(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE129

ASHGO_7.PE129        Location/Qualifiers
FT   CDS_pept        join(complement(250103..250119),complement(249161..250049))
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079004"
FT                   /gene_name="PHO85"
FT                   /locus_tag="AGL242C"
FT                   /product="Negative regulator of the PHO system "
FT                   /EC_number="2.7.11.22"
FT                   /function="ATP binding"
FT                   /function="cyclin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS54249.2"
FT                   /db_xref="GO:0004693"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001DB2B18"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751E8"
FT                   /transl_table=1
FT                   /translation="MTSTSQFKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEG
FT                   TPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRG
FT                   LELSLVKYFQWQLLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVN
FT                   TFSSEVVTLWYRAPDVLMGSRTYCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIF
FT                   ETMGTPTEQTWVGVSQLPKYNPQIPLYPNKDIKQLLQATTKEQISDVLVNLIQGLLQLN
FT                   PSMRLSAQQALSHPLFEEYH"
     atgactagca catctcaatt caagcagctg gagcggctgg gcaatgggac atacgcgact        60
     gtgtacaagg gcctgaacaa gacgaccggg ctgtatgttg cgctgaagga ggtgaagctc       120
     gactcagaag agggcacgcc gtcgacagcc atacgtgaga tctcgctgat gaaggagctg       180
     aagcacgaga acatcgtgag gctgtacgac gtaatacaca cggagaacaa gctgacgctg       240
     gtgttcgagt tcatggacaa cgacctgaag aagttcatgg actcgcggct cgaccgggag       300
     atgccgcgcg ggctggagct gtcgctggtg aagtacttcc agtggcaact gctgcagggc       360
     gtggcgttct gccacgagaa ccggatcctg caccgcgacc tgaagccaca gaacttactg       420
     atcaacaaca agggtcagtt gaagctgggt gacttcgggc tggcgcgcgc gttcggcatc       480
     ccggtgaaca cattcagcag cgaggtcgtg acgctctggt accgtgcgcc ggacgtcctg       540
     atggggtcgc gcacatactg cacgtctatc gacatctggt cgtgtggctg cattctagct       600
     gagatgatca tggggaaggc gctcttcccc gggaccaacg acgacgagca gctaaagctg       660
     atcttcgaga ccatgggcac gccgacagaa cagacgtggg tcggcgtcag ccagctgccc       720
     aagtacaacc ctcagatacc gctctacccc aacaaggaca ttaagcagct attgcaggct       780
     accaccaagg agcagatcag cgacgtgctc gtgaacctca tccagggcct cctccagttg       840
     aatccaagca tgcgcttgag cgcacaacag gcgctgagtc accctctatt cgaggagtac       900
     cactga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page