(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE235

ASHGO_7.PE235        Location/Qualifiers
FT   CDS_pept        769497..770012
FT                   /codon_start=1
FT                   /gene_family="HOG000204209" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750158"
FT                   /gene_name="SDH4"
FT                   /locus_tag="AGL137W"
FT                   /product="Succinate dehydrogenase [ubiquinone] cytochrome b
FT                   small subunit, mitochondrial"
FT                   /function="heme binding"
FT                   /function="ubiquinone binding"
FT                   /biological_process="electron transport chain"
FT                   /biological_process="transport"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial respiratory chain
FT                   complex II"
FT                   /protein_id="AAS54354.1"
FT                   /db_xref="GO:0005749"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0048039"
FT                   /db_xref="HOGENOM:HBG175893"
FT                   /db_xref="HOGENOM:HBG734876"
FT                   /db_xref="InterPro:IPR007992"
FT                   /db_xref="UniParc:UPI00002533D9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750S6"
FT                   /transl_table=1
FT                   /translation="MQGIKMASPVIRAACKRSLHQSAVRAITIPFLPTLPQNPGGVKGD
FT                   VNEANPVPPANKMHGSLHWNIERAFAVAAVPLVGLPLVAGSGVSTLMDSLLASVMLGHC
FT                   YIGFQACIIDYIPQRVYGKFHQYAMYLLAFGSLLSGVGIYKMESEGYGICGAVAAVWSG
FT                   KAAREEKA"
     atgcagggaa ttaaaatggc cagcccagtt atcagggcag catgcaagag atcactacac        60
     caaagcgcag tcagggcgat tacgattccc tttctgccca cgttgccgca gaaccctggc       120
     ggtgtgaagg gcgacgtcaa tgaggcaaac cctgtgccac cagctaacaa gatgcacggg       180
     tcactccact ggaacatcga gcgggcattt gctgtggctg ctgttccact tgtaggcctg       240
     ccactagtgg caggcagcgg tgtgtcgacg ttgatggact cgttgcttgc gtctgtgatg       300
     ctgggccatt gctacatcgg gttccaggca tgtatcatcg actatatacc acagcgcgtg       360
     tacggaaagt tccaccagta cgcgatgtac ctgctggcgt ttggctcgct gctttccgga       420
     gtagggatct acaagatgga gagcgagggc tacggcatct gcggcgcggt ggctgctgtg       480
     tggtcgggca aggccgcgcg tgaggagaag gcctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page