(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE165

ASHGO_7.PE165        Location/Qualifiers
FT   CDS_pept        complement(314110..316317)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750130"
FT                   /locus_tag="AGOS_AGL206C"
FT                   /product="AGL206Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54285.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059776"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001DB2B53"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Z3"
FT                   /transl_table=1
FT                   /translation="MVVVRYRMRRSRDDALSTEDPALMAWSNGRGVNDDSRVLKKTEKR
FT                   SRNGCLTCRARRKKCDETRPKCIGCQRNLLLCHWADDDGNYDGHSPNKEEVGIKSNDGF
FT                   LNCTLENWEAEYEVGKSYRFFSVPAEQLKFEYTVALGRDNSIWRLHRNHGSKQRLQKFP
FT                   THGQLDKSGVTPRSAPVKLHKYPVGTKKSARRSISAAILLQDSKNDLLPSDASYAVQRD
FT                   DLLDLKSLFDLQMEPYQQIGEPQLWGCFLYSGTPLETIQPNYSYLLYDHNSNSVYYKEV
FT                   LESFRHGDLSHANSIKEDDGFLFYVCYKEFIPLLDPRDSTYRLVTHTSSVIQQAENNPV
FT                   IKELILSCGASFLQYYSYDTFAPLSDRYYNTAIIFLSNFLGTQAVSGNEVWLMAAFQLM
FT                   ALKNKWCLQNNVNDVLECLTNSYLLLKNCYFGQFGDSISELFLSHPPLAACNSGLTGNL
FT                   GVRSALERPAIPSSCEGGEVSQLRENPLILLPQERTFLEAFIHCYSVCIMFATDQTQIP
FT                   DPFHIFKELNPLFKCPVRHNTEDWVSGASYGYTLEAFEILAKVSYISRYPMPITDPVIL
FT                   QKCQNLQKMARYYSNNLFSTDGPQAYDTYQLYALSFLSGLILARSSYLLITTVLEYSVI
FT                   QPHSPKLQETLGEIMNYFEAIPLDANIWGALTWPLLVCGVYCCTPDDQTHIRFYLGFLG
FT                   KRFALPTTGSIISYLESVWRLPMEQRIPQLFNRAELCKISL"
     atggtggttg tacggtaccg catgcggcgg tccagggacg acgctttgtc taccgaagac        60
     cctgcgctga tggcttggtc caacggcagg ggcgtcaacg acgatagcag ggtgctaaag       120
     aaaacggaga agcgatcccg caatggatgt ttaacgtgcc gtgcgcgccg gaagaagtgt       180
     gatgagacac ggccgaagtg tattggctgc cagcgcaacc tgctgctgtg ccactgggcg       240
     gacgacgacg gaaactacga cggtcattcg cccaacaagg aggaagtggg catcaaatcg       300
     aacgatgggt tcctgaactg cacgctagag aactgggagg cggaatacga agtcgggaag       360
     tcatatcgct tcttttcggt gcctgccgaa cagttgaagt tcgagtacac tgttgctctc       420
     ggacgcgata acagcatctg gaggctgcat cgcaatcacg gttcaaagca gcgcttgcaa       480
     aagttcccaa cgcatggcca gttggataag agtggggtaa cgccacgttc tgcgccagtg       540
     aagcttcaca agtatccagt tggaacaaaa aagagtgctc gccggagcat atctgctgca       600
     atcttattac aagactcaaa gaacgaccta ctgccctcgg acgctagtta tgccgtacag       660
     cgagatgacc tcttggattt gaaatcactg ttcgacttgc aaatggaacc atatcagcag       720
     ataggtgagc cgcagttatg gggatgcttt ctatattcag gcactccctt agagactatt       780
     caaccgaatt atagctacct gttatatgac cataattcta attctgttta ctacaaggag       840
     gtgctggaga gttttagaca tggtgattta tcgcatgcca acagtatcaa ggaagatgac       900
     ggttttcttt tctacgtctg ctacaaagag tttattcctc tccttgaccc gcgggactcc       960
     acttatcgcc tggtgacaca cacttcctcc gttatccaac aggctgaaaa caatcctgtc      1020
     ataaaggagt tgatcctaag ctgcggtgca tcttttctgc agtattattc atacgatacc      1080
     tttgcgcctc tgagcgacag gtactataat actgccataa tatttctatc gaactttcta      1140
     gggactcaag cagtcagcgg caacgaagtg tggcttatgg cagcatttca gttgatggca      1200
     ctcaagaaca agtggtgtct gcagaacaac gtcaacgatg tgcttgagtg ccttacaaac      1260
     tcctatcttc tgctcaaaaa ttgttatttt ggacagtttg gtgactccat cagcgagctc      1320
     ttcttgtcac atccaccgct tgctgcatgc aactctggtc tcaccggaaa tttgggggtt      1380
     cgcagtgctc tggaacgtcc tgccattcct agctcatgcg aaggcggcga ggtttcacag      1440
     ttgcgggaaa acccgttaat acttcttcct caggaaagaa catttttgga ggctttcata      1500
     cattgttaca gtgtttgcat aatgtttgct accgatcaaa cacagatacc ggaccctttt      1560
     cacattttta aagagttgaa tccactcttt aaatgcccag ttcgtcataa taccgaggat      1620
     tgggtttcgg gcgcttcgta tgggtataca ttggaggcct ttgagatcct cgctaaagta      1680
     tcctacatct cgcgttatcc gatgcccata acagatcctg tcattttaca gaagtgccag      1740
     aacctccaaa agatggcccg ctactatagc aataacctat tctccacaga tggaccccaa      1800
     gcgtatgaca cataccagtt gtacgcgctt tcattcctat cgggcctgat tcttgcacgt      1860
     tcaagttacc tgctcatcac cacggtgctc gagtactcag tcatccagcc gcactcacca      1920
     aagttgcagg agacgctcgg tgaaatcatg aattacttcg aggccattcc tttggatgca      1980
     aacatttggg gtgcactcac ctggcccttg ctggtttgcg gtgtctattg ctgcactcca      2040
     gatgaccaga ctcatatccg gttctatctc gggtttcttg gcaagcgatt tgcgctgcca      2100
     acgaccggat caataatcag ctacttggaa agcgtctggc gtcttccaat ggagcaacgt      2160
     atcccacagt tatttaacag ggccgagttg tgcaagatat ctctctga                   2208
//

If you have problems or comments...

PBIL Back to PBIL home page