(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE138

ASHGO_7.PE138        Location/Qualifiers
FT   CDS_pept        complement(262678..265296)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622208"
FT                   /locus_tag="AGL233C"
FT                   /orf_name="AGOS_AGL233C"
FT                   /product="AGL233Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54258.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059760"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000253379"
FT                   /db_xref="UniProtKB/TrEMBL:Q751D9"
FT                   /transl_table=1
FT                   /translation="MAESDGKIVKTRRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGLP
FT                   ECVYLSEFTHDVNSRELFSSTPNVELLRRIDELETELARMKSEMVPQLFMQKHVMGTVS
FT                   PVNRLSQFHLVIEKQGRTIFYGPTSFRAVVASVSPRFYHYFTVILTKLRHVRLSWKKDN
FT                   NYSAMMELDLIETPFMSEHEQTLLGGLLLRLPSYETTLKILEKGLNSPLSKNFPFLDSS
FT                   KIMQDFLESFQKGEEDPTTRQSPIVRLIPAGKKNYYGIGVIVMLLCILHYGHSPSKEVE
FT                   VFLKYLSTSFNGKVFYVERIEFFVLRFIYRSMFGKDGGDCIHTVLFAEEAVSTAIHMGF
FT                   HKDIKDLYKNHPVYKDRIVYLENLWHLVLFIDIEVSLSLGVPLHVSESYVSQESILDRD
FT                   TGSLYFLKKVVAKFRSILLAIHSPLCTPDIKALIEDIRQFIRHNYKPLDFYLNHQNLNG
FT                   QEYVEIESLMFFMSTMYHMGMVNLILNNDSSPANIASIVQYVLFTLKLTTVVIQRYYDL
FT                   DSVYYPERVANHETQPLWYLQLGIALMSKMSTRSIAEYYTLLFDRAISADGLTKGKYYN
FT                   NLPVSDVFDLDIHTIEVPTDHYISLSSASMELHNIFGDFLKSLGPKLLSVLNKIYPFTV
FT                   ITSLQNICHVVLQSAFDSNEETVVNTRNSPLVYETVPNFQAMPPRQRLPYQSFTLGTSL
FT                   QPNYYPHHMPFHPLQQSLQYKFPHAIQRIPPHIRQHFAQRLAQPPVTEILPQGPVHTSQ
FT                   KASYAPNSNIIRSYNPGDGYVNPSLIKDSPSVSTASQGNSSQAQNTPHSSSVCSHVPVS
FT                   STFTPCLYPMPNGDLQASRSIADEFWNNIENGLEDWITTTNSSLNQLTNVFKAADSPEE
FT                   S"
     atggcagagt ccgatggcaa gattgtgaaa accaggcgga aggtcagcaa gtcgtgcgtg        60
     ttctgccgca agcggcgcgt caagtgcaac aaggcgcggc cgaagtgctc tacatgtatt       120
     gggaagggcc tgcccgagtg tgtgtacctg tctgagttta cgcacgacgt gaactcacgg       180
     gagctgttca gctcgacgcc caatgtggag ctgctgcgac ggatcgacga gcttgagact       240
     gagctcgcgc ggatgaagag cgagatggta ccgcagctgt tcatgcagaa gcacgttatg       300
     ggcacggtgt cccccgtgaa cagactttcg cagttccatc ttgtgataga gaagcagggc       360
     cgcacgatct tctacgggcc gacttcattt cgagcggtcg tcgcttctgt gagtccgcgg       420
     ttctaccatt attttactgt aatcctgacg aagttgcggc atgtgcgtct gtcttggaag       480
     aaagataata actactctgc gatgatggag ctagatttga tagagacacc tttcatgagc       540
     gaacatgaac agacactact gggggggctt ctgctgcgtc ttccgagcta tgaaacgacg       600
     ctcaaaatat tggaaaaggg gcttaattcc ccgttgtcta agaacttccc atttctggat       660
     agcagcaaga tcatgcaaga tttcctggaa agctttcaga agggcgagga agacccaaca       720
     accagacagt cgcctatcgt gcgcttaata ccggccggaa aaaaaaacta ctatgggatt       780
     ggtgttatcg tgatgttact gtgtattctt cactatggcc actctccatc gaaggaagtc       840
     gaggtattcc tgaagtatct gtcaacctca tttaatggca aggtattcta tgtcgaaagg       900
     atagaatttt ttgtgctacg tttcatatac cggagtatgt ttggtaagga tggtggggac       960
     tgtatccata ctgttttatt tgctgaggag gcagttagca cggccattca catgggcttc      1020
     cataaagaca tcaaggatct atacaagaat catcccgtat acaaggacag gatcgtctat      1080
     ctagaaaact tgtggcactt ggtgctcttt atagacattg aagtttcact ttcgctgggg      1140
     gtcccattac acgtctccga gtcctatgtt tctcaagaat ctatattgga tcgtgacaca      1200
     ggtagcttat atttcctgaa gaaagtggtc gccaaatttc gatctattct tctcgcaatc      1260
     cattcgccgc tgtgtacgcc agatatcaaa gctctcattg aagatatacg tcaatttatc      1320
     aggcataatt ataagccgct ggacttttac ttgaaccacc aaaatctaaa tggccaagag      1380
     tatgtggaaa ttgaatccct tatgtttttc atgtccacaa tgtatcatat gggaatggtt      1440
     aatctcatac tgaataatga ttcctcgcct gcaaacattg cgagtatagt acagtatgtt      1500
     cttttcacgc taaaactgac gacggtagtg atacaacgct attatgacct tgattctgtg      1560
     tactatccgg agagagttgc aaatcatgag acacagccgc tatggtattt acagcttggc      1620
     atagccctca tgagcaaaat gtctacgaga tccattgcgg aatattatac cttgttattc      1680
     gatcgtgcta tatccgcaga tgggcttact aaaggaaagt actataataa cctccccgtt      1740
     tcggatgtat ttgatctaga tatacataca attgaggttc ccaccgatca ttacatcagc      1800
     ctatcatctg catccatgga actccacaat atatttggcg acttcttaaa gagtctcggt      1860
     ccgaagctat tgtccgtgct taacaagata taccctttca ctgtaataac atcgttacaa      1920
     aatatttgcc atgtcgtact ccaaagtgcg tttgatagta atgaagaaac ggtagtcaat      1980
     acgaggaact cgcctctggt atatgaaaca gtaccaaact ttcaggctat gcccccaaga      2040
     caaaggttgc cttaccagtc ctttacattg ggcacctcac tacagccaaa ttattaccca      2100
     catcatatgc cttttcaccc gctacagcaa tcacttcaat ataagtttcc gcacgcaata      2160
     caacggatac cgccccatat aaggcagcac tttgctcaac gcttagctca gccgccggtt      2220
     actgagatac tgccacaagg gcccgtgcat acaagccaga aggcttcata cgctccgaac      2280
     tccaacatta tcagatcata caatccgggt gacggttatg ttaatccatc tctaattaaa      2340
     gatagcccat cagtttcaac agcatcccaa gggaactcat cacaagcaca gaatactcct      2400
     cattcgtcat ctgtttgttc acatgttcca gtaagcagta ctttcactcc ctgtctgtat      2460
     ccaatgccca atggcgattt gcaggcctca agatcaattg cagatgaatt ttggaataat      2520
     atagagaatg gcctcgagga ttggataacc acaacgaata gctccctaaa tcaacttaca      2580
     aatgttttta aagctgctga ttcaccagag gaaagttaa                             2619
//

If you have problems or comments...

PBIL Back to PBIL home page