(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE196

ASHGO_7.PE196        Location/Qualifiers
FT   CDS_pept        369511..370725
FT                   /codon_start=1
FT                   /gene_family="HOG000013358" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750147"
FT                   /locus_tag="AGL175W"
FT                   /orf_name="AGOS_AGL175W"
FT                   /product="AGL175Wp"
FT                   /function="NAD+ or NADH binding"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="aspartate-semialdehyde dehydrogenase activity "
FT                   /function="protein dimerization activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54316.1"
FT                   /db_xref="GO:0004073"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG000063"
FT                   /db_xref="HOGENOM:HBG518238"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00002533B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W4"
FT                   /transl_table=1
FT                   /translation="MQDESEAGGRALARRRGSCGGQKKSPSTISASSSRPEDKMAGKKI
FT                   AGVLGATGSVGQRFILLLADHPDFELKVLGASPRSAGKRYADAVNWKQTELMPAFAEDI
FT                   VVSECKAEAFCGCDVVFSGLDADYAGPIEREFADAGLAVVSNAKNHRREDDVPLVVPIA
FT                   NSEHLEMVQQKLESAAAEGRARPGFIVCISNCSTAGLVAPLKPLVDAFGPIDALSVTTM
FT                   QAISGAGFSPGVPGIDILDNVIPYIGGEEDKIEWEAKKILAPLNASKTSVELLSDEELR
FT                   VSAQCNRVAVSDGHTECVSLRFRNRPAPSVEAVKKCLREYVCEATHLGCHSAPKQAIHV
FT                   LEQQDRPQPRLDRLRDAGYGVSVGRVREDPVLDLKMVVLSHNTIIGAAGAGILIAELLL
FT                   AQQMI"
     atgcaagacg aatctgaggc cggcggacgc gcgctggcgc ggcgccgcgg tagctgcgga        60
     gggcagaaaa aatcgccgtc gacaatctct gcgtcatcat cccggccaga ggacaagatg       120
     gctggcaaga agattgcggg tgtgctaggc gcgacgggct ccgtggggca gcggtttatc       180
     ctgctgttgg cggaccaccc tgactttgag ctgaaggtgc ttggggcatc gccgcgatcc       240
     gctggcaagc ggtatgcgga cgcggtgaat tggaagcaga ccgagctgat gccggcgttt       300
     gccgaggaca tcgtggtgag cgagtgcaag gctgaggcat tttgcggctg cgacgttgtg       360
     ttctctgggc tcgatgcgga ctacgcaggc cccatcgagc gggaatttgc ggacgccgga       420
     ctggctgttg tctcgaacgc caagaatcac cgccgggagg atgacgtgcc gcttgtggtc       480
     ccaatcgcca actctgagca cctggagatg gtgcagcaga agctggaatc tgctgcagcg       540
     gaaggccggg cccggccggg tttcattgtg tgtatttcca actgttccac cgcaggcttg       600
     gttgctcctc tgaagccgct cgtggacgcg tttggcccca tcgatgcgct ctctgtgacc       660
     acgatgcagg ccatttctgg cgccggcttc tcgccaggcg tgcccgggat tgacatcctg       720
     gacaacgtta tcccgtacat tggcggagag gaggacaaga tagagtggga ggcgaagaag       780
     atactggcac ctctgaacgc gagcaagact tctgtggaac tactctccga tgaggagctt       840
     cgcgtatctg cgcagtgcaa ccgtgttgcg gtctcggacg gccacaccga atgcgtctcg       900
     ctgcgtttcc gcaaccgccc tgcgccctct gtcgaggcgg tgaagaagtg tctgcgcgag       960
     tacgtctgcg aggccaccca cttgggttgc cactcggcgc caaagcaggc tatccacgtt      1020
     ttggagcagc aagacaggcc acagccccgg ctagacagac tcagagatgc cggctacggt      1080
     gtttccgtcg gcagggtccg cgaggaccct gtgctcgacc tcaagatggt cgtgctctcg      1140
     cacaacacta ttatcggcgc tgccggcgca ggtattttaa ttgcagagct cctgctggct      1200
     cagcagatga tttag                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page