(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE280

ASHGO_7.PE280        Location/Qualifiers
FT   CDS_pept        846798..848474
FT                   /codon_start=1
FT                   /gene_family="HOG000226729" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750184"
FT                   /locus_tag="AGOS_AGL092W"
FT                   /product="AGL092Wp"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54398.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012715"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI0001DB2BEF"
FT                   /db_xref="UniProtKB/TrEMBL:Q751B1"
FT                   /transl_table=1
FT                   /translation="MAQVFNNQRSDTLFLGGEKVSGDDIRNQNVLAALAVANVVKSSLG
FT                   PVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVII
FT                   AAELLKRANELVKNKIHPTTIITGFRVALREALRYIEDVLSQPVDALARETMVNIAKTS
FT                   MSSKIIGSDSEFFSSMVVDALLAVKTQNGRGEVKYPVKAVNILKAHGKSACESVLVQGY
FT                   ALNCTVASQAMPRKLTGSVKIACLDINLQKARMAMGVQINVDDPDQLEEIRKREVGIVL
FT                   ERVKKIIDAGAQVVLTTKGIDDLCLKAFVEANVMAVRRCQKEDLRRIARATGAVLISSM
FT                   SNLEGDETFEPSYLGTCSEVVQAKFSDDECILIKGTAKHSSSSIILRGPNDYSLDEMER
FT                   SLHDSLCVVKRTLESGHVVAGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAAMLVIP
FT                   KTLAVNAAKDSSDLVAKLRSYHAASQQAKPDDLKKRKYRNYGLDLIRGKVVDEVGAGVL
FT                   EPTISKKKSLKSALEACIAILRIDTMITVDPEPPKEDPHAH"
     atggctcaag tgttcaacaa ccagcgttcg gataccctgt ttctgggcgg cgagaaggtg        60
     tctggagatg acatccgcaa ccagaatgtg cttgcggcgc tggcagtggc caatgtggtg       120
     aagtcgtcgc tgggcccggt ggggctggac aagatgctgg tggacgacat cggggacttc       180
     acggtgacga acgacggggc gacgatcctg tcgctgctgg acgtgcagca ccctgcgggc       240
     aagatcctgg tagagctggc gcagcagcag gaccgcgaga tcggcgatgg cacgacgagc       300
     gtggtgatca tcgcggcaga gctgctgaag cgcgcgaacg agctggtcaa gaacaagatc       360
     cacccgacga cgattatcac agggttccgg gtggcgctgc gggaggcgct gcgctacatt       420
     gaagacgtgc tatcgcagcc agtggacgcc ctggcgcgcg agacgatggt gaacatcgcg       480
     aagaccagta tgtcgtccaa gatcattggc tccgactcgg agttctttag ctccatggtg       540
     gtggatgcgc tgctggccgt caagacgcag aacggccgcg gtgaggtaaa gtacccggtc       600
     aaggcggtga acatactgaa ggcgcacggt aaatccgcgt gcgagtccgt gctcgtgcag       660
     ggctacgccc taaactgtac tgttgcatcg caggccatgc cccgtaaact gacgggcagt       720
     gtgaagatcg cgtgtcttga tatcaacctg cagaaggcac gcatggcgat gggtgttcag       780
     atcaatgtcg acgatccgga ccagctggag gagatccgga agcgggaggt tggaatagtg       840
     ttggagcgtg tcaagaaaat tattgacgcc ggggcccagg ttgtgctcac aactaagggt       900
     atcgacgacc tatgcctgaa agcgtttgtc gaggccaacg ttatggcagt ccgccgttgt       960
     cagaaggagg atttgcgcag gatagctcgc gccacaggcg ctgtgctcat cagctcaatg      1020
     tcgaacttgg agggcgatga gaccttcgag ccaagctatc tcggcacctg tagcgaggtc      1080
     gtgcaggcga agttctccga cgacgagtgt atcttgatta agggcactgc caagcattct      1140
     tcttcctcca tcatcttgcg tggaccaaac gactactctc tggacgaaat ggagcgctcg      1200
     ctgcacgact cgctctgcgt ggtgaagaga accctcgaga gtgggcatgt ggtggctggc      1260
     ggcggctgtg tcgaggcggc cctcaacata tatctagaca actttgccac caccgtcggc      1320
     tcgcgcgagc agctggcaat cgccgagttt gccgccgcga tgttggtcat cccaaagaca      1380
     ttggccgtca atgcagccaa ggactccagc gacctcgttg ccaagctgcg ttcgtaccat      1440
     gcagccagcc agcaggccaa accggacgac ctcaagaagc gcaagtaccg caactacggg      1500
     ctcgacctta tccgcgggaa ggtcgtcgac gaggtgggag ccggcgtgtt ggaacccacc      1560
     atcagcaaga aaaagtcttt gaagtccgcc ctcgaagctt gcattgccat tcttagaatt      1620
     gacacaatga ttacggtcga tccagaacct ccaaaggagg atccccacgc tcactga         1677
//

If you have problems or comments...

PBIL Back to PBIL home page