(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE333

ASHGO_7.PE333        Location/Qualifiers
FT   CDS_pept        complement(942596..943813)
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775049"
FT                   /locus_tag="AGL043C"
FT                   /orf_name="AGOS_AGL043C"
FT                   /product="AGL043Cp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54447.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI0000253434"
FT                   /db_xref="UniProtKB/TrEMBL:Q750J4"
FT                   /transl_table=1
FT                   /translation="MAAIQVSTVPVNTHDSGVKPYFEQKIQETELRIRTKTANLRRLEA
FT                   QRNALNDKVRFIKDELRLLQEPGSYVGEVVKVVSDKKVLVKIQPEGKYIVDIAKDINVK
FT                   DLKVSQRVCLKSDSYVLHKVLENKVDPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVI
FT                   ELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYI
FT                   GEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRTMLELLNQLDG
FT                   FETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRIHSRKMNLTRG
FT                   INLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMNKNDETAIS
FT                   VAKLFK"
     atggcagcta ttcaggtgag cacggttccc gtgaacacgc acgacagcgg cgtaaagccg        60
     tactttgagc agaagatcca ggagaccgag ctgcggatac ggaccaagac cgccaacctg       120
     cggcggctgg aggcccagcg caacgcgctg aacgacaagg tgcggttcat caaggacgag       180
     ctgcggctgc tgcaggagcc ggggtcctac gtcggcgagg tggtcaaggt tgtgagcgac       240
     aagaaggtgc tggtcaagat acagccggag gggaagtaca ttgtggacat cgccaaggac       300
     atcaacgtca aggacctcaa ggtgtcgcag cgcgtgtgcc tcaagagcga ctcgtatgtg       360
     ctgcacaagg tgctggagaa caaggtggac ccgctggtgt cgcttatgat ggtggagaag       420
     gtgccggact cgacgtatga catggtgggc ggcctgacga agcagataaa ggagatcaag       480
     gaggtgatcg agctcccggt gaagcacccg gagctgttcg agagcctggg catcgcccag       540
     cccaagggcg tgatcctgta cggcccaccc ggcaccggca agacgctgct cgcgcgcgcg       600
     gtcgcgcacc acaccgactg caagttcatc cgcgtgtcgg gcgccgagct cgtgcagaag       660
     tacattggcg agggctcgcg catggtccgc gagctctttg tcatggcgcg cgaacatgcg       720
     ccgtctatca tcttcatgga cgagatcgac tccatcggct ccagccgcgt cgagggcggc       780
     tccggcggcg gcgactccga ggtccagcgc accatgctcg agctgctcaa ccagctcgac       840
     ggcttcgaga cctctaagaa catcaagatc atcatggcca ccaaccgtct ggacatcctc       900
     gaccctgccc tgctgcgtcc gggccgcatc gaccgtaaga tcgagtttcc cccacccacc       960
     gtcgccgccc gcaccgagat cctgcgcatc cactcgcgga agatgaatct cacgcgcggc      1020
     atcaacctgc gcaagatcgc cgagaagatg aacgggtgct cgggcgccga cgtcaagggt      1080
     gtgtgcaccg aggcgggcat gtacgcgctc cgcgaacgcc gcatccacgt cacccaggag      1140
     gacttcgaac tcgccgtcgc caaggtcatg aacaagaacg acgagaccgc catctccgtc      1200
     gccaagctct ttaagtag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page