(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE262

ASHGO_7.PE262        Location/Qualifiers
FT   CDS_pept        complement(813439..814272)
FT                   /codon_start=1
FT                   /gene_family="HOG000020768" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750176"
FT                   /locus_tag="AGL110C"
FT                   /orf_name="AGOS_AGL110C"
FT                   /product="AGL110Cp"
FT                   /function="ATP binding"
FT                   /function="dephospho-CoA kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54381.1"
FT                   /db_xref="GO:0004140"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="HOGENOM:HBG460048"
FT                   /db_xref="HOGENOM:HBG650290"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="UniParc:UPI00002533F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Q2"
FT                   /transl_table=1
FT                   /translation="MLVIGLTGGIACGKSTVSRRLHERYRIPVIDADAIAREIMRPGER
FT                   AYQRVVERFEQRVPQLVQANGELNRAALGAWIFQHAEERQALNAITHPEIRKRIFFRVV
FT                   DCYMRMHPMCVLDIPLLFETGLDVFCGVTVSVVCDQKVQIERLLLRNAELTREEAEARI
FT                   RAQMSMEERIELSDYVIPNNDNYEVLFETVDQAVTYIKPYLLTVMLHYFLPFGIVSALA
FT                   VVLSKYYKKTVAGTSRRKRRKAKERAAKKRAAEQKAALKASQPPLYKRLLSRKAE"
     atgcttgtta tagggttgac aggaggtatt gcatgcggca agtcgacggt gtcgcggaga        60
     ctgcacgagc gataccggat cccggtgatc gatgcggatg cgattgcgcg ggagattatg       120
     cggccggggg agcgggcgta ccagcgggtg gtggagcggt ttgagcagcg ggtgccgcag       180
     ctggtgcagg cgaacgggga gctgaaccgc gcggcgctgg gggcgtggat cttccagcac       240
     gcggaggagc ggcaggcgct gaacgcgatc acgcacccgg agatccgcaa gcggattttc       300
     ttccgggtgg tggattgcta catgaggatg cacccgatgt gcgtgctcga catcccgctt       360
     ttgttcgaga cggggctgga cgtgttctgc ggggtgacgg tgagcgtggt gtgcgaccag       420
     aaggtgcaga tcgagcggct gctgttgcgg aacgcggagc tgacgcgcga ggaggcggag       480
     gcgcggatcc gcgcgcagat gtcgatggag gagcggatcg agctttcaga ctacgtgatc       540
     ccgaacaacg acaactacga ggtgctgttc gaaacggtgg accaggcggt gacgtacatc       600
     aagccgtacc ttttgacggt gatgctccac tactttctgc cgtttggcat cgtgtctgcg       660
     ctggcggtgg tgttgtcgaa gtactacaag aaaacagtcg cgggcaccag ccggcgcaag       720
     agacggaagg cgaaggagcg cgctgcgaag aagcgcgctg ccgagcagaa ggccgcgctc       780
     aaggcgagcc agccgccgct gtacaagcgg ctgctgagta ggaaggcgga gtag             834
//

If you have problems or comments...

PBIL Back to PBIL home page