(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE145

ASHGO_7.PE145        Location/Qualifiers
FT   CDS_pept        complement(273788..277864)
FT                   /codon_start=1
FT                   /gene_family="HOG000057136" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079007"
FT                   /gene_name="SRB8"
FT                   /gene_synonym="MED12"
FT                   /locus_tag="AGL226C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 12"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS54265.2"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG059763"
FT                   /db_xref="HOGENOM:HBG204064"
FT                   /db_xref="InterPro:IPR019035"
FT                   /db_xref="UniParc:UPI0001DB2B38"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751D2"
FT                   /transl_table=1
FT                   /translation="MSSSRYILIPPEDLHPLTSNTGNEQNIYPDFDPWAHTEIEDKILL
FT                   SFVAKGHYTSAKVNFESISARSSLQESLPKVAGMLAEQFSKVVHLREQTINKVSGESEE
FT                   SIRGKAKFTDLAGPGFSLPNRVTLTDQRRTQWLQELSSPNVSLSKLAKSIPHGFKRKQI
FT                   LEQCYMRQLPLQRAIWLIKSSYSIEWKSLTSKLKPGQTNEGVVSQLYNLWTNSMVSIME
FT                   RLLFEMPKYYNDTAQAKIWKPRVSYYINLLGNCYNMGLMDRGVFNHWLVEFVEKVENFE
FT                   FLPLSLHLLNIFWSGICPPTHGIEAPDNSFLISKITVVLLHKHHMILQNKSMINDENYI
FT                   INDLQRNARLKESLLLRLKAFILDIFHHQSLEAFIMPNQNWDLYKNCLYEIVTMDKTSN
FT                   EQAMVIKRKLELITYRNDSLQFNLLKQYKMKSSSLYESDGVEIDNLCDMQSILNVPFLD
FT                   PEMTKILDNATPGYDWTLFVQQRFTCIEKVAQMIMWATNPSRKARYDGAHLVAKLLLLK
FT                   TTSQENLPDYNMEDMIWKLVFHFSKLSERELSNIVELPSLYELLNIFIGYGIIKVPTYI
FT                   RKLISSGIMYISDSKDKFFHCELLINLKISPLMKNQYNMMLKNIMEYDATYYVRYNYEQ
FT                   LQIQLNTAKEQMLQEQFEHISCLPISVKIWVSEWYLSYVCSPVDNVLKPVDKGTVIKNF
FT                   TIFGLYLKEIFHFYKWVEFIVYHQLLADINALSALIDVLLYYENLFPLLINDQILFMKT
FT                   LIHIYSKGLKNKDNLSYNITEFNPFWKFFMKHFPYLVEIDSDLQLQLGEVYESEKIRIE
FT                   KLTKSSVDVITLYCNINQVNEESFKFGTHNFPGIFQQNLKILLKTESADACERARKGLS
FT                   LLMLANLGDYTKFMSIFLKRKDYTIEQLVKLISVKLLTLDQIQKIIGDDILREILSRNN
FT                   YGEGLWYELHKRNFIKKNFKIVLSMYRNSTSLDDRKLFLDLLVFYGPNSRLQEQVTTII
FT                   CNCLRESNEDYSLILSLLRYGTKNIDQGTQETINIAKLYENLNFTNLWIFQAFTNYYTE
FT                   ALFNGATSDGQTITNFVFELIDLTRYNVLCSHLFDRVANFDVLEKLLEVFEADFFKKCL
FT                   SEDPDDVHFLAVMIETIMNLSRKMNQSSAVISMNNESFRLLQATMLKFTSMNKTALCNS
FT                   EMKLSIYLKIFIVHQKFIFQKVCDSLRQDRYDAEADLVKSLRLLFENTGFKLKLRLLLY
FT                   DILSSLKSFVIYECTKKSESKRETRKLQISEALQNLPPFHISSFLDDMSISAHGDFDFL
FT                   GLTEQPTPAEPEEGSQFFLYNKRTREYECGLNIEPFQLLPNHQSREPGSSCHFFNDTAL
FT                   SLSLFDARFDKKNPT"
     atgtcatcca gtagatatat tttgatcccg cctgaggatt tgcatccgtt gacgtccaac        60
     acaggtaatg aacagaatat ctaccccgat tttgatccat gggcacacac agagatcgag       120
     gacaagatcc ttcttagctt tgttgccaag ggacactata caagtgcgaa ggtcaatttt       180
     gaaagcatct cggcgcgttc atcgctgcag gaatcgctgc cgaaggttgc tggaatgctg       240
     gccgagcaat tctcgaaggt tgtgcatcta cgtgagcaaa cgataaataa agtctccgga       300
     gaaagtgaag agagcataag gggcaaggcg aagtttacag atttagctgg gcccgggttt       360
     tcgctgccca acagggtgac attgacggac cagcggcgga cccaatggtt gcaagagctg       420
     agctccccta atgtgtctct gtcaaagcta gcaaagtcta taccgcatgg gttcaagagg       480
     aagcagatct tggaacagtg ttacatgcgg cagctcccgt tgcagcgcgc tatttggctc       540
     atcaaaagta gttattcgat agagtggaaa tcgctgacga gcaaattgaa gccaggccag       600
     accaacgagg gagtcgttag ccagctatac aacctgtgga caaatagcat ggtaagcata       660
     atggaacggt tgcttttcga gatgccaaag tactacaatg ataccgcgca ggcaaaaata       720
     tggaaacctc gggtctctta ctatatcaat cttctcggca attgctacaa tatgggcctg       780
     atggatagag gcgtattcaa ccactggctg gtcgaattcg tggaaaaggt ggaaaatttc       840
     gaatttttgc cgttgtccct tcatttacta aatatattct ggtctggcat ctgccctccg       900
     acacatggaa ttgaagcacc agataactcg tttctgatat caaagataac agttgtactt       960
     ttgcacaaac atcatatgat tttgcaaaat aaatcaatga ttaatgatga gaattatatt      1020
     ataaatgact tgcaacgcaa tgctcgattg aaggagagtc ttttacttcg tttgaaggcc      1080
     tttattctgg acatctttca ccatcagtca ctggaggctt ttataatgcc taatcagaac      1140
     tgggatcttt acaagaattg tttatatgag attgtaacta tggacaaaac cagcaacgaa      1200
     caggcgatgg tgattaaaag aaaactggag ttaattacat ataggaatga ttcattacag      1260
     ttcaatttgc tcaagcaata caaaatgaaa tcatcctcct tatatgaatc cgacggcgtg      1320
     gaaattgata atctttgtga catgcagagt atcctaaatg taccgttcct ggatccggaa      1380
     atgactaaaa tattggataa cgccactcct ggttatgatt ggactctctt tgttcagcaa      1440
     cggtttacgt gtattgagaa ggtcgctcaa atgataatgt gggccactaa cccctcgagg      1500
     aaagcacgtt atgatggtgc acacctggtg gccaaactgc tacttctgaa aaccacatcg      1560
     caggaaaatc tacctgacta caacatggag gatatgatat ggaagctagt gttccatttt      1620
     tcaaagttga gtgagagaga actcagcaac atcgttgagc tacctagcct ttacgagctg      1680
     ttgaatatct tcattggcta cggtattatt aaggtaccta cctacattcg aaagctgata      1740
     agttctggta taatgtatat ttcagattcc aaggataagt tcttccattg tgagctactg      1800
     attaacctaa agatttcgcc attaatgaaa aaccaataca atatgatgct caaaaatatc      1860
     atggaatatg atgccactta ctatgtgaga tataactacg agcaattaca gatacagttg      1920
     aatacagcga aggagcagat gcttcaggaa caatttgaac atatttcttg tcttcctata      1980
     agtgttaaga tatgggtttc cgagtggtat ctcagctacg tctgctcacc ggttgacaat      2040
     gtgctaaaac ctgtagataa gggcactgtc ataaagaact ttaccatatt tgggctgtac      2100
     ctgaaagaaa tattccattt ctacaagtgg gttgaattta ttgtctatca ccaacttttg      2160
     gcagatatca acgcactttc tgcactgatt gatgttctat tatattacga gaaccttttc      2220
     cctctactta ttaatgatca aattttgttc atgaagactc tcatccacat atattcaaag      2280
     ggccttaaga acaaagataa cttatcctat aacattacgg aattcaatcc cttctggaag      2340
     tttttcatga agcatttccc ctaccttgtt gaaatagatt ctgacttaca gttacagctg      2400
     ggagaagttt atgaatcgga gaaaatacgc attgaaaaat tgacaaaatc aagcgtagat      2460
     gttattactc tctattgtaa tattaaccaa gtaaacgagg aaagcttcaa gtttggaact      2520
     cataacttcc caggtatttt ccaacaaaat ttgaaaatct tgttgaaaac tgagagtgct      2580
     gatgcctgcg aaagggcgag aaaaggttta tccttactaa tgcttgccaa tttgggtgac      2640
     tatacaaagt tcatgtccat ttttttgaaa aggaaggatt acacaattga gcagctggtc      2700
     aaactcatat cagtgaaact attgactttg gaccaaattc aaaagatcat tggtgatgac      2760
     attttgcggg agatattaag cagaaacaat tatggagagg gactatggta tgaattacac      2820
     aagcgtaact ttattaagaa aaatttcaaa attgtacttt cgatgtaccg caattctacc      2880
     tccctcgatg atcgaaaatt gttcttagat ttgttagttt tctacggccc taattcccgg      2940
     ctacaggaac aagttaccac tatcatctgc aattgtctta gggagtctaa cgaggattat      3000
     tcattaatat tatccctcct gaggtatggg actaaaaaca tagaccaggg gacccaagaa      3060
     actataaaca ttgctaaact atatgagaac ctgaacttca cgaatctctg gattttccaa      3120
     gcctttacga attattatac ggaggcccta tttaatggcg cgacgagtga cggacagacg      3180
     ataacgaact ttgtcttcga gctgattgac ctgacccggt acaatgtatt atgctcccac      3240
     ttatttgata gggtagcgaa tttcgatgta ttggagaagt tattggaagt gttcgaagcc      3300
     gatttcttta agaaatgtct atctgaggat ccagacgatg ttcacttctt agcagtaatg      3360
     attgagacta ttatgaatct ctctcgtaaa atgaaccaga gcagtgcggt gatatcgatg      3420
     aataatgaat ccttccggct cctccaggca acaatgttga aattcacaag catgaacaaa      3480
     accgcgctct gcaattcaga gatgaagttg agcatttatc tgaaaatatt tattgtgcat      3540
     cagaaattca tctttcaaaa ggtatgcgac tcgcttcggc aggatagata tgatgccgaa      3600
     gcagatctgg tgaaatcttt gcgactactt tttgaaaata cggggttcaa actgaaactt      3660
     cgtctgctac tttatgatat tctgtcctca ctaaagtcct ttgttatcta tgaatgcacc      3720
     aagaaaagtg aatcgaagcg ggaaactcgg aaactacaga tctcggaagc attacagaat      3780
     cttcctccct tccatatttc gtcttttctg gatgatatgt ctatctctgc acatggtgac      3840
     tttgattttc taggcctgac cgagcaaccc actcccgcgg aaccagagga aggtagccag      3900
     tttttcttat acaataagag aactagagaa tacgaatgtg ggttgaatat cgaacccttc      3960
     caactgcttc cgaatcatca gagcagggag cccgggtcga gctgtcattt tttcaacgat      4020
     accgcgctca gcctcagttt gtttgatgcc cggtttgaca agaaaaatcc cacgtaa         4077
//

If you have problems or comments...

PBIL Back to PBIL home page