(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE177

ASHGO_7.PE177        Location/Qualifiers
FT   CDS_pept        join(complement(336733..336735),complement(335917..336681))
FT                   /codon_start=1
FT                   /gene_family="HOG000112177" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750137"
FT                   /gene_name="DCN1"
FT                   /locus_tag="AGL194C"
FT                   /product="Defective in cullin neddylation protein 1 "
FT                   /protein_id="AAS54297.2"
FT                   /db_xref="HOGENOM:HBG202460"
FT                   /db_xref="HOGENOM:HBG206132"
FT                   /db_xref="InterPro:IPR005176"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014764"
FT                   /db_xref="UniParc:UPI0001DB2B57"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750Y3"
FT                   /transl_table=1
FT                   /translation="MSNARQRELIREFLAVTSATSAAAETYLERNHWSLDHALDDFYTQ
FT                   SGGGGRAEQYSAELVATFERYAAGGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEE
FT                   LTADISRFQFLSTWHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGG
FT                   RRLSVETAIAYWSLFFLDHTYAVTVPAPRLRSWFEFLRAGDHSVSRDTWDMFPRFAQRF
FT                   PDDTELLEHYNELASWPLVIDEYYEWVKGRNQL"
     atgagcaatg cacgccaaag agaactgatc agggagttcc tggcggtgac cagcgcgacg        60
     agcgcggccg cagagacata cctcgagcgc aaccattggt cgctggacca cgcactggac       120
     gacttctaca cgcagagcgg gggcggcggg cgcgcggagc agtacagcgc ggagctggtg       180
     gccacttttg agcgctacgc tgcgggcggc gcgatggaca cggaggcgct ggtgcgctac       240
     gtgggcgatc tggggttcca actcgaggac gtcgcgacac tgtgcctggc gcgcctgctg       300
     aaggtcgagg agcttacggc ggacatctcg cgcttccagt tcctgtcgac gtggcacgga       360
     ctgggctgca gctcgctgcc ggacatgcgc gcggctgtgg acgcgctaga gctgcgcttg       420
     cgcaccgacg cagcctactt ccgcgcgctg tacgcctaca ccttcggcct cgggctggac       480
     gccggcggcc gtcgtctgtc cgtggagacc gcgattgcgt actggtcgct gttcttcctg       540
     gaccacacct atgccgtcac tgtacccgcc ccgcgcctgc gctcctggtt cgagttcctg       600
     cgcgcgggcg accacagcgt tagccgcgat acctgggaca tgtttccgcg cttcgcgcag       660
     cgcttcccgg acgacacaga gctcctggaa cactacaacg aactggcgtc ctggcctctg       720
     gtaatcgacg agtactacga gtgggtcaag ggccgcaacc agctgtaa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page