(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE30

ASHGO_7.PE30         Location/Qualifiers
FT   CDS_pept        complement(77251..77820)
FT                   /codon_start=1
FT                   /gene_family="HOG000000770" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927761"
FT                   /locus_tag="AGL341C"
FT                   /orf_name="AGOS_AGL341C"
FT                   /product="AGL341Cp"
FT                   /function="protein phosphatase inhibitor activity "
FT                   /biological_process="regulation of phosphoprotein
FT                   phosphatase activity"
FT                   /biological_process="regulation of signal transduction "
FT                   /protein_id="AAS54150.1"
FT                   /db_xref="GO:0004864"
FT                   /db_xref="GO:0009966"
FT                   /db_xref="GO:0043666"
FT                   /db_xref="HOGENOM:HBG059850"
FT                   /db_xref="HOGENOM:HBG397087"
FT                   /db_xref="InterPro:IPR007062"
FT                   /db_xref="UniParc:UPI000025330F"
FT                   /db_xref="UniProtKB/TrEMBL:Q751R7"
FT                   /transl_table=1
FT                   /translation="MGGILKNPLSPHEQETHNAEPESVTEFRQQVLKNTRLNAQMTTRR
FT                   SSDLHNGAHGVPKDTLQLKRMHDEERLQWNQQNLDQNELTKQQFQDIHVDEPKTPYQGA
FT                   IDPEGEYYKHDDDDDDDGDLENFTLGDPEYSVPVPPVAQNGEPEGSQEADDDQAAQRRR
FT                   FEELRRKHYNVREAFSNRQLSEDEEE"
     atgggcggca ttctgaaaaa ccctctttct ccgcatgaac aggagacgca taacgcggag        60
     cctgaatccg tgaccgagtt ccggcagcaa gtgctgaaga acacacggct caacgcacag       120
     atgaccacca gacgcagcag cgacctgcat aatggcgcac acggcgtgcc gaaggacacg       180
     ctgcagctca aacggatgca cgacgaagag cggttgcaat ggaaccagca gaacctcgac       240
     cagaacgagc tcacgaagca gcagttccag gatatacatg tggacgagcc caagacgccg       300
     taccagggcg ctatcgaccc tgaaggcgaa tactacaagc atgatgacga cgacgacgac       360
     gacggcgacc tcgagaactt tactctgggc gaccccgagt acagtgtccc ggtgccgccg       420
     gtcgcgcaga acggcgagcc cgaaggcagc caggaagcgg acgatgacca ggctgcgcag       480
     cgccgccgct tcgaggagct gcgccgcaag cattacaacg tcagagaggc gttcagtaac       540
     cggcagctga gtgaagatga agaagagtag                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page