(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE228

ASHGO_7.PE228        Location/Qualifiers
FT   CDS_pept        complement(432968..433987)
FT                   /codon_start=1
FT                   /gene_family="HOG000065947" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750156"
FT                   /locus_tag="AGOS_AGL144C"
FT                   /product="AGL144Cp"
FT                   /function="inositol trisphosphate 3-kinase activity "
FT                   /protein_id="AAS54347.2"
FT                   /db_xref="GO:0008440"
FT                   /db_xref="HOGENOM:HBG059811"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="UniParc:UPI0001DB2BA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q750T3"
FT                   /transl_table=1
FT                   /translation="MGHKKLRHQAAGHDGTLTDIDERLIFKPAVDQELEFYTGIISRKD
FT                   REGVDFPLECWMCVFVGTLSEGILNVENNDSIMRLKGEDVVKPTTDYLQHLNLSNDHTQ
FT                   KYLVLENLTYGYRRPNILDIKLGKVLYDDKATEEKKARLTTISASTTSGSLGFRVCGMK
FT                   IERNSLIGQLDKSHYEEDDDDYVLLNKLYGRSRTVDNVSDAFRLFFNAPNLPKHRHAEL
FT                   INRFAVRLRMFYNTLLDEEVRMISSSLLFVYEGDPERWDMENAVDGVLNEPCFLDGDSD
FT                   CSSEEWDKSRNIPLSSMTLIDFAHSKFTPGEGYDENVIVGVENLMEVFDKVSGEYGEQ"
     atggggcaca aaaagttgcg gcaccaagct gcaggacatg atggcacgct gaccgacatc        60
     gacgaaagac taatctttaa accggcggtc gatcaggagt tggagtttta tacgggcata       120
     atatctagga aagataggga gggtgttgac tttcccttgg agtgttggat gtgtgtgttc       180
     gttgggactt tgagcgaagg catacttaat gtggagaaca atgacagcat aatgaggttg       240
     aagggggaag atgtggtgaa acctacgaca gactacttgc agcacttgaa tctgtccaat       300
     gaccacacac agaagtacct ggtcttggag aaccttacat atggttatag gcgtcccaac       360
     atactcgata ttaaacttgg caaggttcta tacgatgata aagctactga ggaaaaaaaa       420
     gccaggctaa caaccatcag tgcctcgaca acttcgggct cattgggttt tagggtatgc       480
     gggatgaaaa tagagagaaa cagtctcatc ggccagctgg acaagtctca ttatgaggag       540
     gacgacgatg attatgtgct tcttaataaa ctgtacggcc gttctcggac ggttgataat       600
     gtttcagatg cgtttcgact attcttcaat gcccctaatc ttccgaagca tagacatgca       660
     gagctaatta ataggtttgc agttcgactg cgaatgtttt ataatacact tctagatgag       720
     gaagtacgga tgatctcgag tagtttacta tttgtttatg aaggtgatcc agaacgctgg       780
     gatatggaga atgcggttga cggcgtgcta aatgagccat gctttctcga cggtgatagt       840
     gattgcagtt ctgaagaatg ggataaatca cgtaacattc ccctaagttc tatgacgttg       900
     atagacttcg ctcattcgaa gtttacaccg ggagaaggct acgacgaaaa tgtcattgta       960
     ggagtggaga acctcatgga agtgtttgac aaggtatccg gcgaatatgg tgagcaatga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page