(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE381

ASHGO_7.PE381        Location/Qualifiers
FT   CDS_pept        1047366..1048301
FT                   /codon_start=1
FT                   /gene_family="HOG000183690" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775324"
FT                   /gene_name="RPN11"
FT                   /locus_tag="AGR006W"
FT                   /product="26S proteasome regulatory subunit RPN11 "
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="AAS54495.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="HOGENOM:HBG346862"
FT                   /db_xref="HOGENOM:HBG499867"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI0000253464"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750E9"
FT                   /transl_table=1
FT                   /translation="MDRLQRLMMSQRSNMIGAAATEMPLDDTKETVYISSLALLKMLKH
FT                   SRAGVPMEVMGLMLGDFVDEYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTG
FT                   RDQMVVGWYHSHPGFGCWLSSVDVDTQRSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRL
FT                   ISPATVVRNQEPRQTTSNVGLLNKPNIQSLIHGLNRHYYSLNIDYHKTSAELNMLMNLH
FT                   KEQWQSGLKMHDYKEKERINLEATKKSVRIAEQYTKRIEEEKELTEDELKTRYVGKQDP
FT                   KKHLSETAERVLEENIVSVLTAGVNSVAIK"
     atggatagat tacagagact aatgatgagc caaaggtcga atatgatcgg cgcggcggcg        60
     acagaaatgc cgttggatga taccaaggag acggtgtata tctcttcttt ggctctttta       120
     aagatgctga aacacagcag ggcgggcgtg cccatggagg tgatggggct gatgctgggg       180
     gactttgtgg atgagtacac ggtcaatgtg gtggacgtgt ttgccatgcc gcagtccgga       240
     acaggcgtgt cggtggaggc cgtggacgat gttttccagg cgaagatgat ggacatgtta       300
     aagcagactg gcagggacca gatggtagtt ggctggtacc actcgcaccc gggttttggg       360
     tgctggctgt catcggtgga cgtggacaca cagcggtcgt ttgagcagtt gaatagccgg       420
     gccgtggcgg tagtggttga cccaatacag tccgtgaagg gtaaggtggt tattgatgca       480
     ttcaggctga tcagccccgc gactgttgtg cggaaccagg agcccagaca gacgacctcg       540
     aacgtcggtc tgctaaataa gcccaacatc cagtcgctca tccacggtct caacagacac       600
     tactattctc taaacatcga ctatcacaag acttcggcgg agttgaacat gctgatgaac       660
     ctacacaaag agcagtggca gtcgggcttg aagatgcacg actacaagga aaaggaaagg       720
     attaatttgg aggcgacgaa aaagtcggtg cgcatcgctg agcagtatac caagcggatt       780
     gaagaagaga aggagctaac cgaggatgaa ctgaagacac ggtacgtggg gaagcaggac       840
     cccaagaagc atctctccga gacggcagaa agagtcttgg aggagaatat tgtgtctgtg       900
     ctaacagcgg gcgtcaattc ggtggccatt aagtaa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page