(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE355

ASHGO_7.PE355        Location/Qualifiers
FT   CDS_pept        998909..999547
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928317"
FT                   /locus_tag="AGL021W"
FT                   /orf_name="AGOS_AGL021W"
FT                   /product="AGL021Wp"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="AAS54469.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:121P"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000025344A"
FT                   /db_xref="UniProtKB/TrEMBL:Q750L3"
FT                   /transl_table=1
FT                   /translation="MSGLRTVSSSSGAKNYDSIMKILLVGDSGVGKSCLLVRFVEDKFS
FT                   PSFITTIGIDFKIKAVDINGKKIKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDE
FT                   RTFENIRQWFTTVNQHANEEAQLLLVGNKKDMDTRAVTYEQGESLAKELGVPFIEASAK
FT                   DDENVSDIFFTLAKLIQEKIDNDKLVNNSGREGSVNISSGSNMPSSNCC"
     atgtcggggc taagaacggt gtcgtcgtcc agcggggcta agaactacga ctcgatcatg        60
     aagatattgc tcgtggggga ttccggcgtg ggcaagtcgt gcttgctcgt gcggtttgtg       120
     gaggacaagt tcagtccctc gttcatcacc acgatcggga tcgacttcaa aatcaaggcg       180
     gtggacatca acggcaagaa gatcaagctt cagctctggg acacggcggg acaggagcgg       240
     ttccggacga tcaccaccgc gtactaccgg ggtgcgatgg ggatcatctt ggtgtacgac       300
     gtgacggacg agcgcacgtt cgagaacatc cgccagtggt tcacgacggt caaccagcac       360
     gcgaacgagg aggcgcagct cttgttggtg ggcaacaaga aggacatgga cacccgcgcg       420
     gtgacgtacg agcaggggga gagcttggcc aaggagctcg gcgtgccgtt catcgaggcc       480
     agtgccaagg acgacgagaa cgtgagcgac atcttcttca cgctggctaa gctcatccaa       540
     gagaagatcg acaacgacaa gttggtcaac aacagcggca gagaggggag cgtgaacatc       600
     tcgtcgggca gcaacatgcc ctcgtccaac tgttgctag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page