(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE399

ASHGO_7.PE399        Location/Qualifiers
FT   CDS_pept        complement(1076692..1078125)
FT                   /codon_start=1
FT                   /gene_family="HOG000217005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751283"
FT                   /locus_tag="AGR024C"
FT                   /orf_name="AGOS_AGR024C"
FT                   /product="AGR024Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS54513.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG383328"
FT                   /db_xref="HOGENOM:HBG748731"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="UniParc:UPI0000253476"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D1"
FT                   /transl_table=1
FT                   /translation="MIRSTVRGMVQRRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEI
FT                   CHSILPVMQEYAKSDVANVIVFDSACAPRAFCAGGDIVLMAKAMRRDMLEKVDDFFQGE
FT                   YTMNWMLATYPKPVVALMDGITMGGGVGLTIHVPFRVATENTKWAMPELDIGLHPDVGV
FT                   SFALPRIMTLGGQEGQLGYYLCLTGEVLQGADVYMAGLASHYVESTQHGALKERLGTVP
FT                   ITRKADETFANTNAVIEEFSSPLPDGYQFKYNKEELDVIERFFHYDVSYKELRKNLEAF
FT                   ASSNANSEVARNFAKATLEKLSTKSTVSAEITREQFRRNSQRDIQSAMKQDLITSTNLL
FT                   RNNELAEFENAVIHKLVEKAKTPYEWKNTSPSVADISKLLAADPANPIDLLETFGVTFK
FT                   NYRYHNKFTLPTEAAVQAYITGTDQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVN
FT                   LIIDRKCRMDNDSFLHWNY"
     atgataagaa gcaccgttag aggcatggtc cagagaaggc agatgtcgtc tttagtcaag        60
     ttcaaaacga ataacacggc ccgtgtggtc acgctcaatc ggcccgagaa gctgaacgcc       120
     atcaaccatg agatctgcca ctcgattctg ccggtgatgc aggagtacgc caaaagcgat       180
     gtggccaacg tgattgtgtt cgactctgcg tgcgcgccac gggcgttctg cgccggtggc       240
     gacatcgtgc tgatggcgaa ggccatgcgg cgggacatgc tggagaaggt ggacgacttc       300
     ttccagggcg agtacaccat gaactggatg ctggcgacgt acccgaagcc tgttgtcgcg       360
     ctgatggacg ggatcacgat gggtggcggc gtggggctga cgatccacgt gccgttccgc       420
     gtggcgaccg agaacacgaa gtgggcgatg ccagagctgg atatagggtt gcaccccgat       480
     gtgggggtgt cctttgcgct gcccaggatc atgacgctcg gcggacaaga gggccagctc       540
     gggtactacc tgtgcctgac cggcgaggtg ctccaggggg ctgacgtcta catggcgggc       600
     cttgcctcgc actatgtcga gagcacacag catggcgcgc tgaaggagcg cctcgggacg       660
     gttccgataa cccgcaaggc cgacgagacg tttgccaaca ccaacgccgt catcgaggag       720
     ttctcgtctc ctctgccaga cggctaccaa ttcaagtaca acaaggaaga attggatgtg       780
     atcgagcggt tcttccacta cgacgtctcc tacaaggaat tgcgcaagaa cctcgaggcg       840
     tttgccagtt cgaatgcgaa ctcggaagtc gcccgtaact ttgccaaggc aaccttggag       900
     aagctctcca caaagtccac cgtttctgct gagatcaccc gcgagcaatt ccgccggaac       960
     tcccaacgtg acatccagtc cgccatgaag caagacctca ttaccagcac gaacctgttg      1020
     cggaacaacg aactagcgga gttcgaaaac gcggtcatcc ataagctggt ggagaaggcc      1080
     aagacaccct acgagtggaa gaatacgtca ccttcggtcg cagatatatc caaactgcta      1140
     gctgcggacc cagccaaccc aatcgacctg ctggaaacct tcggagtcac gttcaagaac      1200
     taccgttacc acaacaagtt cacgctcccc accgaagccg cggtccaggc atacatcacc      1260
     ggcactgacc agtctggcag gtcaatggcc gttacaaggg cggagactgt caagtatttc      1320
     acggaattta accctgtaag ccggggtaaa gttggtactg aatatgttgt caacttgatc      1380
     atcgaccgga aatgcagaat ggataatgat tccttcctac actggaacta ttag            1434
//

If you have problems or comments...

PBIL Back to PBIL home page