(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE259

ASHGO_7.PE259        Location/Qualifiers
FT   CDS_pept        complement(806736..809348)
FT                   /codon_start=1
FT                   /gene_family="HOG000174003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750175"
FT                   /locus_tag="AGL113C"
FT                   /orf_name="AGOS_AGL113C"
FT                   /product="AGL113Cp"
FT                   /function="1-phosphatidylinositol-3-kinase activity "
FT                   /function="binding"
FT                   /biological_process="phosphatidylinositol-mediated
FT                   signaling"
FT                   /cellular_component="phosphatidylinositol 3-kinase complex "
FT                   /protein_id="AAS54378.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005942"
FT                   /db_xref="GO:0016303"
FT                   /db_xref="GO:0048015"
FT                   /db_xref="HOGENOM:HBG025547"
FT                   /db_xref="HOGENOM:HBG320338"
FT                   /db_xref="HSSP:1E8X"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR008290"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI00002533F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Q5"
FT                   /transl_table=1
FT                   /translation="MPSQSVTFVVSQELNIPLKIKISSLHGTKKLLQPSQRFTHPELTQ
FT                   RTSNMRLNSDMFVSVQVFDRERNRALTTPVHTQYVPFKTGRVWNQWLTLPIYINQLDRN
FT                   STLQITIWEYDAANCIEFATLKTPVFSDADCTLKRGREALHFEYGAPESSRVEGDAIQG
FT                   LLNKYDQGGIKAIDWLDSLTFKKLESMQREADLPKGTFRLNIEFPLFELPVVYTEATNT
FT                   NVQKNIPTLNNFEPPSETIESKMDSQAKISVGSPRQSTLKFYDLDQYNVDVIEEKFRRL
FT                   ERSSKSSNLDRELKPDAKKRDILNHIIAYPPCTSLTPHEKGLVWKYRYYLVNNKKALTK
FT                   LLQSTNLAEENERKEVLDLMDLWAEIDIDDAIELLGPVYKNLSVRSYAVNRLKKASDTE
FT                   LELYLLQLVQAVCFESSSTWSDKSNSAFTIVHMDQSKNGNCTPKSLTPHMTASLDSLDR
FT                   SDVESNGAESSIVISPLAEFLIRRVVNNTRLSNYFYWFLKSESKGTQYLVHILDSFLVR
FT                   LSQESRGQIEDQVQLVNLLKECCCEVKQLKDTTPKKHELLHYLMLSKVRPFLRATNVAL
FT                   PLDPEVVAVDVVPEDCKVFKSSLSPLKITFKTKDARKYSLMFKVGDDLRQDQFVVQIIT
FT                   LMNALLKNENVDLKLTPYRILATGHNEGAIEFIPNDTMANILSKHHGILPFLKSNFPDR
FT                   GEPLGVQDWVMDNFVKSCAGYCVITYILGVGDRHLDNLLIAPDGRFFHADFGYILGRDP
FT                   KPFPPLMKLPPQIIEAFGGAESNNYNKFRSYCFVAYSILRRNAGLILNLFELMKTSDIP
FT                   DIQMDPDGAILKVKEKFCLNMSEEQATVHFQNLINASVNALLPLVIDHLHNLAQYWRS"
     atgccaagcc agagcgttac atttgttgtc tcgcaagagc tgaacatccc cttaaagatt        60
     aaaattagct ctttacatgg aacgaagaag ttgctgcagc cgtcacagcg gtttactcat       120
     ccagagctga ctcagaggac gtctaatatg cgattgaaca gcgatatgtt cgtctcggtg       180
     caggttttcg atcgcgagcg gaaccgggcg ctgacgaccc ctgtgcatac gcagtatgtg       240
     ccattcaaaa cgggccgcgt gtggaaccag tggctaacgt tgccgattta catcaaccag       300
     ctggatcgga acagcacgct gcagatcacc atctgggagt atgatgcggc caattgcatt       360
     gaatttgcga cgttgaagac acccgtgttt tcggacgcag actgcacgct taagcgaggc       420
     cgagaggcgc tgcacttcga gtatggggcg cccgagtctt ccagggtaga aggcgatgcg       480
     atacaagggc tactgaacaa gtacgaccag ggggggatca aagctatcga ctggcttgac       540
     tcgctgacgt tcaagaagct ggagagtatg caacgggagg cggatcttcc gaagggcacg       600
     ttcagactga acatcgagtt tcctcttttc gagctacccg ttgtgtatac cgaagcaacg       660
     aataccaatg tgcagaagaa cataccaaca ctgaacaact ttgagccacc gagtgagaca       720
     atcgagagca agatggactc tcaggcgaag atatcggtgg ggtctccaag acagtctact       780
     ttgaaattct acgacctgga tcaatataat gtggatgtta tagaagagaa attccgcagg       840
     ctggaaagat cttccaaaag ctccaatttg gatcgagagc tgaagccgga tgcgaagaag       900
     cgtgatattt tgaaccacat cattgcttat ccgccatgca cgagcttgac gccccacgaa       960
     aaaggacttg tatggaaata ccgctattac cttgtcaata ataaaaaggc attgacgaag      1020
     cttctacaaa gcaccaacct agccgaagaa aatgagcgga aagaggtatt ggacttgatg      1080
     gacttgtggg cagaaattga tattgatgat gcgattgaac ttctgggccc tgtatacaag      1140
     aacttatcgg ttaggtctta tgctgtgaat cgtttaaaga aagcctccga cacggagctg      1200
     gagttgtacc tgctacaact agtgcaggcc gtttgtttcg agagctcatc gacttggtcc      1260
     gataaatcca atagcgcatt cacgatagtg catatggacc aaagtaagaa cgggaactgc      1320
     accccgaagt cgttgactcc tcatatgaca gcatctttag acagtttgga caggtcagat      1380
     gtcgaatcaa acggcgcgga aagctctata gtgatttccc ctctggcaga attcttaatt      1440
     cggcgcgtcg tgaacaatac caggctaagc aattacttct attggttttt aaagtccgaa      1500
     tccaaaggga cgcagtacct ggtgcacata ctcgatagct tcttggtccg gctctcgcaa      1560
     gaaagtcgtg gacaaattga ggatcaggta caacttgtca atctgctaaa ggaatgctgt      1620
     tgtgaagtca agcaattgaa ggacactact cccaaaaaac atgagctact acactatttg      1680
     atgttgtcta aagtcagacc ctttttacgt gcaactaatg tagctttacc gctggacccc      1740
     gaggtagttg ctgttgatgt ggtgcccgag gactgcaagg tttttaaaag ctctctgtcg      1800
     ccactaaaga taacctttaa gaccaaagat gctcgaaaat attctctgat gtttaaagtt      1860
     ggcgatgacc tgcgtcaaga ccagtttgtt gtccagatca tcactctgat gaatgctcta      1920
     ctcaagaatg aaaatgttga cctcaagctt actccttaca ggatcctagc cacgggacac      1980
     aacgagggcg ccattgagtt cattccaaat gacacaatgg caaacattct cagcaaacac      2040
     catggtattt tacccttcct caagagtaac tttccggatc gcggcgagcc tctaggcgtc      2100
     caggattggg tgatggacaa tttcgtcaag tcctgcgccg gctactgcgt catcacatac      2160
     attttaggtg tcggagatag gcatctcgac aacctcctga tcgccccgga tggccggttc      2220
     ttccacgccg actttggata catcctgggt cgcgatccaa aaccatttcc tccgttaatg      2280
     aaacttccgc ctcagataat agaggccttt gggggcgccg agtccaacaa ctacaacaag      2340
     ttcaggagct actgctttgt agcctactct atcctccgga ggaatgctgg tttgatactg      2400
     aatctttttg agctcatgaa gacgtcagac attcctgata tccagatgga tccagatggt      2460
     gccattttga aggtcaagga gaaattctgc ctgaacatgt cagaggaaca ggccaccgta      2520
     cattttcaga acctcatcaa tgccagtgtt aatgccctat tgcctctagt catagaccat      2580
     ttgcataact tagctcagta ctggcgctcg taa                                   2613
//

If you have problems or comments...

PBIL Back to PBIL home page