(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE169

ASHGO_7.PE169        Location/Qualifiers
FT   CDS_pept        321438..322112
FT                   /codon_start=1
FT                   /gene_family="HOG000182099" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750133"
FT                   /gene_name="ALG14"
FT                   /locus_tag="AGL202W"
FT                   /product="UDP-N-acetylglucosamine transferase subunit ALG14"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54289.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG193935"
FT                   /db_xref="HOGENOM:HBG735599"
FT                   /db_xref="InterPro:IPR013969"
FT                   /db_xref="UniParc:UPI0000253398"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750Y9"
FT                   /transl_table=1
FT                   /translation="MAWLAIVCLLAATTALCVRMAALAPGVYGPAVCGGRSGGGRGPPR
FT                   HVMIFLGSGGHTGEMLRLLEVYGAALVAGATVRVGYTDEASAERGRQSAALRAARGVEY
FT                   VPLLKAREVGAGAGAAVRSTVRAAAQAFSAVRRARRALHTGPHVVVLNGPGTSVVVLFW
FT                   LRVLDLLSLRRTRVVYVESLARTESLSLSGRLAYPFADEFVVQWPDLAQRYRRARWFGA
FT                   LV"
     atggcttggt tggcgattgt atgcctgcta gcagctacga cggcgctgtg cgtgcgcatg        60
     gcagcgctgg cgccgggggt ctacggcccc gcggtatgcg gcgggcgcag cggcggcggg       120
     cgcggcccgc cgcgtcacgt gatgatcttc ttggggtcgg gcgggcacac gggggagatg       180
     ctgcggctgc tagaggtata cggcgcggcg ctggtggcgg gggcgacggt gcgggtgggg       240
     tacacggacg aggcgagcgc ggagcgcggg cggcagagcg cggcactgcg ggcggcacgc       300
     ggcgtggagt acgtgccgct gctgaaggcg cgggaggtgg gcgccggcgc gggcgcggcc       360
     gtgcgcagca cggtgcgcgc ggcggcgcag gcgtttagcg cggtgcggcg cgcacggcgc       420
     gcactgcaca cgggaccgca cgtggtggtg ctgaacggcc cgggcacgag cgtggtggtg       480
     ctgttctggc tgcgcgtgct ggacctgctg tcgctgcggc gtacgcgggt ggtgtacgtg       540
     gaatcgctgg cgcgcacgga gtcgctgagt ctgtccgggc ggctggcgta cccgtttgcg       600
     gacgaatttg tagttcagtg gccggacctg gcgcagcggt accgccgcgc acgctggttc       660
     ggggctctag tgtag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page