(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE375

ASHGO_7.PE375        Location/Qualifiers
FT   CDS_pept        1036882..1038057
FT                   /codon_start=1
FT                   /gene_family="HOG000074728" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751276"
FT                   /gene_name="HAT1"
FT                   /locus_tag="AGL001W"
FT                   /product="Histone acetyltransferase type B catalytic
FT                   subunit"
FT                   /EC_number="2.3.1.48"
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin silencing at telomere "
FT                   /biological_process="histone acetylation"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="histone acetyltransferase complex "
FT                   /protein_id="AAS54489.2"
FT                   /db_xref="GO:0000123"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006348"
FT                   /db_xref="GO:0016573"
FT                   /db_xref="HOGENOM:HBG197707"
FT                   /db_xref="HOGENOM:HBG738699"
FT                   /db_xref="InterPro:IPR013523"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017380"
FT                   /db_xref="InterPro:IPR019467"
FT                   /db_xref="UniParc:UPI0001DB2C66"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750F5"
FT                   /transl_table=1
FT                   /translation="MAEELKPELWTTSSNSALKLSLVNDENAVQFSPIFTYPIFGQAEQ
FT                   LFGYQDLNILLAFDSVTFKPFLNIKYTKKLERGLDDVEGSILKFLPEGDVILKDEVEWV
FT                   DAFNGEREKFALPNSESKVAEYTSGGESFAIFKVHLSDPNIRQLHRRMQIFTLLFIEAA
FT                   SYIDEDDSAWDIFMTFNTSTRQCIGYTTTYKHWRYINGQEFDSSEKTTKRAKISQFIIF
FT                   PPYQSKSHGSHLYSAAIDVWSKEEKISEVTVEDPNEAFDDLRDRCDFMRLSGSGLSSSI
FT                   PEDVPIPRTWLTEQARKYKLSLVQFTRLVEMILLYDNSPNFEIQVKARLYQKNHEVLTG
FT                   MDSDTRKAKLQEAFTSLKEDYARILQKVPNRRRVLPSDEENAGESKRHKKE"
     atggctgaag aattgaagcc agagctatgg actacgtcta gcaattcagc attaaagttg        60
     tcacttgtta atgatgaaaa tgctgtccaa ttctcaccta tattcactta tcctattttc       120
     ggtcaagctg aacaactatt tggctaccaa gacctgaata tactactcgc cttcgattca       180
     gttacattca aacccttcct caacatcaaa tataccaaga aacttgagcg tggacttgat       240
     gatgttgaag gttccatatt gaagttcctt ccagaaggag atgttatctt gaaagatgag       300
     gtggagtggg tcgatgcgtt caatggtgaa agagagaaat ttgctctacc aaacagtgaa       360
     tcgaaagttg cagaatacac ttctggcgga gaatcgtttg ccatttttaa ggttcacttg       420
     tcagacccta acataagaca gctgcataga cggatgcaga tattcactct tctttttatc       480
     gaagccgcat cctacatcga tgaggacgac tccgcatggg atatttttat gacgttcaat       540
     acatctactc gtcaatgtat tggatacaca actacgtata agcactggag gtacatcaat       600
     ggccaggaat ttgacagctc agaaaagacc accaagaggg caaagatatc ccaattcata       660
     atttttcctc catatcagtc aaagtcacat ggtagtcatt tgtattccgc ggcgattgat       720
     gtgtggtcta aagaggagaa aatatctgaa gtgactgtag aagatccaaa cgaagcgttt       780
     gatgatctta gagatcgttg cgatttcatg agattgtctg gttctggact atcaagctcg       840
     attccagaag atgttcccat accgaggacg tggttaactg aacaagcacg caaatacaag       900
     ttatccctag tacaatttac gcggttagta gaaatgattc tactatatga taattctcca       960
     aatttcgaaa tacaggtgaa ggctagactg tatcagaaaa accatgaggt tttaacaggc      1020
     atggatagcg acacaaggaa agctaagcta caagaagctt ttacttcgct gaaggaggac      1080
     tatgctcgta tattgcaaaa agtgcctaac agaagacgtg tactacctag tgatgaggaa      1140
     aacgcaggag agtctaagag acacaaaaaa gagtag                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page