(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE283

ASHGO_7.PE283        Location/Qualifiers
FT   CDS_pept        853141..853881
FT                   /codon_start=1
FT                   /gene_family="HOG000091084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750185"
FT                   /locus_tag="AGL089W"
FT                   /orf_name="AGOS_AGL089W"
FT                   /product="AGL089Wp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="AAS54401.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="HSSP:1G65"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI0000253407"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N9"
FT                   /transl_table=1
FT                   /translation="MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCT
FT                   VLVNQKKVPDKLLEPSTVTYLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGY
FT                   DMPVHVLAKRFANLSQTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKAT
FT                   ATGPKQQELITALEKHFKKLQKDRLDEDSWEKVVEFAIGQMINSLGTDFSSKDLEIGVA
FT                   VAGKFFVLSQDQVEERLVAIAEQD"
     atgagtgctg cagggtatga taggcatatt acgatcttct cgcccgaggg gcggctgtac        60
     caggtcgagt atgcattcaa ggcaacgaat cagaccaaca tcaattccgt ggcgatccgc       120
     gggaagtcat gcacggtcct agtgaaccaa aagaaggtgc cagacaagct actggagcca       180
     tcgacagtga cttatttgtt cccgattgcg aaacatattg ggatgtgcgc gacgggcccg       240
     attgccgacg cacgcaatgt ggctgtccgg tgcagagcca tggcggccga attccggtac       300
     gagtatggct atgacatgcc ggtgcatgtg cttgccaagc gctttgccaa cctatcgcag       360
     acgtacacgc aacgagcata catgcggccg ctgggagtgg tgcttacgtt catttccgtg       420
     gacgaggagg aggggccatc catcttcaaa tgcgaccctg caggctacta caccggctac       480
     aaggccactg ccacgggacc caagcagcag gagctaatca cagcgctaga gaagcatttt       540
     aaaaaattgc agaaggaccg cctggacgag gacagctggg agaaggttgt cgagttcgcc       600
     attggccaga tgatcaactc gctagggacc gacttctcca gcaaggatct ggaaatagga       660
     gtggcggtgg cagggaagtt tttcgtgctg agccaggacc aggtcgagga gcggctggtc       720
     gcaattgctg agcaggacta g                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page