(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE281

ASHGO_7.PE281        Location/Qualifiers
FT   CDS_pept        849059..851659
FT                   /codon_start=1
FT                   /gene_family="HOG000001044" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622498"
FT                   /locus_tag="AGL091W"
FT                   /orf_name="AGOS_AGL091W"
FT                   /product="AGL091Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54399.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG192605"
FT                   /db_xref="HOGENOM:HBG203209"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000253405"
FT                   /db_xref="UniProtKB/TrEMBL:Q751B6"
FT                   /transl_table=1
FT                   /translation="MLSVREQVAEKLHLTSRKRNCILGKNSDMALEMQENAGRNMHSQY
FT                   SPRDSDRPRKRIEKVIELIEVDGKKVSKTATGKRKFHNKSKNGCDNCKRRRVKCDEGKP
FT                   GCQKCLKMRLSCVYTPAKPRKKKDRDVETVIKYVTRGNDEKDDGDVDTVIKYVTRGNDE
FT                   KDDSRDELGQQDNQNAPLAANLAVSGSQIEGAVPQTSPSVTPDASLLPPLFVGQNSQQL
FT                   QQQLMQQPHLLPQLMTLSNSERFATFELPNSPIPLQATAMNTTNSINSVFTNTRFASNL
FT                   LQQISQSPDQADLSSSVSKNGINLKQFGGPFPSAGIGGVTYDFQELIGIKAMTTKEPEV
FT                   TSQQQQISNVVTGNTSMLSKQPLVQCSSLEQQHSRASGRSTQHQPRQAQQRHSGSQPDH
FT                   QHRHQQLQQSHMPQLQDVQIQQTAAQQSPSIPVQDSLSQRGQSSATAVLSSLGSNGGSA
FT                   NMMDNPTISPIVLPMSPMSKASESVLVNNTSSTGVGDVSNSASRAAAGAKTQQNTSTRR
FT                   DSISASDNQLSEDTDGQMCTSDGCGILSFSKIIEFTQNSTLNLVDLRLFHHYCTKVWPT
FT                   IISAGISEQHIWSEHIPELAFRYPFLMHALLAFSATHLSRTEVGLEPFVACHRLESLKL
FT                   LREAVLQICEENTDALVASALILIMDSLANAASPNPAISSAAISPSAWIFHVKGAATIL
FT                   TAVWPLTPTSRFYNLINVDLSDLGDIINSDNGTVSELVCFDNSISDLYPVEIDSPYLIT
FT                   LAYLDKLHKEKDRSGFILRVFAFPALLDKTFLALLMTGDLGAMRIMRSYYKLLRGYATE
FT                   MKDRVWFLEGMTQVLPQDVDEYSGGGGMHMMLDFLGGGLPSMTTTNFTEFVYNE"
     atgctgagcg tcagagagca ggtagcggag aaactacatt tgacatcgcg caagaggaac        60
     tgtatactag gcaagaactc tgacatggcg ctcgaaatgc aagagaatgc ggggagaaac       120
     atgcactcgc agtattcccc acgagatagc gacaggcccc ggaagcggat cgagaaggtg       180
     atcgagttaa ttgaggtcga tggaaagaag gtgagcaaaa cagcaactgg gaagcgtaaa       240
     ttccacaaca aatccaagaa cggctgtgac aactgcaagc gccgacgcgt aaaatgcgat       300
     gaaggtaagc ctggctgcca aaaatgcctt aaaatgcgac tgagttgcgt gtataccccg       360
     gccaagcctc ggaaaaagaa ggacagggac gtggagactg tgatcaagta tgtgacacga       420
     ggtaatgatg agaaggatga cggggacgta gacactgtta tcaagtatgt gactcgcggt       480
     aatgacgaga aggatgatag tagagatgag ctgggccagc aggataatca gaatgcaccg       540
     cttgccgcaa acctggctgt ttcaggtagc cagatagagg gcgctgttcc acagacttcg       600
     ccgtctgtta cgcccgatgc gtcgctgtta ccgcctctct ttgttgggca gaactcgcaa       660
     cagttacagc agcaattgat gcaacagccg catttgcttc cccagttaat gacattatcg       720
     aattcagaaa gattcgccac tttcgaactg cccaacagtc ccataccatt acaagcaacc       780
     gccatgaaca ccactaacag tattaattcg gtgtttacta atacgagatt tgcttcgaat       840
     cttctgcaac agatatccca gtctccagac caggcagact tgagctcatc agtatcaaaa       900
     aatgggataa acctcaagca gtttggaggc cctttcccgt cagctggaat tggaggagtc       960
     acgtatgact tccaagaatt aattggaata aaggcgatga ccacgaaaga acctgaagtg      1020
     acttcccagc aacaacagat aagcaacgtt gttacgggga acacctctat gctctctaaa      1080
     caaccgctgg ttcagtgttc ttcgcttgag cagcagcatt cgagggcttc cggtaggagc      1140
     acgcaacacc aaccaagaca agcacagcag cgacactccg gctcgcaacc tgaccatcaa      1200
     caccgccacc aacaacttca gcagtcacat atgccccagc tgcaagatgt tcaaatccaa      1260
     caaactgctg cgcagcagag cccctccata cctgtgcaag attcgctgtc tcagcgagga      1320
     cagtcatccg cgacggccgt tttatcaagt cttggcagta atggcggatc tgccaacatg      1380
     atggacaacc caaccatctc gcccattgtt cttccaatgt ctccgatgtc aaaggcaagt      1440
     gagtccgtcc tcgtaaacaa cacatcttca acaggcgttg gagacgtatc caactctgcg      1500
     tcacgagcag cagcgggcgc caagacacag cagaacactt ccacacgcag ggattctatt      1560
     tccgcatcag ataaccaact atccgaggat actgacggac agatgtgtac ctctgatggc      1620
     tgcggtattc tatcatttag caagattatt gaattcaccc agaacagcac gttgaatttg      1680
     gttgatctac ggcttttcca ccactattgt accaaggtat ggccgacgat aatctcagca      1740
     ggtatcagtg aacagcatat ctggtctgag catataccag aactggcttt cagatatcca      1800
     tttctcatgc atgctctcct ggcttttagc gccacccatc tttcccggac agaggtcggc      1860
     cttgagccat tcgttgcatg ccatcgtttg gaatctctca aattgctgcg cgaagcagtg      1920
     ctgcaaatat gtgaagaaaa cacagacgcg ttggtcgcca gcgcactgat actaatcatg      1980
     gactcgcttg ccaacgcagc gtctcccaac cccgccatat ccagcgccgc tatctccccc      2040
     tctgcgtgga ttttccacgt caagggcgcc gccaccatac tcacggccgt ctggccgctg      2100
     accccgacat caaggttcta caatctcatc aatgttgatc ttagcgacct aggggacatc      2160
     atcaacagcg acaatggcac ggtaagcgag ctcgtctgct tcgacaacag catttctgat      2220
     ctttatcccg tggagatcga ctctccctat ctgataaccc tggcctacct ggacaagtta      2280
     cacaaagaga aggaccgttc gggctttata ctccgtgtat ttgcttttcc agctctgctg      2340
     gataagacct tccttgcttt gctgatgacc ggcgatctcg gtgccatgcg catcatgcgt      2400
     agctattaca aattgctgcg cggttacgcc acggaaatga aggatcgcgt ctggttccta      2460
     gaggggatga cacaggtgct accgcaagat gtagacgagt acagtggggg tggcggcatg      2520
     catatgatgc tagacttcct cggtggaggc ttaccttcga tgactaccac caacttcacc      2580
     gagttcgtat ataatgagta a                                                2601
//

If you have problems or comments...

PBIL Back to PBIL home page