(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE10

ASHGO_7.PE10         Location/Qualifiers
FT   CDS_pept        complement(26363..28453)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749021"
FT                   /locus_tag="AGL361C"
FT                   /orf_name="AGOS_AGL361C"
FT                   /product="AGL361Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54130.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058382"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00002532FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q751Q0"
FT                   /transl_table=1
FT                   /translation="MDILTIITNQPSKEGRTREAKSQSYPNRLSFQAAPQTNSSADMLE
FT                   TLKSKKPKVQYSRKGCSQCKKSHIKCDKVQPLCTTCAKKNILCTYELSFVFEDGSSKRK
FT                   ILKRLPKTKKKRPQEIVTPLSLASNSTSSLSTSSRSQSLSQMLPAVAVLHAEQECVRGN
FT                   VRRASMDDTSDAQNQRSSTTSAGISNFSFESDQFDIQNFLDTSPADLILFDNAEFELNA
FT                   WTEQQTHAGWKMFTFDWRDADWPEVMKLLEAYDPIQHGSPVSQPCAPTDLGVDPSELNR
FT                   FVWTMARSTQLFGNFAIFPNDKMEELINVLWIINLHYGVIQDALTYGCGMFIKEVYERA
FT                   NYQTFAYHWGMIAMSSKESVSFDLLNTQLLKAVVFTDFVAVLFAYFLAIASNSTCERFE
FT                   WDTYFPQGYHVIRHVRTLIPLSGCMSELERAAISAFGVLEDWFCQAEVIAQVISDKGGA
FT                   LSERTELEYLLTKVPPLLTSYQNKYDLMKGCFHNFNAIFLKLCLKLTDLKDRGVQLGGR
FT                   HMIEYKLLNTNTSLALELHAFGSTLLEELEAIQPSKTELRQACNGIADHRLQHAMKNSH
FT                   EMYFIGLQLYLKALFMDTPLNSPELVELLERMLEAGQNITYYSAKTICCHLFAFLGAEV
FT                   ALLINNRSLFKSFMGLLKTIADSGTAAAKNSMRRLNYISLVLETRSYTLLVNPIYNNGI
FT                   DL"
     atggatatct taacgataat caccaatcaa ccctctaagg aaggtaggac tagagaagct        60
     aagtcgcaga gttatccaaa tcgcctctcg ttccaggcag ctccacagac aaattcgagc       120
     gcggacatgc ttgaaacgct gaagtccaaa aagccaaagg tgcagtattc tcgcaagggc       180
     tgctcacaat gtaaaaagtc ccacataaag tgtgacaaag tacaaccgct ctgcacgaca       240
     tgcgccaaga agaatattct gtgcacatat gaattgagct ttgtatttga agacggcagc       300
     agcaagcgga agattctgaa gcgtctacca aaaaccaaaa aaaagcgacc acaagaaatt       360
     gtgacaccgc tttccctagc tagtaacagc acatctagcc tttctaccag ctctcggagc       420
     caaagcttgt cgcaaatgtt accagccgtg gccgtcctac atgctgagca ggaatgcgtg       480
     cgtggcaacg tgcggcgcgc gtcaatggat gacacgagcg acgcacaaaa ccaacgatct       540
     tctacaacgt cagcagggat ttccaatttc agctttgaat cggaccaatt tgatatccag       600
     aatttcttag atacatcgcc cgcagatctc attctgttcg ataacgccga gtttgagctt       660
     aacgcatgga ctgaacaaca gacacatgcg gggtggaaga tgtttacctt tgactggcgc       720
     gatgcggact ggcctgaagt gatgaagctt ttggaggcat atgacccaat acagcatggc       780
     tcgccggtct cacagccgtg cgcacccaca gacctcggcg tcgatccctc cgaactaaac       840
     aggtttgtat ggacgatggc gaggagcacg cagctctttg gaaacttcgc aatcttcccc       900
     aatgacaaga tggaagagtt aatcaacgtt ttatggataa tcaacctgca ttacggcgta       960
     atccaggatg ccttgaccta tggctgtggc atgtttatta aggaggtcta cgagcgggca      1020
     aactaccaaa cctttgccta ccactggggc atgattgcga tgtcttcaaa agaatctgtg      1080
     tcgttcgacc tgctaaatac acagcttctg aaggcggtgg tgttcactga cttcgttgct      1140
     gtgctcttcg cgtacttcct cgcaattgca tccaacagca cctgcgagag gttcgagtgg      1200
     gacacgtact ttccccaagg gtaccatgtg atccgccatg tgcgaaccct cataccgttg      1260
     agcgggtgca tgtcggaact tgagcgagca gctataagcg cctttggtgt gctcgaggac      1320
     tggttttgcc aggcggaagt aatagctcag gtcatctccg acaagggtgg cgccctctca      1380
     gaacgaaccg agctcgagta tctattaacc aaggttccac cgcttctcac aagctaccaa      1440
     aacaaatatg acctcatgaa gggttgtttc cataatttca acgccatttt cctcaaacta      1500
     tgtttgaagt tgactgacct caaggaccgc ggcgtgcaat tgggcggacg gcacatgata      1560
     gaatacaaac ttcttaatac caacacatca ttggcgctgg agctacatgc gttcggctcc      1620
     accctactcg aagagctcga agccatccaa ccttccaaga ctgagctcag gcaggcttgt      1680
     aacgggatcg ccgaccaccg actacagcac gccatgaaga actcgcacga gatgtacttc      1740
     atcggtctac agctctattt aaaggcgcta ttcatggaca ccccgctgaa ctcccccgag      1800
     ttggtggagc tgctcgaacg catgctcgag gccggacaga atatcacgta ctattcggcc      1860
     aagactattt gctgccactt gtttgccttt cttggcgcgg aggtcgcctt gctaataaac      1920
     aaccgttcct tgttcaagag cttcatgggt ctcttgaaaa cgattgcaga cagcggaacc      1980
     gccgctgcga agaacagcat gcgacgcctc aactacatct cgctggtatt ggagaccaga      2040
     agttatacac tgctagtaaa cccgatatat aacaacggca tcgatctcta a               2091
//

If you have problems or comments...

PBIL Back to PBIL home page