(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE358

ASHGO_7.PE358        Location/Qualifiers
FT   CDS_pept        complement(1005021..1006043)
FT                   /codon_start=1
FT                   /gene_family="HOG000085952" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751266"
FT                   /locus_tag="AGL018C"
FT                   /orf_name="AGOS_AGL018C"
FT                   /product="AGL018Cp"
FT                   /function="NAD+ binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="AAS54472.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG267174"
FT                   /db_xref="HOGENOM:HBG641281"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="UniParc:UPI000025344D"
FT                   /db_xref="UniProtKB/TrEMBL:Q750H1"
FT                   /transl_table=1
FT                   /translation="MDPQELASINKVAKYIKNHPKAKVVFLVGAGISTSCGIPDFRSPN
FT                   TGLYHNLSKFKLPYAEAVFAIDYFQRDPKPFYTLAREMYPGKYIPSRFHYLMKLFESKG
FT                   YLKAVYTQNIDTLEREAGIAADYIIEAHGSFATNHCIDCDKTFPTETFKAMLESGEYAR
FT                   CEDCEGLIKPRIVFFGEDLPSVFYTSWDKLLSEMQAGKEDYLVIVAGTSLVVYPFASLP
FT                   SETPRKVHRVLMNMEVVGDFKTPRKTDIIIHGETDHIAEELARALGWYDELVDISSGRS
FT                   SSETTVVEKDTENQTDIKSASASVIKYKEVSSVSKEESSIDKIAEKILKLDLSRENSDD
FT                   "
     atggatcctc aagaacttgc tagcatcaac aaggttgcca agtatatcaa gaaccacccg        60
     aaagccaagg ttgtattcct ggtaggcgct ggaatctcca cttcttgcgg gattcccgac       120
     tttcgttcgc ccaacacagg gctctaccac aacttatcca agttcaagtt accatatgct       180
     gaggcagtat ttgcgatcga ctattttcag cgggatccca aacccttcta cactctggcc       240
     cgcgagatgt acccagggaa atatattcca tctcgctttc actacctcat gaaactattc       300
     gagtccaaag gatacctgaa ggctgtatac actcagaaca tagacacttt ggagcgcgaa       360
     gcaggtattg cagcggacta tatcattgaa gcgcatggct cttttgcaac taaccactgt       420
     atcgattgtg acaaaacgtt tccgacagag actttcaagg ccatgctgga aagcggcgag       480
     tatgcgcgtt gtgaggactg tgaaggcttg attaagccca ggattgtatt cttcggtgaa       540
     gatcttccgt ccgtgtttta tacttcttgg gataagttac tgagcgaaat gcaagctgga       600
     aaggaagact atctggttat agtagccggt acatcactcg ttgtatatcc tttcgcatcg       660
     ctcccttcag aaacaccgcg gaaggtccat cgtgtgctga tgaatatgga agtggtgggc       720
     gattttaaaa ccccgaggaa aacggatatc attattcatg gcgaaacaga tcatattgcg       780
     gaagaactgg cgcgagcact gggctggtat gatgaactag tagatatttc atctggacgc       840
     tcctcctcgg aaacaactgt tgttgagaag gatactgaga atcagacaga tattaagagc       900
     gctagtgcaa gtgtcataaa atacaaggag gtatcttcgg ttagcaaaga ggaaagttcc       960
     atagataaga ttgccgagaa gatccttaag ttggatctca gcagggagaa ttctgatgat      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page