(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE267

ASHGO_7.PE267        Location/Qualifiers
FT   CDS_pept        820160..820606
FT                   /codon_start=1
FT                   /gene_family="HOG000154374" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775041"
FT                   /gene_name="SPC19"
FT                   /locus_tag="AGL105W"
FT                   /product="DASH complex subunit SPC19 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS54386.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG192650"
FT                   /db_xref="HOGENOM:HBG203202"
FT                   /db_xref="InterPro:IPR013251"
FT                   /db_xref="UniParc:UPI00002533F9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750P7"
FT                   /transl_table=1
FT                   /translation="MDISLDESCVALESSVKLLGKTLERLAEQGEHSRRLTSTLLRSKR
FT                   VFELVSEYDLQRARLDVIEEVEPVVEKLCSKLEKSLNKLERERATLQQTYELNQLRLNN
FT                   RLAGSGGRRPVVMGTSTTEELGRLREAKQRKAALEREIAEVRGT"
     atggatattt ctttggacga gagctgtgtg gcattggaga gcagcgtgaa gctgcttggg        60
     aagacgttgg aacggctggc ggagcagggg gagcacagca ggaggctgac cagcacgctg       120
     ctgcggtcca aacgcgtgtt cgagctggtg tctgagtacg atctgcagag ggcacggttg       180
     gacgtgatcg aggaggtgga gccggtggtg gagaagctgt gcagcaagct ggagaagtct       240
     ctgaacaagc tggaacggga gcgcgcgacg ctgcagcaga cgtacgagct gaaccagctg       300
     cggctgaaca accggctggc gggcagcggc ggccggcggc cggtggtgat gggcacgtcg       360
     acgacggagg agctggggcg gttgcgggag gcgaagcagc gcaaggcggc gctggagcgg       420
     gagatcgcgg aggtgcgggg tacttag                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page