(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE118

ASHGO_7.PE118        Location/Qualifiers
FT   CDS_pept        complement(230112..230414)
FT                   /codon_start=1
FT                   /gene_family="HOG000216525" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749066"
FT                   /gene_name="ELC1"
FT                   /locus_tag="AGL253C"
FT                   /product="Elongin-C"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54238.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG317170"
FT                   /db_xref="HOGENOM:HBG360223"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="UniParc:UPI0000253365"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751F9"
FT                   /transl_table=1
FT                   /translation="MTPTSHVTLVSSDGKSFEVPRERAMLSPTLAKMLDSSFAEAKEAK
FT                   VTLPTIESSMLAKVVEYLEYLEEYKHKDDGEDIPQFEVPPEISLELLLAADYLQI"
     atgaccccca ccagccacgt tacgctagta tccagcgatg gcaagagttt tgaagtaccg        60
     cgcgagcgag cgatgctatc gcccacgcta gccaagatgc tggactcgtc tttcgcagag       120
     gccaaagaag caaaggtcac tttgcccacc atcgagtcca gcatgctggc caaagttgtg       180
     gaatacctcg aatacctcga ggagtacaaa cacaaagacg atggagagga cattccacag       240
     tttgaagtgc ctccagagat atccctggag ttattactag cagcggacta cctacagata       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page