(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE183

ASHGO_7.PE183        Location/Qualifiers
FT   CDS_pept        345838..346545
FT                   /codon_start=1
FT                   /gene_family="HOG000260139" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622486"
FT                   /locus_tag="AGL188W"
FT                   /product="Acyl-protein thioesterase 1 "
FT                   /EC_number="3.1.2.-"
FT                   /function="carboxylesterase activity"
FT                   /biological_process="fatty acid metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54303.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006631"
FT                   /db_xref="HOGENOM:HBG398734"
FT                   /db_xref="HOGENOM:HBG651281"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="UniParc:UPI00002533A6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750X7"
FT                   /transl_table=1
FT                   /translation="MSATAPIRIAARAQPAKYAFIIFHGLGDSGAGWTFLAEYLQRDPA
FT                   LASAQFVFPTAPVRPITANNFAPATAWLDVRSWLSHESVDLEGFNESMKLVPKLIEEQV
FT                   AQGIPYERIWIGGFSQGAALTMGTALSFPHRLGGFLSFSGPPSYRWLEHTVSDANTGAP
FT                   VFQSHGTMDEVFPSSGAEAVHRSFTSQYGFKNHRLKIYDGLGHSISPQLLDDALAFIKA
FT                   NLDAEKPAPRPAL"
     atgtctgcaa ctgctcctat cagaatcgcg gctcgtgcgc agcccgccaa gtacgcgttc        60
     atcatcttcc atggcctcgg cgacagcggt gccggctgga cgttcctggc cgagtacctg       120
     cagcgcgacc cggcactcgc aagcgcgcag ttcgtgttcc cgacagcgcc ggtgcgcccg       180
     atcacggcga acaacttcgc gcccgccacg gcgtggctgg acgtgcgctc gtggctctcg       240
     cacgagtccg tggacctcga gggcttcaac gagtccatga aactcgtccc gaagctcatc       300
     gaggagcagg tcgcgcaggg cattccctac gagcgcatct ggatcggcgg cttctcgcag       360
     ggcgctgcgt tgacgatggg caccgcgctg agcttcccgc accgcctcgg cggcttcctg       420
     tcgttctccg gcccgcccag ctaccgctgg ctcgagcata ccgtgtccga cgccaacacg       480
     ggggcgcccg tcttccaatc gcatggcacc atggacgagg tcttcccttc cagcggtgcg       540
     gaagctgttc accggagctt cacctcccag tacggcttta aaaaccaccg cctgaagatt       600
     tacgacggct tagggcactc gatctcgccc cagctgctgg acgatgcgct ggcttttatc       660
     aaggccaacc tcgacgccga gaagccggcc ccgcggcccg ccctgtga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page