(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE289

ASHGO_7.PE289        Location/Qualifiers
FT   CDS_pept        864033..866603
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750188"
FT                   /locus_tag="AGL083W"
FT                   /orf_name="AGOS_AGL083W"
FT                   /product="AGL083Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54407.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059842"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000025340D"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N3"
FT                   /transl_table=1
FT                   /translation="MNGATATATAAVGAEEEGGAREGSRRRDSVESAGDGRRRTKVSRA
FT                   CDQCRRKKIKCEYQEDAQSCSGCRKNSERCAFERVPLKRGPSKGYTRGEGAGDGARETE
FT                   GARGELDTSRADGKAAPVSLPPLHYYLPISNGQPGGAPAQAPAAPFPPMKQQFWKVPYY
FT                   ENQMQRRSSLESVNSDASGPQSQQETYAASSASTSSHQRTSRSYFPSSDGASALFQEPC
FT                   SSSYPPPLVRSSSTGGQLQQLPAPQYPYSQFAVALSGSTSASSQSVQLRTSATGSTSLP
FT                   EDSSPSSSNAYSPQLRAHCMSESLTTPTAGSKTGGSVKRRKRLSEPADPIVPLSAREPR
FT                   QAGHIGLPLQAQQATGKTGVICGKLSDAELIDAYYEYVHVNYPIIPINKETLTNEILLV
FT                   NTQPISEVHEMNNYILYWFRVALELLLHVASDKTNQDTASGMDSNAVHDGGLYAHRGDF
FT                   KQNEEHHVPHQSQLLAALNDCFRKLLDIHPKICAYQESTSPKVTTIYLSTYIIINYMLA
FT                   MLGEDNTFVLGTSVTVFNEFKIYRLLVLHEVADEPGDDSADVERHGFELLYKRLYYSLL
FT                   VFDALQSCCFGAPRLASLPISHLVEPLFAPPPPLDSAKWAVESDAARREPLLASIRLGA
FT                   LLTELCETRVLAGALPRAPTPALRAPRPFRVAPPADDSVPGAFFHALAAQRALLDRLLA
FT                   IPAHPAFAADAPPDATVDLCAQLGDAICRFTSCVLDTLVRAGPRPASPFAAALSRALHH
FT                   AINLSRNIPTSLIGCIIGTAVHHSRDRDLIVALSRCMSDMIQIQGLTHCLRPCAPPRPR
FT                   ARVSCDLRRLYGHDGPPASPHQVMLHQFIDIAWRLLRNDELGWF"
     atgaatggag cgacagccac agctacagca gcggtcgggg ccgaggagga gggcggcgcg        60
     cgggagggct cgcggcggcg cgactcggtg gagagcgcgg gcgacgggcg gcggcgcacg       120
     aaggtgtcgc gcgcgtgcga ccagtgccgg cgcaagaaga tcaagtgcga gtaccaggag       180
     gacgcgcaga gctgcagcgg gtgccgcaag aacagcgagc ggtgcgcgtt cgagcgggtg       240
     ccgctgaagc ggggcccgtc gaagggatac acgcggggtg agggggccgg ggacggagcg       300
     cgcgagacgg agggggcgcg cggcgagttg gacacgtcga gggcggacgg gaaggccgcg       360
     ccggtgtcgc tgccgccgct gcactactac ctgccgattt ccaacgggca gccgggtggg       420
     gcgcctgcgc aggcgcctgc ggcgccattt ccgcccatga aacagcagtt ctggaaggtg       480
     ccctactacg agaaccagat gcagcggcgg tcgtcgctag agtcggtgaa cagcgacgcc       540
     tctggcccgc agagccagca ggagacgtac gcggcgtcga gcgcgtcgac gtcctcgcac       600
     cagcgcacgt cgcgcagcta cttcccgagc tcggacggag cctccgcgct gttccaggag       660
     ccgtgctcgt cgagctaccc gccgcctctg gtgcgatctt cgtcgaccgg cgggcagctg       720
     cagcagctgc cggcgccgca gtacccgtat tcgcaattcg cggtggcgct cagcggctca       780
     acgtctgcgt cgagccagag cgtgcagctg cgaacctcgg cgacggggag caccagcctg       840
     ccggaggaca gctcgcccag ctcttctaac gcatattctc cacagctgcg cgcccattgc       900
     atgtcagaga gcttgacgac gccgacggcc ggctccaaga ccggcgggtc cgtgaagcgc       960
     cggaaacggc tgtctgaacc cgcagatcct atcgtgccgc tgagcgcgcg ggagccgcgc      1020
     caagcgggac atattgggct tccattacaa gcgcagcaag cgacaggcaa gacaggcgtt      1080
     atctgtggga agctgtcgga cgcagagctt atcgacgcgt actatgaata tgtccatgtc      1140
     aactatccca tcatacccat caacaaggaa acactgacga atgaaattct gctggtaaat      1200
     acgcagccga tatccgaggt ccacgagatg aacaactaca ttctctactg gttccgtgtc      1260
     gcgctcgagc ttctgctaca tgtggcctcg gacaagacta accaggacac agcaagtggg      1320
     atggacagca acgcagtgca tgacggcggc ctctacgcgc accggggcga cttcaaacag      1380
     aacgaggagc accacgttcc gcatcaatcg cagctgctcg cggcactcaa cgattgcttc      1440
     cgcaagctcc tggacataca ccccaagata tgcgcatacc aagagagcac ctcgccaaag      1500
     gtgacgacaa tctacctcag cacctacatc atcatcaact acatgctcgc gatgctgggc      1560
     gaggacaaca catttgtgct cggtacgtcc gtcaccgtct tcaacgagtt caagatctac      1620
     cggttgctgg tgctgcacga agtcgccgac gagcccggcg acgactcagc ggacgtcgag      1680
     cgccacggct tcgagctgct ctacaagcgc ctttactaca gcctgctcgt ctttgacgcg      1740
     ctccagagct gctgcttcgg agctccccgg ctcgcatccc tgccgatctc gcacctcgtc      1800
     gagcccctct ttgccccgcc gccacccctc gactccgcca agtgggcggt cgagtccgac      1860
     gccgcacgcc gcgagcccct gctcgccagc atccgccttg gcgcgctcct cacagagctg      1920
     tgcgagaccc gcgtgctcgc aggcgcgctc ccgcgagccc ccacgcccgc cctgcgcgcg      1980
     ccccgcccct tccgcgttgc cccgcccgca gacgactccg tgcccggtgc cttcttccac      2040
     gccctcgccg cccagcgcgc cctcctcgac cgcctgctcg ccatccccgc ccaccccgcc      2100
     ttcgccgcag acgccccgcc cgacgcgacc gtcgacctct gcgcccagct cggcgacgcc      2160
     atctgccgtt tcacctcctg cgtccttgac acccttgtcc gcgccggccc gcgccccgcc      2220
     tcgcccttcg ccgccgctct ctcgcgcgcc ctccaccacg ccatcaacct ctcccgcaac      2280
     atccccacct cgctcatcgg ctgcatcatc ggcaccgctg tccaccactc gcgcgaccgc      2340
     gacctcatcg tcgccctgtc ccgctgcatg agcgacatga tccagatcca gggcctgacc      2400
     cactgtctgc gcccctgcgc ccccccgcgc ccgcgtgccc gtgtctcctg cgacctccgc      2460
     cgtctctacg gccacgacgg gcctcctgcc tcgccccatc aggtcatgct acaccagttt      2520
     atagacatcg cctggcgcct gctccgcaac gacgagcttg gctggttttg a               2571
//

If you have problems or comments...

PBIL Back to PBIL home page