014C"
FT                   /product="AGL014Cp"
FT                   /function="binding"
FT                   /protein_id="AAS54476.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG051976"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012978"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB2C4D"
FT                   /db_xref="UniProtKB/TrEMBL:Q750G7"
FT                   /transl_table=1
FT                   /translation="MDADKVAHELELEERLSKIRAQSNSKLDNQKHVAITLSAVEETMG
FT                   EQKDGAGNVVNYLIAFMSLLDQSVSQETRELQDVQLGASSCYLLDIVFQHTPKPLLRSK
FT                   FAELLMKIAPCITDPRTTAPLVRSALGCLEALLIAQDAQTWQNTQGLSVSPVRGLNGLL
FT                   ELSLDSRAKVRKRAQEAIVRILQNPPPAPTSAHVAAPVIADFALKALVSAIDEAANISN
FT                   KKLRAVGGSDTLNAKTIHILRLIASITSTNQWPATLTEQLCDLLLEISKSSNQYLVSEA
FT                   FGCFEALFNSMAESSANSGLADDKFLNVLDIIFSMKPSKSDAHLAVAWIAVVAKGVSTY
FT                   ASHQPLKCLVKIPDVFNVISFYLGSETPEVYFSASQCLIAILTDAIKDELLLYPPQVDG
FT                   ETFEAVDDVISKLSEIFTGFLTINYTHCAKEVLNTLAAAFKKLRHRCNPDFLRPLEIVG
FT                   AWRTNEEQFLDFRNAAEQVIGAAIEAMGPETVLGCLPLNLENPSDKRPGRAWLIPLIRD
FT                   HTKNSLLSVFAKEFIPTIRHFESTIEKLDKESIQCTLLQTVVDQLWSTFPQFCVLPKDL
FT                   NDVFTDEFAAELASLLYSRIELRTVICNGLKVLVTSNLLYRDGAYKDDIIMGQQFPPTE
FT                   AEKNIEYLSQKSPNMLAVLFNVYTQTAPNARSYILETIEAYLKITSAENLSNTFDNVCA
FT                   LLKDAMDKEASSQPVKGQPKMSATLLDLVVVMSRVVPASSYTALFSIFNTTVNSQDVLT
FT                   QKRAYRIISNVADLEGGSGAVQSYISDIENVMIAAAKTVQTASKAARLTAITALVKLLP
FT                   SDHHNFIVQIVPEVIVSCKDTNEKSREAAFGALIVMGKLMNEGNGIIKLSQLPGYDPAT
FT                   PDQQSSVAEFFKIISAGLIGESQHMVSATITAYSCLVFEFKDEVDPQVLLEIYDTIELY
FT                   LTSNSREIVKSTIGFCKVCCLSLSDEFMRPRIPSLLPKLLRWSHEHTGHFKAKVKNILE
FT                   RLIRRFGYDFIDANFPEEDRKLLTNIRKTRNRNKRKAAEEDQNATSSTVQSSQKNSRFM
FT                   SAFDEAIYDSDEDEGNDSDANENTKAKQYIVESKEDPLDLLDAGALAHVSSTRPKKMSK
FT                   EEKRKKLASSDVYSFDSEGKLVLKNESGQAAEETLESLTSGINAYLDAVKNGPIKGQKG
FT                   RLKYKKGRRDNADDSDDEGVPHPKANGPQRPNRVGKKGIHKNRRKL"
FT   CDS_pept        1015802..1016158
FT                   /codon_start=1
FT                   /gene_family="HOG000246720" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751269"
FT                   /locus_tag="AGOS_AGL013W"
FT                   /product="AGL013Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS54477.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG114333"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="UniParc:UPI0001DB2C4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q750G6"
FT                   /transl_table=1
FT                   /translation="MGKGLVRIRLARFGRRHSPVYNIVVANAHKATTRKPIEVIGTYDP
FT                   IPSPLTREEVRAGVVPTKDIQLDFDRAKYWIGVGAQPSETVTRLLKKCGILPPEWGRSY
FT                   SSTKVVEPVKEVVE"
FT   CDS_pept        complement(1016557..1017807)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622771"
FT                   /locus_tag="AGL012C"
FT                   /orf_name="AGOS_AGL012C"
FT                   /product="AGL012Cp"
FT                   /protein_id="AAS54478.1"
FT                   /db_xref="HOGENOM:HBG059874"
FT                   /db_xref="UniParc:UPI0000253453"
FT                   /db_xref="UniProtKB/TrEMBL:Q750G5"
FT                   /transl_table=1
FT                   /translation="MDAAVVSEVGQVPARSNKRFKGMIFSKIQHHLTHYKKYRHWRWQA
FT                   KRRLAGCEQEKSEQVVQEPENAEPLAKLGDALTVTALTGKMSYYRQLQGSVSSLLSSVS
FT                   QLTTSTRAPECDFTEQFITLLVNTYHEMCLDATVTPFDKTNPPSAFLNKVARAAVERSE
FT                   QQSIAIGRPRDKWLLTCTRKRLLQEIKRETEDVPQGSVRSVACSMNHGTLQRDLGSAFA
FT                   EEGDFFYWDPDFELFQGITANLLTDTGDISGKNSPMSFGSGAEKSNESTSEDKNNSKIS
FT                   GFGSSMGKGETSSISETGSNQTHPRQPAASPTSELDNCPGKLQNKIEHHTNRSVSCPIS
FT                   PVSYVTSRTCSNCALSIAAPFMVPSNPPRPLPRDPIKALPDFTATLQESMRACDALASK
FT                   LDVLGESFLATGPNPVC"
FT   CDS_pept        complement(1018481..1019434)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751270"
FT                   /locus_tag="AGL011C"
FT                   /orf_name="AGOS_AGL011C"
FT                   /product="AGL011Cp"
FT                   /protein_id="AAS54479.1"
FT                   /db_xref="HOGENOM:HBG059875"
FT                   /db_xref="UniParc:UPI0000253454"
FT                   /db_xref="UniProtKB/TrEMBL:Q750G4"
FT                   /transl_table=1
FT                   /translation="MASPIFVSRRPTSLNLEAGAMGVGIALTSSARSHQFLTAAEHALA
FT                   LKAAGVSVGLHLLFRGLSLAVGDVESVCNVGVLVACLTECALTSQLDILFWNSLCKLST
FT                   QRKPSVVQLGVPPSRLQRRRRRLEALARFAQAHLHKAVLLLVLYPMSGHWERALVGLWS
FT                   YTQLQSLLGQQLAAGATALLSLASLRFSILWHINCVCHLWTLDLCIRLLLAPYFGGVHF
FT                   TKGEQDIWIQTRLGVLHGFVLLIYILIARFPYISAPVFYIAHACTAALIDRVTDPLPEN
FT                   DTIGSKDMSRWTATQVLWLNERELVDAARANVGLPE"
FT   CDS_pept        1019939..1022344
FT                   /codon_start=1
FT                   /gene_family="HOG000241266" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751271"
FT                   /gene_name="CHL1"
FT                   /locus_tag="AGL010W"
FT                   /product="ATP-dependent RNA helicase CHL1 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54480.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG211585"
FT                   /db_xref="HOGENOM:HBG381928"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR013020"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="UniParc:UPI0000253455"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750G3"
FT                   /transl_table=1
FT                   /translation="MGRCEFYHPFTPYRIQLELMQQIYGLLESGKKMGIFESPTGTGKT
FT                   LSLICSTFTWLREHKAGYLQGSTGAQDSEEDSEDEPAWVKENYEQSVLADVTASMRAYE
FT                   QRLAAVDTDLLVKGAAKRQRVEVAVERPDDGAEFLPDAYHSDVEERPSHAGGRGQLRKQ
FT                   LDADIKRLLRKLDEPDAADKSRLAANPLKVYFASRTHTQLGQFAAQLRLPQFPPSLAGL
FT                   EQERVKFLPLGSRKQLCIHKKVSKVKSDGINEACMDAVSKSECSFFSAAREPDIIRQFQ
FT                   DQAFSTIQDIEDLVGIGNTLHACPYYSSRELIEGAEVITLPYQHLLLENARKTMGIDLR
FT                   DSIIVIDEAHNLIDTINSIHSASISLTELRQCKLALQAYLAKFKTRLNSGNRVNLLKLI
FT                   KMVDVLSQFIETQYKNGKRINDPNDIFMGTSMDVVNIHKLEKYMKTSKVAYKIDKYIQA
FT                   TTSNDLQDRGSRDIKQPILFKVASFLKTLANPSEEGQFFFENGHVLKYMLLEPSEVLKS
FT                   IVTEAKCVILAGGTMEPVNDFFTQLVPYLAPTDVTTYSCGHVIPDDNLNAFIVSENFEF
FT                   TFANREDIALIERLFHFIYQLASRVPFGMVVFFSSYKYIDFVVKTWTDRGLLSRLDAIK
FT                   RIYHETSDGADVLKGYSETIQSEKKGAILLAVVGGRLSEGINFENELARAVVLVGLPFP
FT                   NMFSGEMIVKQQHIKEKVIRNGGTQEDVNKAVREFYENICMKAVNQSVGRAIRHASDFA
FT                   NVYLIDKRYSGPRIQQKLSDWVRKRIQSASNIPKILSDTEAFFSGKGL"
FT   CDS_pept        complement(1022374..1024095)
FT                   /codon_start=1
FT                   /gene_family="HOG000074727" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622772"
FT                   /locus_tag="AGOS_AGL009C"
FT                   /product="AGL009Cp"
FT                   /protein_id="AAS54481.2"
FT                   /db_xref="HOGENOM:HBG059876"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI0001DB2C4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q750G2"
FT                   /transl_table=1
FT                   /translation="MKILRDLVIPRKELQHWTDNLTWAKDGTLYVTTIPDVTCCEPVFS
FT                   REINGQAKQLFYTKEFPLELGNKFEYDLAERDVLLNAQPEPGVVMCAPSPSAMQLAILT
FT                   NNANVITTMGQTCVGVSDERTLSEAERAYRAVCWGPDGRLLVVGNECGELKIFSVRAAG
FT                   GGASVGHLHTVSVGGPEEWVVGIRWKGDMIVAYTSANSVHMVSAVDYKHQELLGASRRQ
FT                   VTDVQLVGKHVLVARMDALHKIDYYSGQVEVLALGWGTESYIVPLPDQEAAVVLCNRTS
FT                   CKVLLDGPFEAGPDDVIAPHIETKFKKWNTVFNEFNKYETTFNIYGVALSPDGYCLAIL
FT                   YEIERVSFKYRILSELQFRIMFLPLTSKWRITPRATGLALYQNYHIYNGLVPENLEETQ
FT                   SIDFSTKQEFALFLEEIRNSEQVSKLRFQNLLRDSPSDEWYKRLLYKYALDNRDRITNP
FT                   LDKACVISLANILKVPAPFTSTLVTLKGEYVTESFNFSENDDPRVLKSEDGTLWQRCAI
FT                   TYLPLLTASVKVCPVSNHRIIDIRRDTYNDYGWLTRTLLEVFNDESLYTGTRMTTI"
FT   CDS_pept        1024201..1027737
FT                   /codon_start=1
FT                   /gene_family="HOG000036674" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622773"
FT                   /locus_tag="AGL008W"
FT                   /orf_name="AGOS_AGL008W"
FT                   /product="AGL008Wp"
FT                   /function="hedgehog receptor activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54482.1"
FT                   /db_xref="GO:0008158"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG196835"
FT                   /db_xref="HOGENOM:HBG326129"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="UniParc:UPI0000253457"
FT                   /db_xref="UniProtKB/TrEMBL:Q750G1"
FT                   /transl_table=1
FT                   /translation="MRTNEMLSVILVGVYLLVGLPCGRAAAQCAMYGNCGRQSAFGAEL
FT                   PCPVGADFTPEPLSADDSGFLASVCGPEWGSMDYVCCTRDQMVKLRANLKKAEAIIASC
FT                   PACAKNFAATFCHFTCSPAQRQFLDVKETELSTIGKRIVTEVDFYVESEYGESFYDSCK
FT                   NVKFSSTNGYAMDLIGGGAHNYKEFLNFLGDKKPSLGGSPFQINFKYSSETGQAPLNEK
FT                   TYACNDTEFRCACADCQESCPVLKPVKSGQCKVGKLPCLSFGALVAYGGAALALLLSYL
FT                   YVSRAKGDGVLLQDDAMGDDNEELNRQAEDELFHEYPTSRYRLNDVLADHLGSVAAYCI
FT                   KYPYHVLGATFAVVLILSSLIPFFGRLETDPVALWVSKRSPRFIEKQYFDENFGPFYRM
FT                   EQIFIANDNGPVLSYEHLDWWFTIEKEITSGLQSSDNTTFQDLCLRPTSDSTCVIQSVT
FT                   QYFDGILPPKSTWLEDLKTCAESPVSCLPSFQQPLNSKLLFSHENITESNALVISLPVD
FT                   NHTQSAELWEQTLEDYLSKLDVPKGLRLSFSTESSLSKELGKNNDVTIVLISYVIMFFY
FT                   ASWALKNKMGKQRFLLGGTGILIVFCSILSAVGMLSALGLSSTLIIAEVIPFLILAIGV
FT                   DNIFLLTGEYDRTTAGNTSLSIEDRILISVRKIAPSIVTSVVCQTVCFLLAAFVGMPAV
FT                   RNFALYSAAALFFNFLFQITAFVSILTLYENKYESYLSNTSLEQEPPFFLPKLRNVILK
FT                   KSTAIVFIVWSLASIVFLPYISIGLDQKMAVPQDSHLTTYFEDVSQYLNVGPPVYFVLR
FT                   NLDLTKRENQKKICGKFTTCNEFSLANVLEQERNRSTITEPLTNWYDDFMMFLNPALDE
FT                   CCRLKKGSQEVCPPRYPFRRCQTCYPPGTWDYDMTDFPEDGEFMRFFKIWIDAPSEPCP
FT                   LGGKAPYSSSIIYNDSVIEASMFRSYHSPLRTQKDYIAAYKDAERITGEFKDLDVFAYS
FT                   PVYIFFDQYRSLVSLTLKLLAVALITMFWISLVMLGSVSTALLLTGTVFMILVDIGASM
FT                   VLFNIPLNAVSLVNLVICVGLAVEFCIHIARAFTLVPVGIKNSRPSRSVYALASVGESV
FT                   FRGITMTKLIGVCILFFAQSKIFQVFYFRMWLSLILIASLHALIFLPTALAFLGGQSYV
FT                   EGNSEVRLVDAE"
FT   CDS_pept        1027911..1029521
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751272"
FT                   /gene_name="AEP3"
FT                   /locus_tag="AGL007W"
FT                   /product="ATPase expression protein 3 "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS54483.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="HOGENOM:HBG059877"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI0000253458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750L0"
FT                   /transl_table=1
FT                   /translation="MNKIVHKVAEAFRKNGVPRTKWLNPKTIYGLANQKLLGSVEAPHA
FT                   QGTGLNTVPQVEHYTKACRTKQRDMVRSYLEATGSTHFARLNTPAYNKSSALEFYAKLK
FT                   ALQRYTEGEEVLFQMSSVEVREIISRLVKLTQEGDQIPDEQRRFPTELFMDVAPVPNFN
FT                   DDPGILEQYIGILTHSAFYYHNTSKIDPIPHILRDLLHPQNEKTASLRTTTMFNDLIYY
FT                   FGKKSDYASCREYYSQMKLEKKTPNIETYRLLFLNLLKNMQIPKKQLPYKEMIFYLNDM
FT                   EKFGVPADAKIWAYCYHLLVESVSKKLLLEKMIQHNAPISPDFIVSILRTLDVDCKAIL
FT                   EFAKEYSIPFTPKLLRLCISKLCKEYKFESAWQLLTSLCRSTDVVTTGSVNILLNAAAE
FT                   KGRLDLAVLTYNSMKVQLGVTPDLRTHRLIFKAMARNGYHENFQDVYHWAVWSMKRSTS
FT                   GWFVHDAWSRRCESMIKQKCGSVTPPTTENMEKVAAILHRGVWDNRGLFIRCWGEYKEL
FT                   RHVFRLLGSIPPAYKGKTA"
FT   CDS_pept        complement(1029946..1030863)
FT                   /codon_start=1
FT                   /gene_family="HOG000214828" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751273"
FT                   /locus_tag="AGL006C"
FT                   /orf_name="AGOS_AGL006C"
FT                   /product="AGL006Cp"
FT                   /protein_id="AAS54484.1"
FT                   /db_xref="HOGENOM:HBG056465"
FT                   /db_xref="HOGENOM:HBG332946"
FT                   /db_xref="UniParc:UPI0000253459"
FT                   /db_xref="UniProtKB/TrEMBL:Q750G0"
FT                   /transl_table=1
FT                   /translation="MHRTYSLRNQKAPTASDLQSPPPPPSSTRSKFFGRAGIASSFRKN
FT                   AAGNFGPELARKLSSFVKTEKGVLRALEVVANERRAAARQLSMWGMDNDDDVSDVTDKL
FT                   GVLIYELGELQDQFIDKYDQYRVTVKSIRNIEASVQPSRDRKQKITDQIAHLKYKEPQS
FT                   PKIPVLEQELVRAEAESLVAEAQLSNITREKLKAAFNYQFDAIRELSEKFALIAGYGKA
FT                   LLELLDDSPVTPGETRPAYDGYEASRQIIMDAEQALEEWTLDAAAVKPNLSFHQTVDDV
FT                   YDGEDGGEEHDWEGTQDETEQATK"
FT   CDS_pept        1031231..1032607
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751274"
FT                   /locus_tag="AGL005W"
FT                   /orf_name="AGOS_AGL005W"
FT                   /product="AGL005Wp"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS54485.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059878"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000025345A"
FT                   /db_xref="UniProtKB/TrEMBL:Q750F9"
FT                   /transl_table=1
FT                   /translation="MDRYDRQKRLWGASGQQGLRHAHVCVIGGADGGLWCEVAKNLALS
FT                   GVGAVRIISTGSSDDSYERFFQPAELCSLNTDVGWSFSSWKGAAVAAEQWSECSALIVT
FT                   TGAPGVVEEVTAKWRERKMPVLLSAHCASVYGYVRLLSPETHCVIEAHPQHRVPDLQLY
FT                   AGWGELDELCGKTAVSQLDPEERQDVPFAVLLRSAVRSLGRKPASREEARAALDDLYTP
FT                   NHSGATIEDMNFLEAVKYAHLALAPTEPVLPRVAEAWAAMPPDLEQVGDPFNRQFWVLV
FT                   RALKQYFTAYGSLPLSGELPDMESSTVRYYELKDCYEQKARADRKRLAGFLSSTIPDAV
FT                   IDAFCRNLRYLRIIRPSKLIGLDESLSELKRVNTDGAMLLSALLSIQYGIQEPTVNKKG
FT                   SEYLNNINRFSGSNFYPTVAFIGGVLAQEATKFLTHQYVPIENTFVYDGLLNTTETIML
FT                   "
FT   CDS_pept        complement(1032636..1034564)
FT                   /codon_start=1
FT                   /gene_family="HOG000268803" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775322"
FT                   /gene_name="SPB4"
FT                   /locus_tag="AGL004C"
FT                   /product="ATP-dependent rRNA helicase SPB4 "
FT                   /EC_number="3.6.4.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS54486.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000025345B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750F8"
FT                   /transl_table=1
FT                   /translation="MSFLDFCFLFVAMSKNSSERLQSSHRQQDLNSNSRLQETQAFIMS
FT                   KSLSWDTLDYTLQPWIRTAVDAMGYETMTPVQASTIPLFARNKDVVVESVTGSGKTVAF
FT                   VIPVLERVIQDDANSSKLKKGHFHTIIISPTRELASQIQGVIEAFLTYYPDGEYPIKSQ
FT                   LLIGSNTSSVRDDVAAFLEHRPQILVGTPGRLLDFLKMPNIKTSSCGAAILDEADKLLD
FT                   MNFEKDVETILKMLPKQRRTGLFSATVSSAGTQVFKTGMRNPVKVSVKTSNKAPSSLDI
FT                   NYIVIEPRMKLQLLLTLLNNYRYKKCIVYLPTCIAVTYFYSILQHLAKLNKMDENLKLY
FT                   SLHGKLLTNSRMKTLDRFTQELGKAVLLTTDVAARGIDIPDIDLVLQMDPPIDADIFLH
FT                   RCGRAGRANRAGRAIVFLNQGREEDYIPFLQVKNVEAKELDTVAIKPIEGLPEIIRAWI
FT                   LEDRARFDHSLKVYVAFLRYYSKHTASSIFRLQTLDYIGIAEMHGLIRLPGTPEIQRYL
FT                   SKDAIPEDGWLVSPPIDLDSFAYADPQREKARKLAKKEAKDVKDNNKLKSEMRKNNEAW
FT                   SKKTVTKENKLQRKEKMALKRKAIEEKLIENSDDSDNEVETDWKDIVRQRKKKKTNSGM
FT                   QGDFGDL"
FT   CDS_pept        1034603..1035901
FT                   /codon_start=1
FT                   /gene_family="HOG000199032" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079581"
FT                   /locus_tag="AGOS_AGL003W"
FT                   /product="AGL003Wp"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="tRNA pseudouridine synthesis "
FT                   /protein_id="AAS54487.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0031119"
FT                   /db_xref="HOGENOM:HBG357474"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0001DB2C65"
FT                   /db_xref="UniProtKB/TrEMBL:Q750F7"
FT                   /transl_table=1
FT                   /translation="MSFLSRMLKLGKATATVGECEYTKWSKEQLIERLLLLEGEGKRSA
FT                   DTSVASEDPKRKKTNENAKKVKTKTPKEFDFSKYNTRFIALKFAYLGWNYNGLAIQKDP
FT                   TPLPTVEGTILEAMNKCRMVPSMVPQDYKFSRCGRTDKGVSAMNQVISLRVRSNLTPQE
FT                   QEDPANDAREIPYIHILNQLLPDDIRISAICLRPPKGFDARFSCKYRHYKYLFNKSGLD
FT                   LSKMEEAARLYEGEHDFRNFCKLDGSKQITNFKRTILSAKILHVDGDMYCFDLLGSAFL
FT                   WHQVRCMMANLFIVGQGLEPLTLINNLLDVEKNPQKPVYDMASDIPLILYDCKFDDMEW
FT                   QLPDLSAEKAFKTTRSVDGIYLDYQLKAAVSTIFKNTLPRADKNEKITINVGDGKGKVV
FT                   NVYQKLFDRQFSESVEAVNAKYKERKRKNTKGQ"
FT   CDS_pept        complement(1036075..1036773)
FT                   /codon_start=1
FT                   /gene_family="HOG000170930" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751275"
FT                   /locus_tag="AGL002C"
FT                   /orf_name="AGOS_AGL002C"
FT                   /product="AGL002Cp"
FT                   /protein_id="AAS54488.1"
FT                   /db_xref="HOGENOM:HBG030340"
FT                   /db_xref="HOGENOM:HBG397278"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="InterPro:IPR016689"
FT                   /db_xref="UniParc:UPI000025345D"
FT                   /db_xref="UniProtKB/TrEMBL:Q750F6"
FT                   /transl_table=1
FT                   /translation="MKKFGVAAFDEVTRDYETLGINFDRQNQELKEQLTIFQERLAEFA
FT                   KDNNKELRANPELRVKVLKMCSKIGIDPLLIFDKDKHLFHVDDYYYELCVKVIEICRRT
FT                   KDLNGGIIAFEDLHRGYFKGTKVQVDDLEKAISMMKSLDGGFEVFIIKGKKYLRSVPNE
FT                   LTGDQTKILEICSILGHASIALLRANLEWKSVRSKAVLEEMVAKGLLWIDEQADGETLY
FT                   WDPAWIMRTY"
FT   CDS_pept        1036882..1038057
FT                   /codon_start=1
FT                   /gene_family="HOG000074728" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751276"
FT                   /gene_name="HAT1"
FT                   /locus_tag="AGL001W"
FT                   /product="Histone acetyltransferase type B catalytic
FT                   subunit"
FT                   /EC_number="2.3.1.48"
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin silencing at telomere "
FT                   /biological_process="histone acetylation"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="histone acetyltransferase complex "
FT                   /protein_id="AAS54489.2"
FT                   /db_xref="GO:0000123"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006348"
FT                   /db_xref="GO:0016573"
FT                   /db_xref="HOGENOM:HBG197707"
FT                   /db_xref="HOGENOM:HBG738699"
FT                   /db_xref="InterPro:IPR013523"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017380"
FT                   /db_xref="InterPro:IPR019467"
FT                   /db_xref="UniParc:UPI0001DB2C66"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750F5"
FT                   /transl_table=1
FT                   /translation="MAEELKPELWTTSSNSALKLSLVNDENAVQFSPIFTYPIFGQAEQ
FT                   LFGYQDLNILLAFDSVTFKPFLNIKYTKKLERGLDDVEGSILKFLPEGDVILKDEVEWV
FT                   DAFNGEREKFALPNSESKVAEYTSGGESFAIFKVHLSDPNIRQLHRRMQIFTLLFIEAA
FT                   SYIDEDDSAWDIFMTFNTSTRQCIGYTTTYKHWRYINGQEFDSSEKTTKRAKISQFIIF
FT                   PPYQSKSHGSHLYSAAIDVWSKEEKISEVTVEDPNEAFDDLRDRCDFMRLSGSGLSSSI
FT                   PEDVPIPRTWLTEQARKYKLSLVQFTRLVEMILLYDNSPNFEIQVKARLYQKNHEVLTG
FT                   MDSDTRKAKLQEAFTSLKEDYARILQKVPNRRRVLPSDEENAGESKRHKKE"
FT   CDS_pept        1039149..1039748
FT                   /codon_start=1
FT                   /gene_family="HOG000066132" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928320"
FT                   /gene_name="LOC1"
FT                   /locus_tag="AGR001W"
FT                   /product="60S ribosomal subunit assembly/export protein
FT                   LOC1"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS54490.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG059879"
FT                   /db_xref="HOGENOM:HBG396584"
FT                   /db_xref="UniParc:UPI000025345F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750F4"
FT                   /transl_table=1
FT                   /translation="MAGKQTKTAKRAKTQNRTREVTSEVFQDSQARNQLANAPKVEKPS
FT                   ARKATKRQVKKEQAVVRLYGTRKKEKTYSEKELNIPTLNRAIVPGVKIKTGKKGKKFVD
FT                   DHDLLTLNRLIKTIGDKNDEVTESKLEKAKRLEEIRELKKQELERKEQAKKEKLDDKMD
FT                   ELKRKASVARTLRRKNKRHEKKLEDVPKSSKKVSFA"
FT   CDS_pept        1040244..1041692
FT                   /codon_start=1
FT                   /gene_family="HOG000130831" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622774"
FT                   /locus_tag="AGR002W"
FT                   /orf_name="AGOS_AGR002W"
FT                   /product="AGR002Wp"
FT                   /function="transferase activity, transferring acyl groups,
FT                   acyl groups converted into alkyl on transfer"
FT                   /biological_process="cellular carbohydrate metabolic
FT                   process"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="AAS54491.1"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0044262"
FT                   /db_xref="GO:0046912"
FT                   /db_xref="HOGENOM:HBG127450"
FT                   /db_xref="HOGENOM:HBG309523"
FT                   /db_xref="HSSP:1AMZ"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="UniParc:UPI0000253460"
FT                   /db_xref="UniProtKB/TrEMBL:Q750F3"
FT                   /transl_table=1
FT                   /translation="MPPFRPMKLCRSITRSSTARPRSLKEAVEQAIPLRRHELKELKAY
FT                   SNMQIDSITVGSIIGGMRNNKSMLWQGTTLDPFNGIKFQGKTIQECQQLLPCSPDKQSK
FT                   KTEFMPESMLWLLMTGEIPKKEEAFGLMHELSQRGKTLPPFVEHIIDSLPRTMHPMTQL
FT                   AVALASLNSSSTFCKNYQDGVIGKEDYWHYIFEDALNLIALLPQLVGKIYSNVTNEGMP
FT                   LGYFNPDRDWSYNIASLLGMTYRDSVNKRNLTKEQCDDFTDLVRLYCGIHVDHEGGNVS
FT                   AHATHLVGSALSDPYLSYSAGVMGLAGPLHGLAAQEVVRFLVDMAARIDSPDNESQVSE
FT                   YLWALLNSGKVVPGYGHAVLRKPDPRFDAMLRFVEARPQEFQGDRYVQLMRNLSKYAPK
FT                   VLTEHGKTKNPFPNVDSASGVLFYHYGIHDLLFVTVIFACSRAIGPLTQLVWDRILGLP
FT                   IERPKSVDMATLRRLVNQNLRNAK"
FT   CDS_pept        1042268..1043824
FT                   /codon_start=1
FT                   /gene_family="HOG000159916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775323"
FT                   /locus_tag="AGR003W"
FT                   /orf_name="AGOS_AGR003W"
FT                   /product="AGR003Wp"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="2-methylcitrate dehydratase activity "
FT                   /biological_process="propionate catabolic process, 2-
FT                   methylcitrate cycle"
FT                   /protein_id="AAS54492.1"
FT                   /db_xref="GO:0019629"
FT                   /db_xref="GO:0047547"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="HOGENOM:HBG006969"
FT                   /db_xref="HOGENOM:HBG298383"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="UniParc:UPI0000253461"
FT                   /db_xref="UniProtKB/TrEMBL:Q750F2"
FT                   /transl_table=1
FT                   /translation="MKINGALLPSLRRSNGLKIIAAVARMSSVADSSSNTRPQADQVLK
FT                   DIASYVHNTRITSTEAFKTARLCLLDTLGCGLAALRYQEPRGVIKPIVPGTIVPNGTRV
FT                   LGTKYRMDPVSGAFAIGTLIRWLDYNDCWLAAEWGHPSDNLGGILAVADYMTRLSQSSG
FT                   GDEGRLFTIREVLEAMIKAHEIQGILALDNAFNKVGLDHVVLVKVATTAVVSKMLNLSE
FT                   SQTVDALSHAFVDGQSLRTYRHAPNTGSRKSWAAGDATSRAVKIAFLVKNGGVDGIPSV
FT                   LTAKDWGFYDVLLKGKPFEFKQRKTYGSYVMENVLFKISFPAEFHAQTAVEAALKVRKQ
FT                   LNRMGKNYQDIKSITIRTQDAAMRIIDKSGPLYNYADRDHCIQYMTAVPLIHGRLVADD
FT                   YHDLVALNPAIDELRSKIYCVRDDQFTAAYNNPDTRAIPNGLTVELNDGTTLEEVVVEY
FT                   PIGHKTRRAEAEPKLLEKFYRHLSGHFEGDITKVEQVMTMSTDPEFESYSIDQYVDTFC
FT                   R"
FT   CDS_pept        1044046..1046601
FT                   /codon_start=1
FT                   /gene_family="HOG000093574" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928321"
FT                   /locus_tag="AGR004W"
FT                   /orf_name="AGOS_AGR004W"
FT                   /product="AGR004Wp"
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="AAS54493.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG059880"
FT                   /db_xref="HOGENOM:HBG396067"
FT                   /db_xref="InterPro:IPR007231"
FT                   /db_xref="UniParc:UPI0000253462"
FT                   /db_xref="UniProtKB/TrEMBL:Q750F1"
FT                   /transl_table=1
FT                   /translation="MNNSINASDLRSVSPHEAPLKGVSKTFNDLIETSKNLPSTSSELG
FT                   SVLLNVNELKKRAAELRAKNVKNKSPHHTRAHYLLAGSGLAIQDVESSLKTLESRQLLE
FT                   QNVQNKVPDGDLDTYLRNKKDENILSSIEQSLSLAAKDFDNFVNANFNLDWKKHKEEVK
FT                   RSFLGLVWKSDPNHKSPTSVSEPSFMTWPKKGSGILDGESKLNINENYVVREKFEKYAR
FT                   IINRFNNARQLHNNFPLTTEFITLFQNSADYKQRQLLEAWKILDNYRLCSDSMNIVDIS
FT                   KGYLENQFMDYVDNLYTKNGNEGLPTNINKIKSFIDCKLKNPNNTWKFGNLTIVNGVPV
FT                   WALIFYLLRAGKFQEALEVAINNKLSLKKVEQSFLVYFKAYVSSKDKRLPQEFITRLHT
FT                   EYNQHIKNSLDGDPFRLAVYKIIGRCDLTRKNISAITLSVEDWLWVHFMLIKDGISSDD
FT                   PVYERYSLVDFQNIITSYGSSSFNNHYLQVLLLSGQYELAVQYAYTINEIDAVHLAIAL
FT                   ADYKLLKVAANVTDDEFVTSPTGERKINFAKILGNYTKSFKFSDPRIAVEYLLLIALAH
FT                   EDSQIELAHEALRELVLDTKEFTILLGKINRDGTRIPGIIEERQPLLYLADKEDFLHKI
FT                   TEQAARRADENGRVYDSLLLYQLAEEYDIVISIVNKLLSEMLSNTDLAQPLMRQDDNSE
FT                   TNPVLIAKKLIDVYIKNLEISKKVHRKNKETCILLLKLVDIRRTYIARQWQNTLQQIEE
FT                   LDLLPSVEDSSPRKKAQEFHNLDDCIIKNVPNLLIIAMTCVSNLIKQLSKGPFSNGATQ
FT                   AQVEALKKVANNYMIYRGMIQYKMPREVYNTLINIEVDL"
FT   CDS_pept        complement(1046672..1047127)
FT                   /codon_start=1
FT                   /gene_family="HOG000066133" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622775"
FT                   /gene_name="YPI1"
FT                   /locus_tag="AGR005C"
FT                   /product="Type 1 phosphatases regulator YPI1 "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54494.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG059881"
FT                   /db_xref="HOGENOM:HBG395575"
FT                   /db_xref="InterPro:IPR011107"
FT                   /db_xref="UniParc:UPI0000253463"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750F0"
FT                   /transl_table=1
FT                   /translation="MSSNNQESLANRSHTVTVSETSQILQLRANQTEQVPKLAKKEQKS
FT                   KVRWDENVVDNEHMNKKKTKICCIFHPQQNFDDEDGGECEHASSSASSSSSSESENDTS
FT                   MDFEARRQARIARRRQKLERKRSSSPNAYEYQPDYSQYRQKYLHGDK"
FT   CDS_pept        1047366..1048301
FT                   /codon_start=1
FT                   /gene_family="HOG000183690" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775324"
FT                   /gene_name="RPN11"
FT                   /locus_tag="AGR006W"
FT                   /product="26S proteasome regulatory subunit RPN11 "
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="AAS54495.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="HOGENOM:HBG346862"
FT                   /db_xref="HOGENOM:HBG499867"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI0000253464"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750E9"
FT                   /transl_table=1
FT                   /translation="MDRLQRLMMSQRSNMIGAAATEMPLDDTKETVYISSLALLKMLKH
FT                   SRAGVPMEVMGLMLGDFVDEYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTG
FT                   RDQMVVGWYHSHPGFGCWLSSVDVDTQRSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRL
FT                   ISPATVVRNQEPRQTTSNVGLLNKPNIQSLIHGLNRHYYSLNIDYHKTSAELNMLMNLH
FT                   KEQWQSGLKMHDYKEKERINLEATKKSVRIAEQYTKRIEEEKELTEDELKTRYVGKQDP
FT                   KKHLSETAERVLEENIVSVLTAGVNSVAIK"
FT   CDS_pept        complement(1048359..1049855)
FT                   /codon_start=1
FT                   /gene_family="HOG000188754" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622776"
FT                   /locus_tag="AGOS_AGR007C"
FT                   /product="AGR007Cp"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAS54496.2"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG021848"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001DB2C67"
FT                   /db_xref="UniProtKB/TrEMBL:Q750E8"
FT                   /transl_table=1
FT                   /translation="MLDGRVPDSKNSSFKAFYKIYATETTRVGERMPGKREVEESDSED
FT                   LYREEGNKRLHISSSDERGLLQTIEKKRLDFYSEKVCSVTLSTIDVYSCLTCGKYLQGR
FT                   NEGSPAFKHSIEDLHRLFMHMRTFKTYILPENRPFRNAEVLDQIRYGFKPTYGRLQVAD
FT                   FPQDCEDLNGQPYLNGFVGLHNISNNGSSNVILLMLAHIKPVRDLFLLNDDLLERADPF
FT                   INKLALLIRHIWSPNLFRRHVSPHEFLQYVATHLAQPSSMKAYSDPRNFMLFVINRMLK
FT                   SSCGEVRKTLTDNIQGTVTIRTTKIVPVPNDDGSAIKFVLDTRTAKSTDVMFWMLSLDL
FT                   PPRPLFKDGKSANSLPQVKLEELMGKFDGTVEQHLKESVKLNKVSRCPRYLVLHLKRFE
FT                   PGKFPVQERNQTVVEFGQELEFRSVKFRLLMNVVHEATKPAKNQEVPILDEISNWKIQI
FT                   RNDKDDTWFELDEGNVRKREKELLFLNETYLQVWERVAAA"
FT   CDS_pept        1049997..1051541
FT                   /codon_start=1
FT                   /gene_family="HOG000008763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775325"
FT                   /locus_tag="AGR008W"
FT                   /orf_name="AGOS_AGR008W"
FT                   /product="AGR008Wp"
FT                   /function="aminopeptidase activity"
FT                   /function="manganese ion binding"
FT                   /biological_process="cellular process"
FT                   /protein_id="AAS54497.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="HOGENOM:HBG445006"
FT                   /db_xref="HOGENOM:HBG545079"
FT                   /db_xref="HSSP:1A16"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="UniParc:UPI0000253466"
FT                   /db_xref="UniProtKB/TrEMBL:Q750E7"
FT                   /transl_table=1
FT                   /translation="MDLQNAALVTASSVLMFTALKQLLRTGELKGGAAVHKSTLTSVTS
FT                   MMENQKYPAKRHNLNVKKCLLEKNPQLKATNTAIFISGAKLEGIKYCDQNKAFRQNRYF
FT                   YYLSGCNIPASSLLFNFNTEELTLFLPDVDKENIMWSGLPLSIDEAYERYDVDSVAYAS
FT                   SIQKNLVGLDDFQLLTIDLDDVPSNIQPLLKIGGDDLFYALDECRMIKDEYELAMLRKA
FT                   CAITDKCHLSVMSAIPIEHNEGHMHAEFTYHAMRQGSKFQGYDPICCSGPNCGTLHYVK
FT                   NDDGMEGKHSVLLDAGAEWENYTADVTRCFPINGTWTKEHREIYETVLDMQTQVMNRIK
FT                   PGVSWDELHVLAHRVLIAHFLKLGIFKSEYTAEELLSSRASVAFFPHGLGHLLGMDTHD
FT                   VGGNPNYDDPDPMMKYLRLRRPLKAGMVVTNEPGCYFNQFLIEEFLEKHPDKLKLVNRD
FT                   VMSKYFYIGGVRIEDDVLVTETGYENLTKVTSDPNEIEKIVSAAIKKGRSHFHALA"
FT   tRNA            join(complement(1051799..1051835),
FT                   complement(1051747..1051782))
FT                   /gene_name="tRNA-Phe"
FT   tRNA            join(1052123..1052160,1052191..1052234)
FT                   /gene_name="tRNA-Leu"
FT   CDS_pept        complement(1052357..1053472)
FT                   /codon_start=1
FT                   /gene_family="HOG000000936" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751277"
FT                   /locus_tag="AGOS_AGR009C"
FT                   /product="AGR009Cp"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS54498.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG124479"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001DB2C68"
FT                   /db_xref="UniProtKB/TrEMBL:Q750E6"
FT                   /transl_table=1
FT                   /translation="MPDPRIRKARHELTPDNLSSSLLISNLPSSWTQSTVTSVIAGSGP
FT                   IVKVSEKKDPRNGRLIGIVIDYLTSKDCKRAAEVIQKIKNFTCKLERIIPPNWSSRTEV
FT                   SDRDVLDLKRDQYPWDDNLELPFELVSEVPIPRKPVSKPATGVNTNGSGTSPFPEILSK
FT                   ASQHLPPLHPGSLVATEPISANLTNIPPLQLLEMISNLKMLSNQDPAKIAKLEQFLRNN
FT                   SVVTMVTVAQALLEMGFINYEVVTKVISEYQPLQTQNTMRQPVPPVNFAQPPAMPHMST
FT                   MLNMMHPQMMATPHQASQVPTTGPFIIGQAPPPMTQQSQPMRLNETKLNALPRAKQDMI
FT                   RQVINLPQEQIRLLPPEQVTVIENLRQEYLI"
FT   CDS_pept        complement(1053756..1054556)
FT                   /codon_start=1
FT                   /gene_family="HOG000247912" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079582"
FT                   /locus_tag="AGR010C"
FT                   /orf_name="AGOS_AGR010C"
FT                   /product="AGR010Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS54499.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG395454"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000253468"
FT                   /db_xref="UniProtKB/TrEMBL:Q750E5"
FT                   /transl_table=1
FT                   /translation="MNKSGNGRPSRTVYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFD
FT                   PQTGKSKGYAFIEFKDLATSSSAVRNLNGYALGNRTLKCGYTTGGGISEEYSLSNRGEL
FT                   SQVGGMGPQEELAYPNLPEGADVNINMTTPAMVISSELSKLSKPEQFNLLEKLQEMSRN
FT                   DREAFVALLKQCPQISFVVAELLLTNGISQIDDLTQLAVDQTNGSAASKDSTPQVGEDD
FT                   MQKLELLKQVLQLTDAEIATLPEDERMSLWDLKQRAMKGEFGPI"
FT   CDS_pept        1054753..1055667
FT                   /codon_start=1
FT                   /gene_family="HOG000195015" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751278"
FT                   /locus_tag="AGOS_AGR011W"
FT                   /product="AGR011Wp"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="transcription elongation regulator activity "
FT                   /function="translation elongation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription elongation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54500.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003711"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006354"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG131880"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR006289"
FT                   /db_xref="InterPro:IPR016492"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI0001DB2C69"
FT                   /db_xref="UniProtKB/TrEMBL:Q750E4"
FT                   /transl_table=1
FT                   /translation="MDAKDVVTHVKNLEKNKSDEQTVLRILRILDKELVATEKLLRETK
FT                   VGVIVNQFKKSSNDEIAKLVKKMIGTWKDAITKEKKKKAAVAAGGSGSGAGTAGGGAHS
FT                   SHSGNSGPHEPKIQEKYHAKGPRSAKNDGVNTTIYGDKLRDMVIRAFYDALAKESEHPP
FT                   QSILAIAIDIEKHMWQLNDPGENEKAYKDKYRVIYSNVISKNNRDLKHKITNGDITPEY
FT                   LVNCDPKELAPEHLRKKLEEIAKQNLFNAQGATLERSVTDRFQCGKCKEKKVSYYQLQT
FT                   RSADEPLTTFCTCEVCGNRWKFS"
FT   CDS_pept        complement(1056080..1057558)
FT                   /codon_start=1
FT                   /gene_family="HOG000217392" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751279"
FT                   /locus_tag="AGOS_AGR012C"
FT                   /product="AGR012Cp"
FT                   /function="cystathionine beta-synthase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /biological_process="cysteine biosynthetic process via
FT                   cystathionine"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54501.2"
FT                   /db_xref="GO:0004122"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0019343"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG370933"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005857"
FT                   /db_xref="UniParc:UPI0001DB2C6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q750E3"
FT                   /transl_table=1
FT                   /translation="MYDNRHHVIDLVGNTPLVELSKLPKALGIKPQVYAKLELYNPGGS
FT                   IKDRIAKTMIERAEESGIIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSN
FT                   EKVSVLKALGAEIIRTPTAAAWDSPESHIGVARKLEKEIPGAIILDQYNNEMNPYAHYF
FT                   GTGREIHHQLRNLGKFDQLHGLVAGAGTGGTISGTAKYLKEQKPDVKVVGADPMGSILA
FT                   QPASLNDTDISEYKVEGIGYDFIPEVLDRSLVDQWIKTEDKASFKYARQLISNEGTLVG
FT                   GSSGSAFAALVEYCNAHPELTEDDVLVVIFPDSIRSYLTKFVDNEWLKSNNLWDDEIVA
FT                   PLAKNEEDAFNGATVKDLQLRPVVAVSETAAVSEVVKILKDNGFDQLPVLAENSKKLVG
FT                   LVTLSQLLKKLSSGAEVSSIKSLFLDFRKLNNFDDISSYNDNKTGKKKFVTFTVDSKLS
FT                   ELNRFFEKNSSAIITDGFTPVHVVTKVDLLSYLA"
FT   CDS_pept        complement(1057838..1058752)
FT                   /codon_start=1
FT                   /gene_family="HOG000139266" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775326"
FT                   /locus_tag="AGOS_AGR013C"
FT                   /product="AGR013Cp"
FT                   /protein_id="AAS54502.2"
FT                   /db_xref="HOGENOM:HBG008719"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniParc:UPI0001DB2C6B"
FT                   /db_xref="UniProtKB/TrEMBL:Q750E2"
FT                   /transl_table=1
FT                   /translation="MAVGEHTFVSQRAEPRYHGNPKPMPAYYPTSKDSALVPDFGFYDS
FT                   IRGAPRRVVKTYEVPVRAGQAWKAPRGSVVRVSTPYGPQVLDFNCWEANSSFKEHLWAA
FT                   RTRQLQSSHVSTYDRLWSNLPYLRPLLTIIDDSLADYGPDEHGGRVHDLLGTRCDPYVD
FT                   KLLSGEDNDFHCHSNLYRAIRPFGGGEHHVHDVLNLFQVTGLNEHGQYFMEASPAKPGD
FT                   YIEFFAEVDLLCAISTCPGGDLSMWGWGEGAVGANEKNVTDMSSVCRPVRVEVFELDDP
FT                   ETVLRGWSSPQPVRYGGNHGIEN"
FT   CDS_pept        1059161..1059820
FT                   /codon_start=1
FT                   /gene_family="HOG000208642" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079583"
FT                   /locus_tag="AGR014W"
FT                   /orf_name="AGOS_AGR014W"
FT                   /product="AGR014Wp"
FT                   /biological_process="protein transport"
FT                   /protein_id="AAS54503.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG371348"
FT                   /db_xref="HOGENOM:HBG592869"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI000025346C"
FT                   /db_xref="UniProtKB/TrEMBL:Q750E1"
FT                   /transl_table=1
FT                   /translation="MGQGGSKIKVTATDKAILQLKLAKDNLHRHAKRTDTLIENERSEL
FT                   RELAKSLKGEIKQSRRARLLLKRIHYQQRLLDQCSDQLINLENMVMTIEFKLVEKQFVE
FT                   GLARGNEVLKKLNREFSGVEQLMDDVAEQVAYQEEIDQLLSNGPMSAGYGLQDELDREL
FT                   EQLEQEVNAQEALPELPSTNGLAPPKTRKSANKEDEPAGQPAAAPQREVEKPMLAS"
FT   CDS_pept        complement(1059920..1060942)
FT                   /codon_start=1
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751280"
FT                   /gene_name="HEM2"
FT                   /locus_tag="AGR015C"
FT                   /product="Delta-aminolevulinic acid dehydratase "
FT                   /EC_number="4.2.1.24"
FT                   /function="lead ion binding"
FT                   /function="porphobilinogen synthase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="heme biosynthetic process "
FT                   /protein_id="AAS54504.1"
FT                   /db_xref="GO:0004655"
FT                   /db_xref="GO:0006783"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0032791"
FT                   /db_xref="HOGENOM:HBG012673"
FT                   /db_xref="HOGENOM:HBG285270"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000025346D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750E0"
FT                   /transl_table=1
FT                   /translation="MKHTAEFLDTHQTQISSILSGGYNHPLLREWQNERQLAKNMFIFP
FT                   LFVSDMPDEDQPIESLPNIRRFGVNKLAGYLKPLVAKGLRAVLLFGVPMKPNSKDEFGS
FT                   AADDPEGPVIQAIKLLRAEFPELYILCDVCLCEYTSHGHCGVLYDDGSINREQSVRRLA
FT                   AVAVNYAKAGAHSVAPSDMIDGRIRDIKLGLLAAGLAHKTFVMSYAAKFSGNLYGPFRD
FT                   AACSAPSQGDRKCYQLPSGGRGLARRALRRDLDEGADGIIVKPSTFYLDIMADASEIAK
FT                   DVPICAYHVSGEYAMLHAAAKAGVVDFKSIAFESHQGFLRAGARLIISYMTPEFLDWLS
FT                   "
FT   CDS_pept        1061381..1062097
FT                   /codon_start=1
FT                   /gene_family="HOG000208631" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928322"
FT                   /locus_tag="AGR016W"
FT                   /orf_name="AGOS_AGR016W"
FT                   /product="AGR016Wp"
FT                   /protein_id="AAS54505.1"
FT                   /db_xref="HOGENOM:HBG051803"
FT                   /db_xref="HOGENOM:HBG618397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="UniParc:UPI000025346E"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D9"
FT                   /transl_table=1
FT                   /translation="MAHHHHSCEAEHHDHVPPARTSAQQSLYQWIDVPSMRCLNVVAKG
FT                   AAASVPAGIIKSNDERYDISRYVESDADCQMLLHIPFTTSCRLYSIILRSAKGGEAGIG
FT                   CMRHVKIYSNLNQNLDFDTVSELKPSNVLEYPQNVGVYLGGSQAEERGEHSFVEHHLPR
FT                   HQFQNCHSLTIFVEDTWSGDEDEPTQLCYLELRGESTGLKPESGAALLRTVYEAAPNPA
FT                   EHVKLESEHERLHLGM"
FT   CDS_pept        join(1062566..1062721,1062785..1063387)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751281"
FT                   /locus_tag="AGR017W"
FT                   /orf_name="AGOS_AGR017W"
FT                   /product="AGR017Wp"
FT                   /protein_id="AAS54506.1"
FT                   /db_xref="HOGENOM:HBG059883"
FT                   /db_xref="UniParc:UPI000025346F"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D8"
FT                   /transl_table=1
FT                   /translation="MNYKFNTVYLAGNDELSASRWDCEVVLSTEQESELDLNKGIFVLP
FT                   PSHSPLEVVVRLGRDHDADVWPPTSPVVPNNEFWEKALNYTVQYVSDDSKLELFLTCNQ
FT                   FIPLKVEKLFAKPANLVYAKEYRLAYLTRLIINCEFYGVSDTQEGTVLDHLNEFVTSLI
FT                   LSQLEFQFPFVFSRRGRRKFLEHEQSMGSLSYSLTGNNSLIPSVIEVMANDLTSTTVFE
FT                   LLEVCRNYKLRAKYKDSKSELKSSKPFKRS"
FT   CDS_pept        complement(1063374..1063949)
FT                   /codon_start=1
FT                   /gene_family="HOG000000950" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622777"
FT                   /locus_tag="AGR018C"
FT                   /orf_name="AGOS_AGR018C"
FT                   /product="AGR018Cp"
FT                   /protein_id="AAS54507.1"
FT                   /db_xref="HOGENOM:HBG059884"
FT                   /db_xref="HOGENOM:HBG204337"
FT                   /db_xref="InterPro:IPR016564"
FT                   /db_xref="UniParc:UPI0000253470"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D7"
FT                   /transl_table=1
FT                   /translation="MSRLRKLNRELINYTQGTADSIEDRDDFFPLDTDEQEELIRKFEL
FT                   RNASKNEKYLQYLGFVYLACCGLMLVLATSAKRVKPLAPYRRILLVSVQSIGCSFVNMQ
FT                   YSTITHMFRNRFLPFRISSQAINIINIVVLILISWQVSETAKSPALLLFLHVPHWLFLV
FT                   SILVKRWSEEIDSELNTLRSLTYKFKSA"
FT   CDS_pept        complement(1064797..1068114)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751282"
FT                   /locus_tag="AGR019C"
FT                   /orf_name="AGOS_AGR019C"
FT                   /product="AGR019Cp"
FT                   /protein_id="AAS54508.1"
FT                   /db_xref="HOGENOM:HBG059885"
FT                   /db_xref="UniParc:UPI0000253471"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D6"
FT                   /transl_table=1
FT                   /translation="MRVVTLAGLSVLLSASPALADAYAAAAPPADIVDYGRHQPMVRRS
FT                   DNETVQASPTALGVLPSLLASIANEIESRLDPINKKTTSSTTLSVATNTKSSSSRSSAT
FT                   GKLHGSSKSSETAASSDTADSASTSAPLTSSNTRSTESTESSAVTSSTAKKGTKTPTKG
FT                   LSESSSTKTIDSETIKPLSEPTLSSGHSHSRKTLSIPTSYLTNTEAKPTPSAETSEEMS
FT                   STTDKSKHKTKKEKHKSTTTSGTDAISSSETDLSSTITDGLSTLTTPTSDSMSQLSATS
FT                   SIDSSLSGSQIPSATSSLSSTGKATNSAISASLSSGTSSTSSGSHLPSGSPTDSSVSGI
FT                   PTSGLTSSSAQSSGSGIPTSGLTSSSAQSSASGIPTSGLTSSSAQSSGSGIPTSGLTSS
FT                   SAQSSGSGIPTSGLTSSSAESSSSGIPTSGLTSSSTQSSGSGIPTSSLSSSSTQSSGSG
FT                   IPTSSLSSSSESAVSGSLISSAYSSLSSISSDNISISSTDSAGSSHLSHALPTSSSVII
FT                   PISSTPIPQELTMTGNSSLSTVRSGTEISTISTSAVTSVSSTKSETTTSVPLSTSRSAN
FT                   HSAVITPSSSPLTILPSSSSTTVVSTSEGHKISSTFNGSISSHTLASHSTFSLTSSSVS
FT                   MSSFVTSSSQVPEEVTPTPQSTETEYPQSTRPSNTSTLYSSSRETYPYTTTLSYIPSTT
FT                   SADKTSEESYSAPEVTTLAPLSDSTQSSQASTTLSSQDSTTLTTSSTSTRPTTWGKNAP
FT                   SGNWLPTVIITATEQEVVSTESPQNTQSKPKPTATPNIQTLPQVIAAPDRVTPKKDYTL
FT                   ITIGFKKQLNYPFIAMNPFANAQIFDYLPGILNYPFNFEYADISVIQLVPLKANSKDYI
FT                   ATIAQVYFPSEKVDELAKLVVDTNSELYSSYDANMKVFASLIDPQLPLTGLAGKGFSSS
FT                   GSTTQNKPHPDADNSIGRSGALGGPYNPTNSKSAAVPMSKAKLTGIVVGSICGVTLYIA
FT                   LMIVGVRYFLLRSRGGVELQDNHSFYSSNSGGSSDMITSSEIPPTLYDDKSLFVTANNA
FT                   RMMRASVTPSMKVDNWMDYNNSVNGLGDNNATHSFVNGKITKISGPIASENSLGWDP"
FT   CDS_pept        complement(1068974..1070734)
FT                   /codon_start=1
FT                   /gene_family="HOG000154360" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622778"
FT                   /gene_name="SNU71"
FT                   /locus_tag="AGR020C"
FT                   /product="U1 small nuclear ribonucleoprotein component
FT                   SNU71"
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS54509.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG124636"
FT                   /db_xref="HOGENOM:HBG204334"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="UniParc:UPI0001DB2C6C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750D5"
FT                   /transl_table=1
FT                   /translation="MGDIVFVSAALYLANSPNWKSKVLKPGFSPIPSNELYNFEQTLKS
FT                   TSQEPVSSTAVSKAPEKSALDAEDGGLRLDYKGPKYQELRLFLPISLTQQLHTLVIQNI
FT                   PESATKTADFIQWLEQATTKHFSTKTDGTKVEDLVENWSSVIASTLESTQDIFIRMYPL
FT                   TEFAQVVLYWIEWFSKATDSVTTVHIDENTARYIDDIVPSSYTPDVTEEELVALRTQIA
FT                   DLKSSVSESSTENAAMVAYEVDMSTLSDLPKSSLNQLVKDIIEFRTRVLTMEREKRTQE
FT                   ALEEGRRRRSQLKRVMEQIRKSKGSSVPATEPEEDEDEYEDEDGEEDWAIERRRLEKEK
FT                   ESAQQSYNALLSHLNGTVMPDLRARKQRLILLKDYEAKLQRERAFFLKELLHLGNSDYY
FT                   DHRREFKEEEEQQDDVDRRAQNEQRIQAPKDAVLQASASASRSPDTSAAHSAPVQEPVA
FT                   KEQKIKLALKRVFDTRAQEAESDSEPEADIPATAVSASTPAPTADLPDRLPFQGPELAA
FT                   RMAELRQSRLVDELVNEYLGVYEDELVDYILDNIVENASRGQLLLELQETFDDDSVRIV
FT                   DAIWAKLLKH"
FT   CDS_pept        complement(1070910..1072073)
FT                   /codon_start=1
FT                   /gene_family="HOG000217393" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079584"
FT                   /locus_tag="AGR021C"
FT                   /orf_name="AGOS_AGR021C"
FT                   /product="AGR021Cp"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /protein_id="AAS54510.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG370933"
FT                   /db_xref="HOGENOM:HBG748215"
FT                   /db_xref="HSSP:1O58"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI0000253473"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D4"
FT                   /transl_table=1
FT                   /translation="MSNQQGLDWRTAITGVSVIVSVASLFYAYKTSSRLTDLAPPKNGV
FT                   EELIGNTPMVLLPSLSKFTGCKIYAKLELANPAGSAKDRVALNIVRTAETQGLLTRGHR
FT                   DVVFEGTSGSTGISIATICNALGYQSHISLPDDTSPEKLALLECLGAHVKKVKPASIVD
FT                   PDQYVNAAKKACKLLNEEGHGNKGIFADQFENEANWTIHYQNTGPEIYQQLGGRINAFI
FT                   AGCGTGGTIGGVSRYLKERLGDSVHTILADPQGSGFYNRINYGVMYDHVEKEGSRRRHQ
FT                   VDTIVEGIGLNRITRNFKCCEEYIDSSIRVTDEQAIKMAKYLCVNDGLFIGSSTAVNAV
FT                   AAVRVAQEMPAGSTLVLIACDSGSRHLSKFWKEASAVRNDIQLCDIV"
FT   CDS_pept        complement(1072437..1073639)
FT                   /codon_start=1
FT                   /gene_family="HOG000216047" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928323"
FT                   /locus_tag="AGOS_AGR022C"
FT                   /product="AGR022Cp"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="NAD biosynthetic process"
FT                   /protein_id="AAS54511.2"
FT                   /db_xref="GO:0009435"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG405239"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001DB2C6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D3"
FT                   /transl_table=1
FT                   /translation="MDPTRAPDFKPLQGDDKPEPPLAPDSEIPENGPIMPFVLADYNTS
FT                   IDAPIHPKSYKKSMKRNSSQPSNCSKGRGGSGSIPLKRSGLEPFSNDVSSESECGEEDE
FT                   QQGESHAADANSSKLRSMVQNIADLEEVPCGIIRQARILEDYEFPTHRLKTTLHNANKL
FT                   PLVIVACGSFSPITHLHLRMFEMAMDAIVEQTRFEVVGGYYSPVSDNYNKPGLASATHR
FT                   VRMCELACERTSSWLMVDAWESLQPQYTRTAKVLDHFNDEINVKRGGIKTSTGDRIGVK
FT                   IMLLAGGDLIESMGEPNVWADADLHHILGNYGCLIVERTGSDVRSFLLSHDIMYEHRRN
FT                   ILVIKQMIYNDISSTKVRLFIRRGMSVQYLLPNSVIRYIQEYGLYVNEHEPVQQVISNK
FT                   D"
FT   CDS_pept        complement(1074114..1076456)
FT                   /codon_start=1
FT                   /gene_family="HOG000162311" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775327"
FT                   /locus_tag="AGR023C"
FT                   /orf_name="AGOS_AGR023C"
FT                   /product="AGR023Cp"
FT                   /function="cysteine-type peptidase activity"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAS54512.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG371766"
FT                   /db_xref="HOGENOM:HBG746888"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016652"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI0000253475"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D2"
FT                   /transl_table=1
FT                   /translation="MCEVVKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNI
FT                   CLGCFQSFCHEHVNLHQQVVRRVQQATHDLYLNVYKIERPKATESAEKRLKLEVQDLSE
FT                   EELYETVWSLVRINNACTARLGSSKQKQKMDTTVVSKLEQIIRTRSSDFKDMAATWQLE
FT                   IKACPHSEQFVVPQDAMPVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKH
FT                   YQQSENNHPLAVKLGSLTSESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKE
FT                   KTLVELQVEQNMNWDFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGG
FT                   VKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNE
FT                   EFSSGRQQDAMEFLTYFIDKLDRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSSQ
FT                   VCEILQIPLLDSNDPQFLMDRLHSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLI
FT                   NPIRIKLQNWTPIKTSNQLFVPGLRDEKRLKLSQFKAHGRQPGEKIFEDSPDDNSNVPA
FT                   SAISFNPDEDKVISIISMGFSKNAALRALYNTGSEVERALNWIFEHMEDPELNAEFSVP
FT                   GTKKQAAVVDQGALDSMVSMGLAERHCRKALILNDGDVTRSVEWVFNNADNLDDDDTQE
FT                   SIDPPVSRDYGYPGDIPDYALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKL
FT                   MAVGGNENLQEIEKNGYIFIFNRIAPA"
FT   CDS_pept        complement(1076692..1078125)
FT                   /codon_start=1
FT                   /gene_family="HOG000217005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751283"
FT                   /locus_tag="AGR024C"
FT                   /orf_name="AGOS_AGR024C"
FT                   /product="AGR024Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS54513.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG383328"
FT                   /db_xref="HOGENOM:HBG748731"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="UniParc:UPI0000253476"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D1"
FT                   /transl_table=1
FT                   /translation="MIRSTVRGMVQRRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEI
FT                   CHSILPVMQEYAKSDVANVIVFDSACAPRAFCAGGDIVLMAKAMRRDMLEKVDDFFQGE
FT                   YTMNWMLATYPKPVVALMDGITMGGGVGLTIHVPFRVATENTKWAMPELDIGLHPDVGV
FT                   SFALPRIMTLGGQEGQLGYYLCLTGEVLQGADVYMAGLASHYVESTQHGALKERLGTVP
FT                   ITRKADETFANTNAVIEEFSSPLPDGYQFKYNKEELDVIERFFHYDVSYKELRKNLEAF
FT                   ASSNANSEVARNFAKATLEKLSTKSTVSAEITREQFRRNSQRDIQSAMKQDLITSTNLL
FT                   RNNELAEFENAVIHKLVEKAKTPYEWKNTSPSVADISKLLAADPANPIDLLETFGVTFK
FT                   NYRYHNKFTLPTEAAVQAYITGTDQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVN
FT                   LIIDRKCRMDNDSFLHWNY"
FT   CDS_pept        1078662..1079798
FT                   /codon_start=1
FT                   /gene_family="HOG000188299" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751284"
FT                   /locus_tag="AGOS_AGR025W"
FT                   /product="AGR025Wp"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54514.2"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG196464"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR013866"
FT                   /db_xref="UniParc:UPI0001DB2AAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D0"
FT                   /transl_table=1
FT                   /translation="MNQRGIATAVTAEPPSADADVEVLHNFYWTSLKEPHAHRRKEILR
FT                   AHPEVKKLMGHEPRTKYLVALVVGLQLLSAYMLRDTDPLSLKFLAWAYVVGATATQNLY
FT                   LAIHELSHNLAFKKPKHNRLFSIFANLPIGIPFAASFGPYHQLHHKFLGDEVYDTDVPT
FT                   VLEAVLLSNVLGKTFFATFQIFFYALRPMMVVRIPITGFHVLNVVCQFVFDVIWIRQFG
FT                   LNGFFYFLLSSFLAGSLHPCSGHFIAEHYLFSIEEAIVGGKVAMKSAAGEAEPVYVTDE
FT                   SAVKRPDVEFRKDYALETYSYYGILNAVTWNVGLHNEHHDFPFIAWSKLWELNRMCPEF
FT                   YETLPKHDSWVRVLWDFIFKYDVTLYNRVRRVNKHLES"
FT   CDS_pept        complement(1079889..1080212)
FT                   /codon_start=1
FT                   /gene_family="HOG000000721" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622779"
FT                   /gene_name="TSC3"
FT                   /locus_tag="AGR026C"
FT                   /product="Serine palmitoyltransferase-regulating protein
FT                   TSC3"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54515.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059886"
FT                   /db_xref="UniParc:UPI0000253478"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750C9"
FT                   /transl_table=1
FT                   /translation="MMAADDTMSSKRADNCYKKDRGTMVYTPTDAQQATGKVHEKVYKF
FT                   FESLYWMYYIHLPYYLMTSFDSFCLHVFFLVVFTLSLFGLLKWVLSLYWATVGYMAYAA
FT                   TGQ"
FT   CDS_pept        complement(1080453..1083338)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622780"
FT                   /locus_tag="AGR027C"
FT                   /orf_name="AGOS_AGR027C"
FT                   /product="AGR027Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS54516.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG059887"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000186176"
FT                   /db_xref="UniProtKB/TrEMBL:Q750C8"
FT                   /transl_table=1
FT                   /translation="MSKRHTGEQSSPTEPVPGTGALTGPLEMLQAGSTVLVGVHQVEVI
FT                   EYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVM
FT                   KKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVL
FT                   KIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEI
FT                   AMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFA
FT                   ILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMECEVKIDDLYGQG
FT                   PYNFDMYGRYQEKLQRLQYDMLMSHQLAQRGIINTDKVNDLFISTFECAPKQPMVMGQN
FT                   AVAQQQIFVAPPSTNTSMPVDMQQSLPKPLDHNGPNAHGGLDSLQKLPKSADVGNYPVA
FT                   ETHMHMYADAQKNYIQVPRKEVMMQHTDRSVLSDHSGNGTSTPSLPGSCPVQHEQLANT
FT                   PKSKQYKKNNPFPKMAKQDFVHDTYDESDEHSPGDDPAPASKPVDSMIPSVPATVTPMV
FT                   SVQRDRSFQHIQPGQIPENVRECEPESEVEMDLSHKIQNCNLDQQQSLQAQDLKLQQIL
FT                   LHQQQLQHRQYQQQNDNRQQHAQRLHDQMPHQQRQQLPLQMHLRPQHPCSNNVPLHKTL
FT                   AEQAYQLSDSTQPQPQPQYQAYYVDRKTAVPFQTYSNAYTQNQHVFPQQSSRGTYGTSD
FT                   RIQNGSNQLIEFSSPDKSANDAQLDLTYNQINLSKPNSVGGGDPSENASVELNGSGSSV
FT                   LTNESIAMELPNAEERPVPPSTSGATQPAENIHSRQESDSYHDREDSRHVTGHVPRRSL
FT                   ELDFQEIDLSSSPTPVSASKTSSKAHLQPNRSGTANCGTSNSSSVVSGVRKSFHRGRKS
FT                   VDLDVSKKESKEEPTNSGSGKRRSIFGVFKS"
FT   CDS_pept        complement(1083624..1085363)
FT                   /codon_start=1
FT                   /gene_family="HOG000115289" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751285"
FT                   /locus_tag="AGOS_AGR028C"
FT                   /product="AGR028Cp"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="origin recognition complex "
FT                   /protein_id="AAS54517.2"
FT                   /db_xref="GO:0000808"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG059888"
FT                   /db_xref="InterPro:IPR007220"
FT                   /db_xref="UniParc:UPI0001DB2AAC"
FT                   /db_xref="UniProtKB/TrEMBL:Q750C7"
FT                   /transl_table=1
FT                   /translation="MRAREIFSARRGPAWSGAEPRMDGQDAEAGAPADIVAHADLGVAP
FT                   AGAGAPSSKFLRFYRAATARSRRASGRRGRASPRRGGAADSSVDEGATAVPSSRDAAEE
FT                   ESPRRKQPVRVPQTPAKLAAPALEADDSDGFVTARSTPLRSPRRQLTFSSPSKSPRKTR
FT                   KQDVLLAQVPSFKLDPGFVPAAVPKGYRLPEDRNLTYFFDGFEGYIDQKKPIRAHKKSR
FT                   NSMAIAPSVSRDEFRLLSGALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGI
FT                   GSKRRFLETLVFEYLSPKLALSGAPEGADVEGVPCVVINGFNPACNYRDCFQSIAAYML
FT                   PDELRHAETKYWHNHVHLQIQKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPFQQMLSS
FT                   LARIRQIAIVASVDHIHAPLLWDSLRAQLYNFVFHDVTNYEPYAIEAAFQESVRLNRSE
FT                   LQAGSIDAARYVLASLTANSKRLFRLLLETVVANMQSAKRIKLTNSRRAGISFGVPFSA
FT                   FYQACAAQFVASNEMSLRSMLREFVEHKMAHLAKDKAGQEIVYVNYSFGEMQKLLSDAL
FT                   SSV"
FT   CDS_pept        1085384..1085722
FT                   /codon_start=1
FT                   /gene_family="HOG000228131" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079585"
FT                   /locus_tag="AGR029W"
FT                   /orf_name="AGOS_AGR029W"
FT                   /product="AGR029Wp"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54518.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG067622"
FT                   /db_xref="HOGENOM:HBG717463"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="UniParc:UPI000025347A"
FT                   /db_xref="UniProtKB/TrEMBL:Q750C6"
FT                   /transl_table=1
FT                   /translation="MLSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRN
FT                   LPRKEVDDVLGGEGAWDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVT
FT                   CGHKWREN"
FT   CDS_pept        complement(1085753..1086727)
FT                   /codon_start=1
FT                   /gene_family="HOG000262768" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751286"
FT                   /locus_tag="AGR030C"
FT                   /orf_name="AGOS_AGR030C"
FT                   /product="AGR030Cp"
FT                   /function="coproporphyrinogen oxidase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="AAS54519.1"
FT                   /db_xref="GO:0004109"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG000861"
FT                   /db_xref="HOGENOM:HBG631180"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="UniParc:UPI000025347B"
FT                   /db_xref="UniProtKB/TrEMBL:Q750C5"
FT                   /transl_table=1
FT                   /translation="MASAHTPHMRERMEELVRRKQREITAAFEAIDTVKFKADSWERKE
FT                   GGGGTSCVLQHGTTFEKAGVNVSVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAAGV
FT                   RFFACGISLVMHPVNPHAPTVHLNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDAR
FT                   LFHAAHKAALDRTDPALYPRFKKWCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRM
FT                   AEDCLDAFVPAYKTIMLRRKDMPYTAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGS
FT                   RVESILMSLPVTARWEYDHHPAEGTREAALLEVLRHPREWVGE"
FT   CDS_pept        1087070..1087492
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775328"
FT                   /locus_tag="AGR031W"
FT                   /orf_name="AGOS_AGR031W"
FT                   /product="AGR031Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54520.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059891"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000025347C"
FT                   /db_xref="UniProtKB/TrEMBL:Q750L1"
FT                   /transl_table=1
FT                   /translation="MDNARQAGAHQSIVLAAVAPPGAAGGRRVLLPPLASSHQSMRRLE
FT                   TYLKQALDRGAFGCAAAPARKRAPAPVPVEKRRKHLCQTCGKGFTTSGHLARHNRIHTG
FT                   EKNHACHFPGCGQRFSRHDNCLQHYRTHLKRTAVPS"
FT   ncRNA           1087651..1087696
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR47"
FT                   /product="AgSNR47"
FT   CDS_pept        1087803..1088798
FT                   /codon_start=1
FT                   /gene_family="HOG000154338" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079586"
FT                   /gene_name="SLT11"
FT                   /locus_tag="AGR032W"
FT                   /product="Pre-mRNA-splicing factor SLT11 "
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS54521.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG059892"
FT                   /db_xref="HOGENOM:HBG204140"
FT                   /db_xref="UniParc:UPI000025347D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750K9"
FT                   /transl_table=1
FT                   /translation="MDEETPSICEQCLTDADLRMTRAARGAECKICTLPFTLYHFKPPG
FT                   APRVTKTLVCRRCAAQRNVCQCCMLDLAWKLPVALRDELVSLVQGSDERTPEASNEMVR
FT                   RFLALRGGQLGGARLTADSAPLRELMGKMRAVAAAAAPAARAHGGREDAGEVPETQLPF
FT                   GGALATPASRSFFIYGVDPALPEWELVDAVSQLVRTPDWRDAGSVSVVVRQDARCAGIR
FT                   FRREELAQAFVARLETLPAAAGAPKGVLRIRHLRMHVVAWPEFHLAAFGETKQQTEGIA
FT                   RLATKTMRADAEGASPARPAAPASAAGKVAKKAAAPRRQGRRGPRPTLEL"
FT   CDS_pept        1088961..1089722
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751287"
FT                   /locus_tag="AGR033W"
FT                   /orf_name="AGOS_AGR033W"
FT                   /product="AGR033Wp"
FT                   /protein_id="AAS54522.1"
FT                   /db_xref="HOGENOM:HBG059893"
FT                   /db_xref="UniParc:UPI000025347E"
FT                   /db_xref="UniProtKB/TrEMBL:Q750C4"
FT                   /transl_table=1
FT                   /translation="MIEDIKLSVAWATFLSVFQKVARFFRQYHTERLRYNYALDPPQMV
FT                   YSLVPPHGSRHAPDVHYRAARNSNFMLEALQLFVLSVLVGTMMTLARCMHRAGSVLHRK
FT                   GFDLPLAALQPRAIGPKPPQRSTSRRAAARPDSAPCSTPQNTAASIADPAPAACERAGP
FT                   APASARAPAGCARAPASPNEGLFLSYVDDVDDELSGVENSFAEYYGVSQFAESDIFDLG
FT                   NLSVRLNSIRSLGINNSPTSKAVKASGMLIW"
FT   CDS_pept        1089915..1090394
FT                   /codon_start=1
FT                   /gene_family="HOG000214894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928324"
FT                   /locus_tag="AGR034W"
FT                   /orf_name="AGOS_AGR034W"
FT                   /product="AGR034Wp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54523.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059894"
FT                   /db_xref="HOGENOM:HBG398490"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000025347F"
FT                   /db_xref="UniProtKB/TrEMBL:Q750C3"
FT                   /transl_table=1
FT                   /translation="MPMCDRLRPRILTLTDDQGTRSELRRQLADMFQEADAHSTALLNV
FT                   IVRLMPEELQQHLQLIGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPL
FT                   VVELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVLVRKPEIDGSAAELEEDWGMYG"
FT   CDS_pept        complement(1090437..1091060)
FT                   /codon_start=1
FT                   /gene_family="HOG000217816" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775329"
FT                   /gene_name="RSM10"
FT                   /locus_tag="AGR035C"
FT                   /product="30S ribosomal protein S10, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAS54524.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG059895"
FT                   /db_xref="HOGENOM:HBG396854"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005731"
FT                   /db_xref="UniParc:UPI0000253480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750C2"
FT                   /transl_table=1
FT                   /translation="MLSVFGLRTVARCNSTLASGGARAAAAAGGKAGAQYSALPKSVHA
FT                   LYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPLPTRRER
FT                   WTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMKCNMFQ
FT                   RESVQLAQELADVPLAPGAPQTADEVVGAKVAELMQSPEFKKHL"
FT   mat_peptide     complement(1090440..1090988)
FT                   /gene_name="RSM10"
FT                   /locus_tag="AGR035C"
FT                   /product="30S ribosomal protein S10, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750C2 "
FT   transit_peptide complement(1090989..1091060)
FT                   /gene_name="RSM10"
FT                   /locus_tag="AGR035C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750C2 "
FT   CDS_pept        1091422..1092342
FT                   /codon_start=1
FT                   /gene_family="HOG000162368" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751288"
FT                   /locus_tag="AGR036W"
FT                   /orf_name="AGOS_AGR036W"
FT                   /product="AGR036Wp"
FT                   /function="nucleic acid binding"
FT                   /function="rRNA (uridine-2'-O-)-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54525.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008650"
FT                   /db_xref="HOGENOM:HBG266638"
FT                   /db_xref="HOGENOM:HBG398270"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniParc:UPI0000253481"
FT                   /db_xref="UniProtKB/TrEMBL:Q750C1"
FT                   /transl_table=1
FT                   /translation="MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGVQRV
FT                   VDLCAAPGSWSQVLSRELFPDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKI
FT                   IELFKGEKADFVCSDGAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRG
FT                   RDIDMLYSQLGLLFDKVTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVEEFF
FT                   EEFFQNWSIQQPLTPGRPLPMYSEGHRGIAPFISCGGLDSFDSDATYHDLPKSATALDP
FT                   VQSPTNPPYKRALELKRSGKLGRSV"
FT   CDS_pept        complement(1092475..1094244)
FT                   /codon_start=1
FT                   /gene_family="HOG000236577" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775330"
FT                   /locus_tag="AGR037C"
FT                   /orf_name="AGOS_AGR037C"
FT                   /product="AGR037Cp"
FT                   /function="ATP binding"
FT                   /function="lysine-tRNA ligase activity"
FT                   /function="magnesium ion binding"
FT                   /function="nucleic acid binding"
FT                   /biological_process="lysyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54526.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006430"
FT                   /db_xref="HOGENOM:HBG370907"
FT                   /db_xref="HOGENOM:HBG631383"
FT                   /db_xref="HSSP:1BBW"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI0000253482"
FT                   /db_xref="UniProtKB/TrEMBL:Q750C0"
FT                   /transl_table=1
FT                   /translation="MSEEAAVQQVAENVANLHLDEVTGEMVSKSELKKRIKQRQVEAKK
FT                   AAKKATSKPKPEPKKKVENMADLDPSKYFEARSRQIQELRKTQEPNPYPHKFNVTIGLP
FT                   AFLNKYAHLQRGETLPEERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHS
FT                   EEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLPADHFG
FT                   FKDQETRYRKRYLDLIMNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGA
FT                   TAKPFVTHHNDLDMQMYMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTT
FT                   CEFYQAYADVYDLMDMTELLFSEMVKEITGDYKIKFHPDPNDPSKEYDINFARPWKRIN
FT                   MIEELEKRFNVTFPAGDQLHTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDT
FT                   CIDPTFIFGHPQMMSPLAKHSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEE
FT                   QARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTL
FT                   KPDVLKEDLKKEN"
FT   CDS_pept        complement(1094678..1096420)
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775331"
FT                   /locus_tag="AGR038C"
FT                   /orf_name="AGOS_AGR038C"
FT                   /product="AGR038Cp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54527.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000253483"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B9"
FT                   /transl_table=1
FT                   /translation="MSADSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTS
FT                   RSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIG
FT                   YLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPL
FT                   ELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFV
FT                   IVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYAL
FT                   SVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYV
FT                   LAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGR
FT                   PLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQ
FT                   GRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPL
FT                   WLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNSPWYVKVL
FT                   NFWC"
FT   CDS_pept        complement(1096869..1098629)
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751289"
FT                   /locus_tag="AGR039C"
FT                   /orf_name="AGOS_AGR039C"
FT                   /product="AGR039Cp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54528.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000253484"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B8"
FT                   /transl_table=1
FT                   /translation="MSGFVSDKPAVPKATSDSSSSAVSIEYAGNRNAWTRFTDSFKRAQ
FT                   VDTAVDLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPA
FT                   GLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWA
FT                   TVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLL
FT                   MAGFIIMAISLTAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSE
FT                   FIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSR
FT                   ASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYV
FT                   DRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRR
FT                   AMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQN
FT                   YLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRNST
FT                   LFKRLLDFWC"
FT   CDS_pept        complement(1099432..1101153)
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622781"
FT                   /locus_tag="AGR040C"
FT                   /orf_name="AGOS_AGR040C"
FT                   /product="AGR040Cp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54529.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000253485"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B7"
FT                   /transl_table=1
FT                   /translation="MQDMTSSISSSKKDESYVKVSPNTVGSGDERRTGIMRGFIDSFRR
FT                   GRDVDLMCKADAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLI
FT                   LGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVF
FT                   PLQLVTAAMIIQYWTDINPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGF
FT                   VILGVVINCGGAGTSGYIGDKYWHEPRPFMNGFKGLCFVFCYAAFAYGGIEVMVLSASE
FT                   QENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGSRASPLVIAVSFHG
FT                   VKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFV
FT                   AMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEV
FT                   GYKARTGYWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFG
FT                   YKIYHKDWRICIPASEVDLISHRQVFDEDELKQEDLEWKLKLKSSPIWVRIYHFWC"
FT   CDS_pept        complement(1101568..1102113)
FT                   /codon_start=1
FT                   /gene_family="HOG000141735" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928325"
FT                   /locus_tag="AGR041C"
FT                   /orf_name="AGOS_AGR041C"
FT                   /product="AGR041Cp"
FT                   /protein_id="AAS54530.1"
FT                   /db_xref="HOGENOM:HBG059897"
FT                   /db_xref="HOGENOM:HBG104494"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="UniParc:UPI0000253486"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B6"
FT                   /transl_table=1
FT                   /translation="MLPAPVFQTIRAAAVAPALLLPATRALSSACTPRSWLSRLLYPPG
FT                   RPGASSYRDNNSSGGNQCLLPIRSNAELNDALLISHSAPLLLNFTFRGVPQADALTGAA
FT                   NRIVLLETDKRINIADVEADFADTREGMLRFGVNSLPTLVAVRKTLPVDYYTLSEDELA
FT                   EVNWLRLKAWIERNADDW"
FT   CDS_pept        1102383..1103879
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751290"
FT                   /gene_name="SLX4"
FT                   /locus_tag="AGR042W"
FT                   /product="Structure-specific endonuclease subunit SLX4 "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54531.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG059898"
FT                   /db_xref="InterPro:IPR018574"
FT                   /db_xref="UniParc:UPI0000253487"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750B5"
FT                   /transl_table=1
FT                   /translation="MDLRRAERNLKILGDANSDEDMPVAHSVEETQGQALFSESDEADA
FT                   EEDAAESPQSGVGGRTTTAESGGEEHREQVFLSTQVQGRIDEFEATEGARRQFRQLVTG
FT                   FTYAQEDGEANAGGRTAKRVPKVRRTRRNNTKVRSLTEFNTENFERLRKEDRARSLLTM
FT                   LSGKTQKVNNLLRGLQQERSRERAFHGCSVYNEGEWREIVRLLHERLPKATRSDVACIK
FT                   SYVYGDGLDETPWCASHARPPDCPAQSQERQGTCGPGDDELRIFTLSQLLEDQSASEDV
FT                   IPDSMDAGDAVSLGSPQPQAGLSQHSFCPDSTATSPLRPPATPLTRAPASPLPVRVYTA
FT                   PASPLDYIPDSEDDPYVLQGPSQARSPPSLLEVRRTLKNIGVRPGRSAAAVRKAAAAVA
FT                   RIEAASDAASLGTASDADRRSALFLRMTALVRRSPRLLAHIYCLRPVALDDLRAVLEAD
FT                   DDFIALLDDSLIRQWADFTGICVKNDTSDSQRPPQPLESQ"
FT   CDS_pept        1104269..1115206
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751291"
FT                   /locus_tag="AGOS_AGR043W"
FT                   /product="AGR043Wp"
FT                   /protein_id="AAS54532.2"
FT                   /db_xref="HOGENOM:HBG059899"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="UniParc:UPI0001DB2AAD"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B4"
FT                   /transl_table=1
FT                   /translation="MAAASGRGPGNGEGGSGSREDLKSQLEQIQRQFDESESEEGKQAK
FT                   KKHFPFSGMLSRRDARNALPVFAGSNTHSAVLKANSGKDMNFVVDLSENLLLECRRLQA
FT                   ENEKKSTKLRTLQQDYEALQTSFNQLTQRFQNASKESESLKDDNWELEMKLQTLSQEFK
FT                   DLTESFNKNRKELQRQVNLSTEIKTELEEVSLRELGLQGELGSKQQRYLSEIAELKDHV
FT                   KELNDENDQLNSKVEVLTSQVEKLTQEVEKSKDIIKRQSVLTMGTADSFGGELDDSVRQ
FT                   AMVPSSPSRHPMTSAEQGLEYQTLKASLTHATQTIAKLRQQIIRMKADKTFDRSGDSPR
FT                   TNRPALRTPKAKRKAFTFADPPSGSLTPTFKNASYTIHEGSVFMSDKDDDSDDDTFDVN
FT                   DGLDQATTPRLESELHFGPADMDIASIGSETMDRNPLANALSADSYGDFKLPLDRGDIE
FT                   EYAKQHNLVLVSDEEYQRLQLASPGSLEDPQKIARLQSSGYKVITISEYEALSEKANLV
FT                   SAPPLEFLEEQAKNIGKVIIDQEEYASLQDPSVTDIISKAESHGFDVLSKSAHQQMLKS
FT                   IEQPTLEYLQSKLQQHSMKAIKLNDYALFENPTEDYLSSKARLLEKSLVNSSELAELRK
FT                   ISQEPSFDYLSRAAANISCQLLPDDQFDALNKKANSPTLEHLKSASAALDHVLVDKDEY
FT                   EHLLNPPLEKLADLAATYKHALLSQHEHESLLHPSAELLTKRLTELDQVMLPKEKYENL
FT                   LSPTKHDIEQYAAACNHILVSDEDFKQLTSPSISVVIQRASELAHAVVPNEELEALKHP
FT                   DLETIKSHLSEIAYTALPIEELGNMKNQISNPTLDHISAKAKQHQSVLLPIDTYNKLLE
FT                   DSSDPSMDMVKKHIEKKDKKELLSWLAQQLDSHIMKNSEHAELLKRLDSPTLEFLAEKA
FT                   KAYDYLLFEKKEHDILLSTMENPAIDYLQTKAKNHNMIVISADYYDELKQIYESPDEGF
FT                   LKKHASERNLEILDSNVLLDLRTVAESPSLDHLKNKAAAAGYALISVSELEALNTLANS
FT                   PPLSHVISSASTYKHEVIEATALNVLREKADAPSLDHLQSCAAAIDYMLVAMAEYNKLV
FT                   STLEAPPIEFLEEKARAHQQSLIPENDLIALTSKLEEPPLEYISQKARGLKHVLLPLEE
FT                   HKSLLENANNPSLEHLKTKAEDNGYVVVPYDEHKRLVILSEDPTLEHLSEKAKARGHVV
FT                   VNESRYEDLQSLANSPDLNHLCDKAKLLGCIVVNSSDQDALLKSIEQPSLGYLKEKAEA
FT                   YAHNCVPTEKYLELKKLVEDPDLAYLEKKATEREATLIKLDAYKALLEKADSPSLQHLS
FT                   DKAESLDHLVVARNEFNDLRSLAAQHSDLLAKLEAPSLEYLKEKTVGYELVPLDTYSDL
FT                   KQTFDDPSLDFLKNKSKEKGFDLVAITEYKELLRRAVDPTLDEMADVLRKTGRVILSQD
FT                   IADKLQKTAESPSKSFLAEKAATMGLLLVEKEKYDVLLKKSSDKDTILSSIQGFGFIPI
FT                   PIPELSLLKNSAVDKASLATLKGRLSDLGYVPVAKAELEELNRPAVERIDKSDTIKLCE
FT                   QYQLKPISIEEYKKLKEDSKPVVHSEDELIQMVSSHGYVVIPESSYNQLKEAAESPNVD
FT                   AITKHAATHKMVLVDQDEHNQLLETLARPSIEHLTEKAADLGFKVIKLNEYERIFSLIE
FT                   SPSKAFIEEHATELGYVLLTNDEKDELTQLATAPTVAQLTSRAGSHNMRLVDQDKYEEL
FT                   LRKSEFPTLEELTEKASNLKMSLVLSKEYETLLKKVSDPELPVIETSAAKLGYVLVSAD
FT                   DYNSLKEQLKSPSMEYLDEKAKNLEYVLVQKVDFETLKSKIEEPDEQFIAEKATIYGKI
FT                   LVSSEVHQENNRKLTSPDILFISELASKIHHAVLPIAELDGLKKQISEPTLEYLVEKAA
FT                   IIDQVVVSKAFYDTLQNKISHPTVEELTSLAKRLDYSVLPSVELQKLRAQIENPSTAYL
FT                   DDIAGKHGKILIGKKEYLQLLEVSTKPSIEFLSNHAEIYDSVVVTCEEFDALKQLAEHP
FT                   DLEHLRTKADSKGFVLIEKSSYDSLQYQLSSPTFDFLSAEAEKIDHSIVPKKRLDELTS
FT                   IEETPSLSFLIDNLLTQSHVAVKKETYETLQTNFEKPSLEFLSEKARDCHQKVLLDEAE
FT                   YEDLIAQLENPSVDYLKEKIKESNHVVVDIEEYNSLLKSAAAPTLDEIKQMAHDLLHSV
FT                   IPDQEYTSMKQELDNPSIEFLMEKSEAIKYSLLPSDLVASMKNSLEYPTEEYLQEKSLG
FT                   FSKVLVDEKEYAKHLHELSSPSISYLEGHAVKYGKVLVPKDRWDELEHLAADPPEDFLL
FT                   KHAQLTGKTLVSVEDLKKLRNSAEHPSWQKVKSVAQEKEFTLISNDHYQALESTVKEPT
FT                   IDFIKEHLDESEWCLLTKKDYDELKTQVDTPALDYLEEQAVKNGYALVLQEEFKKLSDP
FT                   SSEFLHSAAASRGLALLEGDKYNRLVESSIENLSEARLIDLCTRLNLKPIPIDQYERLI
FT                   SPDAEKVSEYAAGYGLVTVISEEYHLLQAKAENPDKPTLIKSAELLGLKVLTSSDYSEL
FT                   VSKADKVDHFTRSDIESMAESLGLVAIPLSRYNELLEELREVTAISGAGHRSKVLASKE
FT                   YFEHVIRQENISNRDKVFESAKSLGFVTLSSQEYKDLVKNQKDHVLSKADVFSGAKQFD
FT                   LSVLPTDEYKALLKRATSRENITYDELQILASQLDYKLVPIFSQQTPTLAPPKRISQEI
FT                   TTLKQSKIRTGSEYSEQSSVSTSTMEYYDAYQTASTVTAGRVRNSIISSSSEYTDALDL
FT                   PEEEIPDNHSFASTIRRESSPSIETLRERAKSLGYILVRADASLVSENSSDKNATVPQI
FT                   VDPKLGDLPELFQDDGSAGSDSGSFVSTWNEKTVSDRAGKLGLMVVTADQFKEYEQLKT
FT                   VSPKDQLAQQAKELDMVLIDAAELYELRSKVSDGLSGDLNSDFVLSKEIILENAHSYGL
FT                   TVLQTEEYLQLQSSLEREQVTSYNIAEKATTIGYVALPRTEYDELVASQASTKEQNFEV
FT                   YAAENGKVIVDKSEYHDLKIKAIPVISPLPQMSKEQMVEKAKELGMVALLIDEYEKLKS
FT                   PISDNALNATAKDRGKVVLLKEEYNRLLELEEKCACDNMTKAQLIERSQSHGMIVLEST
FT                   KYDKMKEHIAIRTSGITVADILSKSTEYGLVPIPKEQFEQIKMELEHPKFTREMIVDHA
FT                   GDFDLIAVELKEYNRLKKQSQFSFGDIFDSINTDEESEASDFEYHDDEIKQLNKTAKRF
FT                   GLLCIPEAAFIATSVASTPDVDNVVVLPISYYNKLIANEAKSLEKLTDWDLQSEAKKRG
FT                   YHINFSFKKEDAPPPPSTLCPPRMPKFSPNRSTLSLDSKTTRRAFNEAATVAAQSEFEQ
FT                   LSRTGSKLQSSTSSLARNPTAGTSDTPGNNGGNMTPNLFPSRRNSVDMGISLATVASLS
FT                   EPSIIPALTQTVIGEYLYKYYRRLGRFSQHESSRHERYFWVHPYTLTLYWSTSNPVLAN
FT                   PGSTKTRAAAILAVDSVDDPNPFPAGLYHKSIVVKTEARDIRFTCPTRQRHNIWFNTLR
FT                   YLLQRNMNGITLDDGNDSAGRITCLPGEDPRDATNRLSTTRHVSVSSKHLRRTDSMFTL
FT                   R"
FT   CDS_pept        complement(1115568..1116470)
FT                   /codon_start=1
FT                   /gene_family="HOG000001038" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751292"
FT                   /locus_tag="AGR044C"
FT                   /orf_name="AGOS_AGR044C"
FT                   /product="AGR044Cp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS54533.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059900"
FT                   /db_xref="HOGENOM:HBG203178"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI0000253489"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B3"
FT                   /transl_table=1
FT                   /translation="MNLYAGSQLVQAATRLASDTTNTSSIFSHDDDNYDARIKEIEEYY
FT                   IKTLLAEENEMEPLGAERFPTSKQQLDPAVLALQQPADGIYGPGWGAGEPVWGGEWSGL
FT                   GAANAEPSLEVAINSHYRPANGILPLTPENLALLQHPSEEPSAQGEQAHSRRRTFAPVQ
FT                   SPAPPPPQQQPQPSQEKVNKMLYKTELCESFATTGACKYDNKCQFAHGLHELKFKERSD
FT                   KFRTKPCINWSKTGYCRYGKRCCFKHGDDDDIMVYLKAGLIKPSADELKLKANKAPEGA
FT                   TKNKKNLHANVKILQSMAW"
FT   CDS_pept        1117144..1117914
FT                   /codon_start=1
FT                   /gene_family="HOG000191823" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751293"
FT                   /locus_tag="AGR045W"
FT                   /orf_name="AGOS_AGR045W"
FT                   /product="AGR045Wp"
FT                   /protein_id="AAS54534.1"
FT                   /db_xref="HOGENOM:HBG339025"
FT                   /db_xref="HOGENOM:HBG444493"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000025348A"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B2"
FT                   /transl_table=1
FT                   /translation="MDYQEEQKQELEVLESIYADDLTVVCGEYPKIQFEVDLKLDLIPL
FT                   ASSSFTAAAISKEQHLVVDITLPERYPEEAPQLSIRPWDVRGGDEAGEEDEEQEYDEHG
FT                   NPVVAKLENIPDSISFDGEVDGFASQAMRQVEEDMLLGIQMCFALISSIKEDAESWFQK
FT                   ELERREKEHERQLRERELEEQKKFRGTKVTHESYMSWRASFRQELGLDERDQERRMQAH
FT                   LGRLSGRQIFEEGLAGEEDVEAGEDDIVQGIKQL"
FT   CDS_pept        complement(1118059..1119222)
FT                   /codon_start=1
FT                   /gene_family="HOG000112379" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928326"
FT                   /locus_tag="AGR046C"
FT                   /orf_name="AGOS_AGR046C"
FT                   /product="AGR046Cp"
FT                   /protein_id="AAS54535.1"
FT                   /db_xref="HOGENOM:HBG059901"
FT                   /db_xref="HOGENOM:HBG203179"
FT                   /db_xref="InterPro:IPR001026"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniParc:UPI000025348B"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B1"
FT                   /transl_table=1
FT                   /translation="MDSLSKKISNLGIHDIRNAARFAQNVIIQYEPYQVDVRRATNTDS
FT                   WGPTPKQMLKVMRHKNHVPMYLITEYTMKRLVDHMAKRPKNLYEKARKQYVNYGHEWRV
FT                   VLKCLVVLEFLILNSSSGQELDQVLSCINTHKHILARDTMQFKVEFSSDGKMEVHERGI
FT                   RKKCEQVLQYTEDAGYLKRVRAKHKQQSMQIHTSGSGYGLNASYNDNVVSIGDASSAGT
FT                   YDLDDELEDYEPHKNNRTGSAEGNQRRASVLDEQRRQRRELLRERIKHSERQRKESAKQ
FT                   QEPIVDLLDLDDPQPPAPGGDISDDDDFGDFQSEGTPQPHGSSSAGSQPRNSANSMRTG
FT                   PVDDLLNWGDKPSTSSSGSGTTPSAGNGKPAGQDAFAALFSYSKTHI"
FT   CDS_pept        1119828..1124306
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079587"
FT                   /locus_tag="AGOS_AGR047W"
FT                   /product="AGR047Wp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54536.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001DB2AC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B0"
FT                   /transl_table=1
FT                   /translation="MGTMRAERGSRPDWGGGPISFYGDLELTFIDGVLLRGTALLMLAV
FT                   GSARVWRLIARPHPGVKYRQDWLLMARLGCSAVFLALCAAAGATVQGDASIYWLTAAST
FT                   AVAIVLQWISFMRAPVSDGVLLFYWLFEALVHVARSVNFTIRHFYEDQWPAGHRAFVFE
FT                   ILLVASALLVLALEAGPQKRKKPYQEIRELHSSRRRNPLEKAHIFQRITFSWMSEMMSN
FT                   GYRRYLTERDLYQLPAEHDARTLSEDMEKRWQRELNKRARPSLAWVLFSSFSHKILLAV
FT                   LFKICHDILAFTQPQLLRLLIKFVTEYSKARGDISAEEDVPLVRGFMLAVGMFLVSVVQ
FT                   TTVLQQYFLQAFDTGTDLRSGITSLIYKKALHLSNEASGTSATGDIVNLMSVDAQRLRD
FT                   LTQWGNVIWSGPFQLCLCLYSLHRLLGPCIWVGVVLLLFTLPLNSYISRVLKRLQKEQM
FT                   KNKDERTRLISEILNNIKSLKLYAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQY
FT                   NIIPFLVSCSTFAVFVLTQKGRPLTTDLVFPALTLFNLLSFPLAVLPIAITSFIEASVA
FT                   IGRLTNFLTAEELQRDAITREPAVKAPGGVAVALADNATFLWQRKPEYKVALKNINFRA
FT                   KKSELTCIIGKVGSGKSALIQAMLGDLFRVNGSAVVRGNVAYVSQVAWIMNGTVRDNIL
FT                   FGHKYDAKFYQQTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYARA
FT                   DTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLTTNKITALEIADHIVLLENGE
FT                   IVQQGTFSEVISDEDSAISKLVLHHGKKQNGAPTSGESSSPSSSAFEYDVVEPDLDLEK
FT                   LADEELQVQDVFSLRRPSDATFKSISFAETAHEEHREQGKVKWSIYLEYAKACNPRHVV
FT                   VFLCVLTLSMFLSVMGGVWLKHWSEVNTRYGYNPNVALYLGVYFMFGLGASLSTLIQSA
FT                   ILWIYCSIHASVYLHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQ
FT                   FFANTTRVSFTIIVICVTTWQFTFFVIPLAMLYIYYQQYYLKTSRELRRLDSVTKSPVY
FT                   AHFQETLNGVSSIRGYGQLDRFIHINQARINNNTSAYYPSMNVNRWLAYRLEFIGSCII
FT                   FFAATLSVFRLASGSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYA
FT                   ELEPEAPQFIANSVPSGDWPKDGEIKFENYSTRYRPGLDLILRGINLHIKPHERVGIVG
FT                   RTGAGKSSLALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRD
FT                   NIDPTKQYTDEQIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARAL
FT                   LIPSRILVLDEATAAIDVETDKVIQDTIRSSFNDRTILTIAHRINTIMDSDKIVVLDKG
FT                   TVAEFDTPENLLKKKEESIFYTLCKEAGLTS"
FT   CDS_pept        complement(1124613..1125974)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928327"
FT                   /gene_name="HOG1"
FT                   /locus_tag="AGR048C"
FT                   /product="Mitogen-activated protein kinase HOG1 "
FT                   /EC_number="2.7.11.24"
FT                   /function="ATP binding"
FT                   /function="MAP kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54537.1"
FT                   /db_xref="GO:0004707"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008352"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000025348D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750A9"
FT                   /transl_table=1
FT                   /translation="MWRARTMASQEEFYRTQIFGTVFEITNRYADLNPVGMGAFGLVCS
FT                   AVDTYTQQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLEDIFLSPLEDIYF
FT                   VTELQGTDLHRLLQTRPLEKQFLQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCD
FT                   LKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPL
FT                   FPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVTSLPHRDPVPFTERFKNLKPDA
FT                   VDLLEKMLVFDPKKRITAGDALTHPYLAPYHDPTDEPVADAKFDWNFNDADLPVDTWRV
FT                   MMYSEILDFHQVPDSQINPNDTFDDQVAAATAAAEAARQQQQQKQQQQKQQQQRHQGVE
FT                   HGAQHVQLQHGAKQLSADPLVGDSNGGIPLNVSAANETLNNFANQAAQYATDFE"
FT   CDS_pept        1126486..1126884
FT                   /codon_start=1
FT                   /gene_family="HOG000001118" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751294"
FT                   /locus_tag="AGR049W"
FT                   /orf_name="AGOS_AGR049W"
FT                   /product="AGR049Wp"
FT                   /protein_id="AAS54538.1"
FT                   /db_xref="HOGENOM:HBG124145"
FT                   /db_xref="UniParc:UPI000025348E"
FT                   /db_xref="UniProtKB/TrEMBL:Q750A8"
FT                   /transl_table=1
FT                   /translation="MQFSTVASIAAAAAVASAHANVTTATATRNQTTLVTITHCEDKTA
FT                   CTAHVSPALVSTATVTIDNVVTLSETWCPLSTTEAPKPPVSTAKPPASSNATVPPTETP
FT                   VVSSFTGAAAKALPAAGALFAGAAALLL"
FT   CDS_pept        1127338..1128711
FT                   /codon_start=1
FT                   /gene_family="HOG000141729" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079588"
FT                   /locus_tag="AGOS_AGR050W"
FT                   /product="AGR050Wp"
FT                   /function="voltage-gated potassium channel activity "
FT                   /cellular_component="voltage-gated potassium channel
FT                   complex"
FT                   /protein_id="AAS54539.2"
FT                   /db_xref="GO:0005249"
FT                   /db_xref="GO:0008076"
FT                   /db_xref="HOGENOM:HBG059902"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniParc:UPI0001DB2AC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q750A7"
FT                   /transl_table=1
FT                   /translation="MSERGEQFSMELPNVLPHENMYLVQIGHKLFRISGASLSSDSPSY
FT                   FTEYFRRRGEEREVEEARDGKDILFIDRSPEVFELIYSHLQGYCITVRDELQYTMLFAD
FT                   AMYYSLPRLRDMLKHSEYYYTCIGGTSFKIPKDLLSAHGNSPNYFDVAVDSLYTGLEQM
FT                   YLSRKPIRPPPQSPPYVARSPALFRDIIALLNGAEITMDDRKRNSLLKECRFYHFLNLE
FT                   QRLLKAEVGYDPFYKSELITMQINDLSPKGIGVKAKSEKMAGCPGQEPEEPPAADSQDA
FT                   PPAKRQRLCTDWHICSYMRPYLDSTPRDLIFQISAMDCIIYFNKRKKTIHVNIRGDTAI
FT                   RFVSLFGSQMQQYGVSLDSYRDPALTDGLIIPCCVSVCDLTVNGIKCTNICSLIDECKI
FT                   TEKIPDFTRGDGCVPGLKLVLLKSMWRLGVKEGEIILVCIRGEAVTGVNEFHHNIKYL"
FT   ncRNA           complement(1128929..1129022)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR6U6"
FT                   /product="AgSNR6_U6"
FT   CDS_pept        1129481..1130167
FT                   /codon_start=1
FT                   /gene_family="HOG000074700" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775332"
FT                   /locus_tag="AGR051W"
FT                   /orf_name="AGOS_AGR051W"
FT                   /product="AGR051Wp"
FT                   /protein_id="AAS54540.1"
FT                   /db_xref="HOGENOM:HBG059904"
FT                   /db_xref="HOGENOM:HBG104515"
FT                   /db_xref="UniParc:UPI0000253490"
FT                   /db_xref="UniProtKB/TrEMBL:Q750A6"
FT                   /transl_table=1
FT                   /translation="MQQPLNDISNREAATRGSDVFKRLAGSPMRRDGAAMDKPAMRLSP
FT                   GKHAYQTSPKRLLAPEHLRSLTQSVDRHFFNTARATGRPGSRDAAFTASPTKGDGGFSN
FT                   MTVAGGDGSLSRIRNRFSPVKERKPILASEQEDGAATRQNLLAKLQREEDVTQVTRRNT
FT                   RQNSEASRYKVGKSQIVTRSRNVKFELPEDRMIAIELQNLKQLIHTLIERQDQLEDRLT
FT                   RLEEQP"
FT   CDS_pept        complement(1130170..1131318)
FT                   /codon_start=1
FT                   /gene_family="HOG000154095" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751295"
FT                   /gene_name="REX3"
FT                   /locus_tag="AGR052C"
FT                   /product="RNA exonuclease 3"
FT                   /EC_number="3.1.-.-"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54541.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG059905"
FT                   /db_xref="HOGENOM:HBG202451"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI0000253491"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750A5"
FT                   /transl_table=1
FT                   /translation="MAVLRPVDMRMQPAPYEGRMKVIHKILEQLQKYRPRKANLEGLAV
FT                   QWEHEVAKRSSSKHGYMFNASLLLRDIARHKGNLNRQGRYEAPAPQVSKAEVLAALRNL
FT                   VLSEQVLSENGYVTAQDALESAAEEKEGLETCVRCLKKFDVRDIMVPTQCQFHVLKEQY
FT                   NKDMRTFQYRCCGEIGTSCTPFALGCKTLEHHVFRPCTYAAMSKLLPFRNTRGVEGETN
FT                   VLALDCEMAYTSCGYELIRLTVVEFWTNAVLFDEIVQPLGEIIDLNTQFSGVHEIDRAV
FT                   AKTFEEAREVFLSPAMINENSILIGHGLENDLNVLRIIHDKIIDTAILYPNGKFKSSLR
FT                   NLAFQELSRRIQTGEHDSSEDAIAAMDVVKHKLGIPLDRKTW"
FT   CDS_pept        1131617..1132231
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751296"
FT                   /gene_name="DPB4"
FT                   /locus_tag="AGR053W"
FT                   /product="DNA polymerase epsilon subunit D "
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54542.1"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000253492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750A4"
FT                   /transl_table=1
FT                   /translation="MVCGESNAAAISAKYVDNDPLQRPAARATPANESHICDLMPPKGW
FT                   KKDAQGNYPTTSYIKEQEKLTVDDLLFPRSIITSLAKDAVHQAVQTAEQDPRVMLSKDA
FT                   SLALQRSSTVFVNHLLMHARQIAQSNDRKSCSGEDVLKALDQIGLAGFESVVRERVVEY
FT                   EKEVQRRRAEKTPAADEGQAEEGDAADEEEGSHKRAKLDEH"
FT   CDS_pept        join(complement(1133001..1133016),
FT                   complement(1132253..1132938))
FT                   /codon_start=1
FT                   /gene_family="HOG000113898" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751297"
FT                   /locus_tag="AGOS_AGR054C"
FT                   /product="AGR054Cp"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54543.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG059906"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR019005"
FT                   /db_xref="UniParc:UPI0001DB2AC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q750A3"
FT                   /transl_table=1
FT                   /translation="MKNYSLTFVEIVNRDKSTTRCQWYHDATAGSAGYGAVSNRAHKDV
FT                   TQESFHNLVHEVVIPKVVRLTGNKVIKTTMTFIDGYDCYYTTNDAGQVLVCFASVGTPK
FT                   ILPLRALTRLKAMETSDDAVLHRNLDAILKEFHQELLSYHDPTSSNATDQDLQTIVSVM
FT                   NDNIDKFLQRQERISLLVDQTSQLNQSSFNFQRKAVRIKRKMWWNNIKFWTVSVSVGLC
FT                   ALFILWMILHI"
FT   CDS_pept        complement(1133758..1135266)
FT                   /codon_start=1
FT                   /gene_family="HOG000246494" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775333"
FT                   /locus_tag="AGR055C"
FT                   /orf_name="AGOS_AGR055C"
FT                   /product="AGR055Cp"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS54544.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059181"
FT                   /db_xref="HOGENOM:HBG626178"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI0000253494"
FT                   /db_xref="UniProtKB/TrEMBL:Q750A2"
FT                   /transl_table=1
FT                   /translation="MRLSGVQYKLRPGHIRSVAVVGAGPYGAGVTKALVKEGSFDQIHV
FT                   FERREQFGGLWNYTKPLLKHHGVTCAAAVPCENARLQMRPQLTKDGRPAFQTAAYRYLD
FT                   TNVPRDLMQYRSISFPEGTPLFPTREQVLEHILQFCRPIKKYVQFNTEVTKVSYDDARA
FT                   KYSVLTTNLLDNTTRAIEVDAVAVATGYYNMPFIPDRPGLKSWHETYPCSISHSIDFDA
FT                   PEDFLDVKGEIIVVGNNASGSDISYELARCLKRPIYKSKRSESLLPGGSDSNIKDVADI
FT                   KRLDPASKTVELVDGQVIQNVEKLLFCTGYLKSVPFLPSSAKEGEHGNRVMSQLITEGD
FT                   KVTDLYNHMLSIRLPTLAFLGLPRYVLPIRLSETQGSWLARVWSGRISLPSEEVQWKYH
FT                   EWTLENNGRGIKYHDLLFPHDIQHSQRLNMEIRHAGAGGHFGVEWTGNHIKLRAALKPL
FT                   KEAYIEYLKQTNKRAVSVEELIDNGYFTWPEDATTCVQVPHFAP"
FT   CDS_pept        complement(1136167..1137588)
FT                   /codon_start=1
FT                   /gene_family="HOG000141732" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775334"
FT                   /locus_tag="AGOS_AGR056C"
FT                   /product="AGR056Cp"
FT                   /protein_id="AAS54545.2"
FT                   /db_xref="HOGENOM:HBG059907"
FT                   /db_xref="UniParc:UPI0001DB2AC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q750A1"
FT                   /transl_table=1
FT                   /translation="MIKQAAKSPVVPEQESRRHALLADVVRQGDVQFADVEAISQLAEL
FT                   GSGADGLDDEGGALERLAAVRASAPGLALTPSMSSVMSQIRKFNNAPTSISSGSLGSGS
FT                   AAPSRKRRDTSFSSTSSSSASRRRRRSNGPPLLGEPRLRDDALWFTSAEEGDNGDEDVE
FT                   EVRSDASFGHPLTEIGDENSQAPGCGGLESTVYNLGLPHVKCVNPQDLDLQDVWSAADI
FT                   VQLYPPVYQRRTRRQPVAPFRRASVELTIDEMRNVGMMMEPHSSGTRTRPILDTIELEH
FT                   WASGDNDATQITKIIDKEENWLEMHLPNRRTRQSSLNPNFLRLYALELSCKLKSLLPDL
FT                   NVDEHVLTKLSYEEIWNLNIPHKHENVSPYQIKLALITRRKLWTDMCNILRQDLHGVNA
FT                   PWNLKFVSGHASEDDSGPGCTPSTSLVRVESDVKPWYKGGKDFMLRPCGKLAVGKHCKR
FT                   EIQYVVKGWCDSRFS"
FT   CDS_pept        join(complement(1139409..1140344),
FT                   complement(1138160..1139407))
FT                   /codon_start=1
FT                   /gene_family="HOG000141731" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /ribosomal_slippage
FT                   /gene_id="IGI18079589"
FT