(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE194

ASHGO_7.PE194        Location/Qualifiers
FT   CDS_pept        complement(368220..368708)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079278"
FT                   /locus_tag="AGL177C"
FT                   /orf_name="AGOS_AGL177C"
FT                   /product="AGL177Cp"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="AAS54314.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG524497"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="HSSP:1A58"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI00002533B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W6"
FT                   /transl_table=1
FT                   /translation="MSKVFFDVEADGQPLGRIVFQLYNDVTPKTAENFRALCTGEKGFG
FT                   YAGCPFHRVIPDFMLQGGDFTHGTGVGGKSIYGGKFPDENFVKKHEKPGLLSMANAGPN
FT                   TNGSQFFITTVPCPWLNGKHVVFGEVSEGMDVVKKVESMGSSSGATRARIVISKSGEL"
     atgtctaagg tgtttttcga tgtggaggcc gatggccagc cattgggcag aattgtgttc        60
     cagttgtaca acgacgtgac tccaaagact gcggagaact tcagagcgct atgcactggc       120
     gagaagggtt tcgggtacgc tggctgccca ttccacagag tcatccctga cttcatgttg       180
     cagggcggtg acttcactca cgggaccggc gtgggcggca agtcgatcta cggcggcaag       240
     ttcccagacg agaacttcgt caagaagcac gagaagccag gtttgttgtc gatggccaac       300
     gcgggcccca acaccaacgg ctcccagttc ttcatcacga ctgtgccatg tccatggttg       360
     aacggtaagc acgttgtgtt cggcgaggtg agcgagggta tggacgttgt caagaaggtg       420
     gagtccatgg ggtcctcttc tggcgcgacc cgtgctagaa tcgtgatctc caagtcgggt       480
     gaattgtaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page