(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE398

ASHGO_7.PE398        Location/Qualifiers
FT   CDS_pept        complement(1074114..1076456)
FT                   /codon_start=1
FT                   /gene_family="HOG000162311" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775327"
FT                   /locus_tag="AGR023C"
FT                   /orf_name="AGOS_AGR023C"
FT                   /product="AGR023Cp"
FT                   /function="cysteine-type peptidase activity"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAS54512.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG371766"
FT                   /db_xref="HOGENOM:HBG746888"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016652"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI0000253475"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D2"
FT                   /transl_table=1
FT                   /translation="MCEVVKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNI
FT                   CLGCFQSFCHEHVNLHQQVVRRVQQATHDLYLNVYKIERPKATESAEKRLKLEVQDLSE
FT                   EELYETVWSLVRINNACTARLGSSKQKQKMDTTVVSKLEQIIRTRSSDFKDMAATWQLE
FT                   IKACPHSEQFVVPQDAMPVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKH
FT                   YQQSENNHPLAVKLGSLTSESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKE
FT                   KTLVELQVEQNMNWDFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGG
FT                   VKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNE
FT                   EFSSGRQQDAMEFLTYFIDKLDRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSSQ
FT                   VCEILQIPLLDSNDPQFLMDRLHSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLI
FT                   NPIRIKLQNWTPIKTSNQLFVPGLRDEKRLKLSQFKAHGRQPGEKIFEDSPDDNSNVPA
FT                   SAISFNPDEDKVISIISMGFSKNAALRALYNTGSEVERALNWIFEHMEDPELNAEFSVP
FT                   GTKKQAAVVDQGALDSMVSMGLAERHCRKALILNDGDVTRSVEWVFNNADNLDDDDTQE
FT                   SIDPPVSRDYGYPGDIPDYALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKL
FT                   MAVGGNENLQEIEKNGYIFIFNRIAPA"
     atgtgtgagg tagtgaagca actaaagatc cctagtacca tatataagga tgattgtggt        60
     tactgttttg aaacgatgat taaccccaac tttggcgatg gtggccctgc ggaacccgag       120
     caccagctta atatttgtct agggtgcttt caaagcttct gccatgagca cgtcaactta       180
     caccagcagg tcgtgcgccg ggtgcagcaa gcaactcacg atctctacct caacgtctac       240
     aagatcgaaa ggccgaaggc caccgagtcg gcggaaaagc gactaaaact cgaggtgcag       300
     gacctttcag aagaggagct gtatgagact gtctggtcgt tggtccggat caacaatgcg       360
     tgtacggcaa ggcttggcag cagcaagcag aagcagaaga tggacacaac ggtggtgagc       420
     aagctagaac agatcattcg cactagatcc tccgacttca aagatatggc cgcaacatgg       480
     cagctagaaa tcaaagcttg tccgcatagt gagcagtttg ttgtgccgca ggatgccatg       540
     ccagtccgcg aaacctgcgg tgattgtgat ttggaccgga acttatggct ctgccttcac       600
     tgcggaaaca ttggctgtgg tcgggagcaa gtaggtattg aaggacactc acatgctctg       660
     aaacactacc agcagagcga gaacaaccac cccttggctg taaaactagg ctctctgaca       720
     agtgaatcta acgatatcta ctgttattcc tgtaatgatg aggtggcgtt tcctgatcca       780
     aaccgattct ctgcagtttt ggcgaagttt ggtatcgatt tggagggcca ggtcgcaaag       840
     gagaagactc tagtggagtt acaagtggaa cagaacatga attgggactt ccagatgcgt       900
     gattcaggaa acgagttcac caagaaaata tttgcatcta aggagtacgg atgcggtcta       960
     attaacctcg ggaattcatg ttacttgaat tctgttgtgc aagtcttgtt caatggtggt      1020
     gtgaaggatt ggaaccttga tatgttgggg gatttcccga gggatgtggt cttcccatct      1080
     actaacctga aatgccagct aatcaagctt cgcaacgccc taaagattca tccagagaaa      1140
     tatcagcacg gggttaagcc tgccagtgtc aagaaatgca tcggcgagga taatgaagag      1200
     tttagctctg gcaggcagca ggatgcgatg gaattcttga catacttcat tgacaaactt      1260
     gacagaaagg tatttagcaa ggcttcctcc tccaacccaa acgaccttat gaggttcatg      1320
     gtggaggacc gtttggagtg taccaagtgt gagcacgtta agtactcaag ccaggtatgt      1380
     gagatcttgc aaataccatt actagatagc aacgatccgc agttcctcat ggacagactc      1440
     cacagctact tcaatggaga atccttggat atccactgcc ctcagtgcag tgaaattact      1500
     gtcgccacta aaaactcgat gctcaagact gcacccgcta ccctgctcat taatcccata      1560
     aggataaaac tacaaaactg gacgcccata aagacgagca atcaactatt tgtcccaggc      1620
     ctacgcgatg agaagagact caagctcagc cagtttaagg cacatggcag gcagccgggg      1680
     gagaagatct tcgaagacag tcctgacgac aacagcaacg tccctgccag cgccatatcg      1740
     ttcaatccgg atgaagataa ggttatttcc atcatcagca tgggcttcag caagaacgcc      1800
     gctcttcgtg cactatacaa cacgggctca gaggttgaac gggctttgaa ttggattttc      1860
     gagcacatgg aagacccgga acttaacgcc gaattcagcg tgcccggcac caagaaacag      1920
     gccgccgtcg tagatcaggg cgccctcgac agcatggtct ccatgggtct tgcggagcgc      1980
     cactgtcgga aggcattgat actcaacgac ggcgatgtaa cccgcagtgt cgagtgggtc      2040
     ttcaacaacg ctgacaacct cgatgacgac gacacccagg agtcgattga ccctccggta      2100
     tcccgtgact acggataccc cggtgacatc ccagactacg ctctctctgc agtgatatgc      2160
     cacaagggga actcggtaca gagcggccac tacgtcgcct tcatcaagaa ggccgtggat      2220
     ggagagccca agtgggtgct ctacaacgac gagaaactca tggccgtcgg cggtaacgag      2280
     aacctccagg aaatagagaa gaatggctac atcttcatct tcaatcgcat tgcaccggct      2340
     tag                                                                    2343
//

If you have problems or comments...

PBIL Back to PBIL home page