(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE245

ASHGO_7.PE245        Location/Qualifiers
FT   CDS_pept        complement(784702..785925)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750168"
FT                   /gene_name="ATC1"
FT                   /locus_tag="AGL127C"
FT                   /product="Protein ATC1/LIC4"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54364.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG059822"
FT                   /db_xref="UniParc:UPI0001DB2BAC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751A7"
FT                   /transl_table=1
FT                   /translation="MSVEGKNVDSYSGLTASVQHEHTHPVHNRGVALETTTQHAFITVA
FT                   SQLKPDLKGEDEEHNLELELHKFLSQHNHGPPSSGTTGTTLAGVPDFSASHNISHRDEM
FT                   AEAIEKAMAEIACPELWNNDHSSAGATVGGDVHLDTLTMDGILGNEEPFVQVHEGALGS
FT                   VDMDGQRYPHGRNSLSSIVGSKAIIQQSMDIHPTAQGGARSRQSTEEVGMHICATPNGK
FT                   RKNAGVASSQATVKRSRLFYETISPESLSPLSDNSDFLKAMDTKGSGVQNVPISTSVTA
FT                   GALGHGAKNIKGYQNASKINMASNIPKEKLQVHSTPPVVSILPEKLTQEFTMQQVMETK
FT                   RRIINTHKLILNFNFLKESYTRSCSELKRTVFKLKESECHRARLAKENEQLKRLVIELN
FT                   ERMKNPSK"
     atgagtgtcg agggtaagaa tgtggattca tattcgggcc taaccgcctc tgtccaacat        60
     gagcacaccc atcctgtcca caacagagga gtcgcgctcg aaacgaccac acagcatgca       120
     ttcattaccg tcgcgtctca gctgaagcca gatctcaagg gggaagacga ggaacataac       180
     ctggagctgg agctgcataa atttttatca caacacaatc acggcccacc gtcgtctggg       240
     actacgggaa cgactttggc tggggtacct gacttctctg cgagccacaa cataagccac       300
     cgtgatgaga tggcggaggc cattgagaag gcaatggcag aaatagcatg tccagaactg       360
     tggaacaacg accacagttc cgccggggcc acagttggag gtgacgttca cttggacacg       420
     ctcacgatgg atggcatact aggcaacgaa gagccttttg tgcaagtgca cgaaggcgcg       480
     cttggctcgg tggacatgga cggccagcgc tatccacatg ggcggaactc cctctcttcc       540
     attgtcggct ccaaagcaat catacagcag tcaatggaca tacacccaac tgcacaaggc       600
     ggcgcccggt ccaggcaaag cactgaagag gttggcatgc acatctgcgc cactccaaac       660
     ggaaagcgga agaatgcagg tgttgcgtcc tcacaggcca cagtgaaacg tagccgattg       720
     ttctacgaaa cgatatctcc cgaatcgcta tctccgctat ccgacaacag cgacttcctc       780
     aaggcgatgg atacaaaggg gtctggggtg cagaatgtgc cgatctctac gtctgttact       840
     gcgggcgctc tggggcatgg cgcaaagaac atcaaaggct atcaaaacgc ctcgaagata       900
     aacatggctt cgaacatacc aaaagaaaag cttcaagtgc attctacacc tccggttgtg       960
     tctatacttc cagagaaact tacacaagag ttcaccatgc agcaggttat ggagactaaa      1020
     cgaaggatca tcaataccca caaacttatt ctgaacttca atttcctaaa agaaagctac      1080
     acacggtcgt gcagcgaact aaagcggacg gttttcaagc taaaagagtc agaatgtcac      1140
     agggccaggc tagcgaagga gaatgaacaa ctaaaacggt tagtcattga gttaaatgag      1200
     agaatgaaaa atccaagtaa atag                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page