(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE13

ASHGO_7.PE13         Location/Qualifiers
FT   CDS_pept        complement(32992..35412)
FT                   /codon_start=1
FT                   /gene_family="HOG000094405" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774748"
FT                   /gene_name="YME2"
FT                   /locus_tag="AGL358C"
FT                   /product="Mitochondrial escape protein 2 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS54133.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059754"
FT                   /db_xref="HOGENOM:HBG397948"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018850"
FT                   /db_xref="UniParc:UPI00002532FE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751P7"
FT                   /transl_table=1
FT                   /translation="MMFLEMQRAFMLHGRRAVTRSAVGVRYISEDIQQKDAQAGEKATA
FT                   TATGVIYKSDEETLMYFDNVYPRATSLWRPTQWYNILLSNQSREAVREKIMRLASPASN
FT                   PVHGLELRSTIPIKRDGGVFATFRVPREYTRAQVNALIQANTQQESSKSLLAAFTRAAA
FT                   FPVKGVPWIEDLKRLPNNVVRVEVEGPALSEEELYSLFRRYGTILDIYPAGKNGYATIR
FT                   YRSFRGAICAKNCVSGIEINGSTLHVKFEPVVRAHAIRDFFVNHPRIAIPLLIALLSIC
FT                   AVLIFDPIREFSIEQKITRMYTLSRDNFVVKSILRLTSYTVSSVKHLWGYDDDQPEKRQ
FT                   LWQERVEKVNDLKMWLEENNNTFVVVTGPRGSGKHELVMQHTLHDRPNVLYLDCDTLIK
FT                   SRTDSKFLRNAAHQIGYFPIFPWLNSVTTLVDLAVQGLTGQKSGLSESKETQFRNMLNT
FT                   AMMSIRHIALSGYKATLHSGDDVTTVKEEDYLQQHPERKPVIVIDRFSNKAEINGFVYK
FT                   ELADWASMLVQMNIAHVIFLTESVSPNQLLAEALPNQVFKFLFLSDASKDSARSYVLSQ
FT                   LYPSSPAYSEKMPAADADANEEYRKEIDRALEPIGGRMLDLQAFVRRVKSGEEPSEALE
FT                   KMVEQASEQITQIFLSERSEPIKTAQAWELIELLSQNDVVKYGDIVFRPLFKSSPEAGL
FT                   LELEKNGLITISRNRGVLQDIRPAKPLFKAAFSYLLQDKDLSIVLRTGYYLRLIAFETG
FT                   RIKKWEEELRLLAKVSDQRICKSRLNYLASKIDASSGVINSCEDKVKEMSKRI"
     atgatgtttc tggagatgca gcgagcgttc atgctacacg ggcggcgagc agtgacgaga        60
     agtgcggtcg gcgtgcggta catctcggag gacatccagc agaaggacgc acaggcgggc       120
     gagaaggcga cggcgacggc gacgggggtt atctacaagt cggacgagga aacgctgatg       180
     tatttcgaca acgtataccc gcgggcgacg tcgttgtggc ggccgacgca gtggtacaac       240
     attctgctgt cgaaccagtc gcgggaagcg gtgagggaga agatcatgcg gctcgcaagc       300
     ccggcaagca acccggtgca cggactggag ctgcggtcga cgatcccgat caagcgggac       360
     ggcggggtgt ttgcgacgtt ccgggtgccg cgtgagtaca cgagggcgca ggtgaacgcg       420
     ttgatccagg cgaacacgca gcaggagtcg tcgaagtcgc tgctggcggc gtttacgcgg       480
     gctgcagcgt tcccggtgaa gggcgtgccg tggatcgagg acctgaagcg gctgccgaac       540
     aacgtggtgc gcgtggaggt ggagggcccg gcgctgtcgg aggaggagtt gtactcgctg       600
     ttccggcggt acggcacgat tctggacatc taccccgcgg gcaagaacgg ctatgcgacg       660
     atccgctacc gctcgttccg gggcgcgatc tgcgcgaaga actgtgtgtc ggggatcgag       720
     atcaacggct cgacgctgca tgtcaagttt gagcctgtag tccgcgcgca cgcgatccgc       780
     gacttcttcg tgaaccaccc gcgcattgcc attcccctgc tgattgccct gttatccatc       840
     tgtgctgtgc tgatcttcga ccctatccgg gagttttcca ttgagcagaa gatcacgcgc       900
     atgtacacac tgtcgcggga caacttcgtg gtgaaaagca tcctgcgcct cacctcctat       960
     acggtctcat ctgtgaagca tctctggggc tacgacgatg accagccaga gaaacgacag      1020
     ttgtggcagg agcgcgtgga gaaggtgaac gacctgaaga tgtggttaga ggaaaacaac      1080
     aacactttcg tcgtggtgac cggtcctcgc ggctctggca agcatgagct cgtgatgcag      1140
     cacactctgc atgaccgtcc taatgtgcta tatctggatt gtgatacttt gatcaagtcg      1200
     cgtactgatt ccaagttttt gaggaatgcc gcccaccaga ttggctattt cccaatattc      1260
     ccgtggttga attccgtcac gactctggtt gacctggctg ttcagggcct gaccggccag      1320
     aagtccgggc tatctgagtc aaaggaaacg caattccgga atatgctgaa cactgctatg      1380
     atgtctatta ggcacattgc tttgtccggt tataaggcga ctctgcactc tggcgatgat      1440
     gttacgactg tgaaggagga ggactacttg caacagcatc ctgagcgcaa gccggttatt      1500
     gtaatagaca ggttcagtaa caaggctgag ataaacggtt ttgtgtacaa agaactcgca      1560
     gattgggcgt ccatgcttgt tcagatgaac atcgcgcatg ttatattcct caccgagtct      1620
     gtatctccaa accagttgtt ggcagaggct cttccaaatc aagttttcaa gttcctgttt      1680
     ctctcagatg cgtcgaagga ctcagcgagg agctacgtgc tttcacagtt atacccttct      1740
     agcccagcgt attctgaaaa aatgccagca gcagatgcag atgccaatga ggagtatagg      1800
     aaggagatag accgtgcatt ggagcctatc ggcggtagaa tgttggacct acaagcgttt      1860
     gtccgcagag tgaaatcagg ggaggagccg tctgaagcat tggaaaagat ggtggagcaa      1920
     gcatcagagc agatcactca aatattctta agtgagagat cggagccgat taaaacggca      1980
     caagcttggg agctgatcga actactttca caaaatgatg tcgtgaagta tggagatatc      2040
     gttttcaggc cgttgtttaa gtcttctcca gaggccgggt tgttggagtt agagaaaaat      2100
     gggctgatca caatcagccg caatagagga gtgttgcaag atatccggcc cgctaaacca      2160
     ttgtttaaag ccgcattcag ctacctgtta caggacaagg acctgtccat cgtcctccga      2220
     acaggttact acttgcgact aatcgcgttt gaaactgggc ggatcaaaaa gtgggaggag      2280
     gaattgcgtc tattggcaaa ggttagtgac caaagaatat gcaagagtcg gttgaattac      2340
     ttagcaagca aaatagacgc cagtagtggg gtaattaaca gttgtgagga caaggtaaaa      2400
     gaaatgtcaa agcgtattta g                                                2421
//

If you have problems or comments...

PBIL Back to PBIL home page