(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE291

ASHGO_7.PE291        Location/Qualifiers
FT   CDS_pept        869107..869778
FT                   /codon_start=1
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928055"
FT                   /locus_tag="AGL081W"
FT                   /orf_name="AGOS_AGL081W"
FT                   /product="AGL081Wp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS54409.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG467264"
FT                   /db_xref="HOGENOM:HBG742904"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000025340F"
FT                   /db_xref="UniProtKB/TrEMBL:Q751A5"
FT                   /transl_table=1
FT                   /translation="MDGLLINTEDIYTVAISKLLAQFDKGPLTWDVKIRLQGLPGREAA
FT                   QKLIDHYDLPLTWEEVEKRNIALQDGLWKDSALLPGVGKLINYLKARDIPIAVCTSSSR
FT                   LKFEGKTAHLRDVFDKFDIVVTGDDERIPQGRGKPFPDIWQLGLKLLNDNFGASILPAE
FT                   CLVFEDGIPGVESGKAFGAYVVWVPHPESLSVTGDTSAVISGKGEMLRSLEHFKPAEFG
FT                   L"
     atggacggtc tcttaattaa cactgaggat atctacactg tcgcaatctc gaaactgtta        60
     gcgcaatttg acaaagggcc gttaacatgg gatgtcaaga tccgactaca gggattgccg       120
     ggacgtgagg ccgcgcaaaa gctaattgac cattatgact tgccattaac atgggaagaa       180
     gtcgaaaagc gcaatattgc attacaggat gggctatgga aagacagcgc attgcttcct       240
     ggagttggca agctgataaa ttacctgaag gctagggaca ttccaatagc agtgtgcact       300
     agttccagtc gcttgaaatt tgagggcaag acagctcatc tgcgggatgt ttttgacaag       360
     tttgatattg tagtcactgg agatgacgaa cggattcccc aaggaagagg taagcctttt       420
     cccgacatct ggcaacttgg gttaaagtta ctaaatgaca actttggtgc atctatctta       480
     cctgccgagt gcttggtttt cgaggatggc atccctggtg tcgaatcagg gaaagcattt       540
     ggggcttatg tagtctgggt cccccaccca gaatccctgt cagtgacggg cgacacgagc       600
     gctgtaattt cgggtaaagg tgagatgcta cggtccttag agcattttaa gcccgctgaa       660
     ttcggtctct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page