(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE334

ASHGO_7.PE334        Location/Qualifiers
FT   CDS_pept        943947..944558
FT                   /codon_start=1
FT                   /gene_family="HOG000192807" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079308"
FT                   /gene_name="ALG13"
FT                   /locus_tag="AGL042W"
FT                   /product="UDP-N-acetylglucosamine transferase subunit ALG13"
FT                   /EC_number="2.4.1.141"
FT                   /function="N-acetylglucosaminyldiphosphodolichol N-
FT                   acetylglucosaminyltransferase activity"
FT                   /function="carbohydrate binding"
FT                   /biological_process="lipid glycosylation"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="AAS54448.1"
FT                   /db_xref="GO:0004577"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0030259"
FT                   /db_xref="HOGENOM:HBG298336"
FT                   /db_xref="HOGENOM:HBG629711"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniParc:UPI0000253435"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750J3"
FT                   /transl_table=1
FT                   /translation="MSTTTKSKMEGPKTVVVTCGATVPFPGLVNAVLDRRVLAELAQCG
FT                   FSRVMVQYGRGFAAEFERQVGAAGAVRAACDAEGLEGCDAHAWRWQGLEIIGFAFHAQM
FT                   ESLIGTSAALVVSHAGTGSILDALRQQKPLIVCVNEALLDNHQEQIARRFEALGHLWAI
FT                   RADVDELAGALARSTRETLAPLPPAYKQGFAELLQDVAHR"
     atgagcacaa cgacgaagag caaaatggag ggccccaaga ccgtggtggt cacgtgtgga        60
     gcgacggtgc cgttcccagg gctggtgaat gcggtgctcg accgccgggt gctcgcagaa       120
     ctggcgcagt gcgggttctc gcgggttatg gtgcagtacg ggcgcgggtt cgcagcggaa       180
     ttcgagcgcc aggtgggcgc ggccggcgcg gtgcgtgcgg cgtgtgatgc ggagggccta       240
     gagggctgcg atgcgcatgc gtggcgctgg caggggctgg agatcatcgg gttcgcgttt       300
     cacgcgcaga tggagagcct cattgggacg agcgcggcgc tggtggtgtc gcacgcgggg       360
     acgggcagca tcctggacgc gctgcggcag cagaagccgc tgatcgtttg cgtgaacgag       420
     gcgctgctgg acaaccacca ggagcagatc gcgcgccggt tcgaggcgct ggggcacctg       480
     tgggcgatcc gcgcggacgt ggacgaattg gccggggcgc tggcgcgcag cacgcgcgag       540
     actctggcgc cgctgccgcc ggcgtacaag caaggctttg ccgagttgct gcaagatgta       600
     gctcatcgct ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page