(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE276

ASHGO_7.PE276        Location/Qualifiers
FT   CDS_pept        838509..840152
FT                   /codon_start=1
FT                   /gene_family="HOG000193875" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622497"
FT                   /locus_tag="AGL096W"
FT                   /orf_name="AGOS_AGL096W"
FT                   /product="AGL096Wp"
FT                   /function="phosphatidylinositol phosphate kinase activity "
FT                   /protein_id="AAS54395.1"
FT                   /db_xref="GO:0016307"
FT                   /db_xref="HOGENOM:HBG059838"
FT                   /db_xref="HOGENOM:HBG588608"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="UniParc:UPI0000253402"
FT                   /db_xref="UniProtKB/TrEMBL:Q750P3"
FT                   /transl_table=1
FT                   /translation="MERQPESLRSANQFSASSSPTSVESIGTAMKALGERRSLVERGSY
FT                   IEDLEDERVLLNRTLSGRRRVARRATSVQQKHARIFAAEEQGENARGAEAAPVRRRSSQ
FT                   FLNDGAMKASESATAELKKMRESLLIKREMKRKQRHLLDDDRVLVGNKVSEGHVNFIIA
FT                   YNMLTGIRVAVSRCSGLMKPLSQRDFHQTKKLAFDYHGNELTPSSQYAFKFKDYCPEVF
FT                   RELRARFGLDPADYLMSLTSKYILSELNSPGKSGSFFYFSRDYKYIIKTIHHSEHKHLR
FT                   HVLHDYYEHVKANPDTLICQFYGLHRVKMPISFKNKVKNRRIYFIVMNNLFPPHLEMHT
FT                   TFDLKGSTLGRYTKVSKEDEDARPVLKDLNWLEQHMNIQFGPHKGRVFLNQLKKDVDFL
FT                   SRLNIMDYSLLLGIHDINLAAANSEDIHAMIPESSAKHALTSAFPANSNSNININNVIT
FT                   NASNNHFFQRDEGGIRASDAENKDLNIIYYIGIIDCLTNYSLLKKLETFWRGLSHDLYA
FT                   VSAVPPNDYGLRFYKFIEDSVTQGKTGHRD"
     atggagaggc agccggagtc gctgaggtcc gcgaaccagt tctcggcgtc gtcgtcgcca        60
     acctcggtgg agtcgatcgg gacggcgatg aaggcgctgg gcgagcggcg gagcctggtg       120
     gagcggggct catatattga ggacctggag gacgaacgcg tgctgctgaa ccgcacgctg       180
     agcgggcggc ggcgcgtggc gcggcgggcg acgagcgtgc agcagaagca tgcacgcatc       240
     ttcgcggcgg aggagcaggg ggagaacgcg cgcggcgcgg aggccgcgcc ggtgcggcgg       300
     cggtcgtcgc agttcctgaa cgacggggcg atgaaggcgt ccgagtcggc gaccgcggag       360
     ctcaagaaga tgcgggagtc gcttttgatc aagcgggaga tgaagcgcaa gcaacgccat       420
     cttctcgacg acgaccgggt gctggtgggc aacaaggtga gcgagggaca cgtcaacttc       480
     atcatcgcgt acaacatgct cacgggcatc cgcgtcgcgg tctcccgctg ctcgggcctt       540
     atgaagccgt tgagccagcg ggactttcac cagacgaaga agctagcatt cgactatcat       600
     ggcaacgagc tcacgcccag ctcacagtat gccttcaaat tcaaagacta ctgcccggag       660
     gtatttaggg agttgagggc acggtttgga ctggatccgg ctgactactt gatgtccttg       720
     acctcgaaat atattctcag cgagctaaat tcgcctggca agtccggttc ctttttctac       780
     ttttcgcgcg actacaaata cattatcaaa acgatccacc actccgagca taagcatttg       840
     cgacatgtgt tgcatgatta ctatgagcat gtaaaagcca atcctgacac tcttatatgt       900
     cagttttatg gcttgcatag ggtgaagatg cccatctcct tcaaaaacaa ggtcaaaaat       960
     agacggatct acttcatcgt aatgaataac ctatttccac cgcacttgga gatgcatact      1020
     acttttgatt tgaaaggatc taccttgggc cgctatacaa aagtgtcgaa ggaagacgag      1080
     gacgcccggc ctgtcttgaa ggacttgaat tggttggaac aacatatgaa catccagttc      1140
     ggcccccaca agggccgtgt cttcttgaac cagttaaaga aggacgtcga cttcctatcc      1200
     cgattgaaca ttatggatta ctccttattg ttgggcatcc atgatattaa cctagcggca      1260
     gcaaacagcg aagacataca tgccatgata ccagaatcgt cagcgaaaca tgccctcact      1320
     tctgcgttcc cagctaattc taactctaat attaatatta ataacgtcat tacgaacgcc      1380
     tcgaataacc actttttcca gcgtgacgaa ggcggcatca gggcttcaga tgcagaaaac      1440
     aaagatctca acatcatcta ttacattggt atcattgact gtctaacaaa ctactctctt      1500
     ttgaaaaagc tagaaacatt ctggaggggt cttagccacg acttatacgc tgtgagcgcc      1560
     gtccccccca atgactacgg cctgcgtttt tataaattta tagaggactc cgttactcag      1620
     ggcaagaccg gccatcgaga ctga                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page