(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE104

ASHGO_7.PE104        Location/Qualifiers
FT   CDS_pept        complement(209407..210690)
FT                   /codon_start=1
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749063"
FT                   /locus_tag="AGL267C"
FT                   /orf_name="AGOS_AGL267C"
FT                   /product="AGL267Cp"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54224.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI0000253357"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H3"
FT                   /transl_table=1
FT                   /translation="MAVLLSKKVIRVALLSSVVLLFLGLLSGHQDVQEYMPDSVRDMHS
FT                   SVKGSLTGVWGGRTEAVVEETKSDAGVAHADSGAERSKAPAKAKEPAEEWMRKPAPVQA
FT                   DGKVRASFVSLVRNSQLEGIIPAIKLVEQRFNHKYHYPWLFLNDEPFNEEFKTEIRKVV
FT                   SSEARFETIPKEHWSFPEWIDQDKAAETREKMKGIIYGDSVSYRHMCRFESGFFWRHPA
FT                   LEDYDWYWRVEPDTKLFCDIDYDVFRWMQDNDKVYGFTISIHEFQATIPTLWETTTNFI
FT                   KKHPEYVAKDNMQGFISDDNGKTYNLCHFWSNFEIASLNFWRSKPYREYFDYLDQAGGF
FT                   FYERWGDAPVHSIAASLFLPKDKIHFFNDIAYYHGPFTHCPIEKDVFQKGNCDCNPDDD
FT                   FTFQGYACGHKYYEVNSMKKPPGYERFQ"
     atggccgttc tactgtcgaa gaaggtgatt cgagtggcac tgctatcctc tgtggtgctc        60
     ctgttcttgg ggctcctctc ggggcaccag gatgtgcagg aatacatgcc cgatagcgtg       120
     agggacatgc actcgagcgt taagggctcg ttgacggggg tctggggcgg caggaccgag       180
     gccgttgttg aggagacgaa gagcgatgcg ggcgtggcgc atgcagacag tggcgcggag       240
     cgctcgaagg cgccagcgaa ggccaaggag cctgcagagg agtggatgcg gaagccggcg       300
     ccggtgcagg cggacggtaa ggtgcgcgcg tcgtttgtct cgcttgtgcg aaactcgcag       360
     ctggagggca tcattccggc gatcaagctg gtcgagcagc gcttcaacca caagtaccac       420
     tacccctggc tcttcctcaa cgacgagccc ttcaacgagg agttcaagac cgagattagg       480
     aaggttgtga gctctgaggc acgcttcgag accatcccca aggagcactg gagcttcccc       540
     gagtggatcg accaggataa ggcggccgag acccgcgaga agatgaaggg catcatctat       600
     ggtgactccg tgtcctacag gcacatgtgc cgcttcgagt ccggcttctt ctggcgccat       660
     cccgcgttgg aggactacga ctggtattgg cgtgtcgagc ccgacaccaa gctcttctgt       720
     gacatcgact acgacgtctt ccgctggatg caggacaacg acaaggtcta cggcttcacc       780
     atctccatcc acgagttcca ggccaccatc ccgaccctct gggagaccac caccaacttc       840
     atcaagaagc accccgagta tgtcgccaag gacaacatgc agggctttat ttcggacgac       900
     aacggcaaga cctacaacct gtgccacttc tggtccaact tcgagatagc ctcattgaac       960
     ttctggcgct ccaagcctta ccgtgagtac tttgactacc tcgaccaggc cggtggcttt      1020
     ttctacgaaa gatggggtga tgcccctgtg cacagtatcg ctgcgtcctt gttcttgccg      1080
     aaagataaga tccacttttt caacgacatt gcatactacc atgggccctt cacccactgc      1140
     ccgattgaaa aggacgtgtt ccagaaaggg aactgcgact gtaacccgga tgatgacttt      1200
     acgttccagg gctacgcatg cggacataag tattatgagg tcaacagcat gaagaagcct      1260
     cctggatatg agcgcttcca gtga                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page