(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE402

ASHGO_7.PE402        Location/Qualifiers
FT   CDS_pept        complement(1080453..1083338)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622780"
FT                   /locus_tag="AGR027C"
FT                   /orf_name="AGOS_AGR027C"
FT                   /product="AGR027Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS54516.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG059887"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000186176"
FT                   /db_xref="UniProtKB/TrEMBL:Q750C8"
FT                   /transl_table=1
FT                   /translation="MSKRHTGEQSSPTEPVPGTGALTGPLEMLQAGSTVLVGVHQVEVI
FT                   EYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDENGLNELRNEVEVM
FT                   KKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVL
FT                   KIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEI
FT                   AMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFA
FT                   ILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMECEVKIDDLYGQG
FT                   PYNFDMYGRYQEKLQRLQYDMLMSHQLAQRGIINTDKVNDLFISTFECAPKQPMVMGQN
FT                   AVAQQQIFVAPPSTNTSMPVDMQQSLPKPLDHNGPNAHGGLDSLQKLPKSADVGNYPVA
FT                   ETHMHMYADAQKNYIQVPRKEVMMQHTDRSVLSDHSGNGTSTPSLPGSCPVQHEQLANT
FT                   PKSKQYKKNNPFPKMAKQDFVHDTYDESDEHSPGDDPAPASKPVDSMIPSVPATVTPMV
FT                   SVQRDRSFQHIQPGQIPENVRECEPESEVEMDLSHKIQNCNLDQQQSLQAQDLKLQQIL
FT                   LHQQQLQHRQYQQQNDNRQQHAQRLHDQMPHQQRQQLPLQMHLRPQHPCSNNVPLHKTL
FT                   AEQAYQLSDSTQPQPQPQYQAYYVDRKTAVPFQTYSNAYTQNQHVFPQQSSRGTYGTSD
FT                   RIQNGSNQLIEFSSPDKSANDAQLDLTYNQINLSKPNSVGGGDPSENASVELNGSGSSV
FT                   LTNESIAMELPNAEERPVPPSTSGATQPAENIHSRQESDSYHDREDSRHVTGHVPRRSL
FT                   ELDFQEIDLSSSPTPVSASKTSSKAHLQPNRSGTANCGTSNSSSVVSGVRKSFHRGRKS
FT                   VDLDVSKKESKEEPTNSGSGKRRSIFGVFKS"
     atgagcaaga gacacacagg agaacaaagc tcgcccacgg agcccgttcc gggcaccggg        60
     gcgctcacag ggccattgga gatgctgcag gcaggcagta cagtccttgt cggtgtgcac       120
     caggtcgagg tgattgaata cctggcggag ggggggtttg cgcacattta caaggtgtct       180
     tttgttgggt acacgaacga gctcgacagg caagaccgga tcctgcagcc aggcgacaca       240
     gtgtgtctca agcgcgtgcg tgtgagcgac gagaacggac tgaatgagct gcgcaacgag       300
     gtggaagtga tgaaaaagct acgtaattgc agtaacatcg tgcagtacta cgactcgaat       360
     gcgtcgcgcc tgggggatgg gaagccgggc tatgaggtgc tccttctgat ggagctctgc       420
     cccaatggat cgctgcttga ctacatgaac cagcggctgg cgaccaagtt gtcggaagcg       480
     gaagtgctga agatcatgta tgacatcacc gtgggtctct cgcacatgca ctaccagcgc       540
     acaccgctga tccaccgcga catcaagatt gagaacgtgc tggtggacgc agacaacaac       600
     ttcaaactgt gcgactttgg gtccacgtct ccatgtttgc cggcggtcgc cagtcaccag       660
     gagatcgcga tgctcatgaa caacatatat gtgcacacca cgccacagta tcggtcgccg       720
     gagatgattg atttataccg ctgtctgccg atcaatgaaa agtcggacat ctgggccttg       780
     gggatttttc tgtacaagct gctcttttat actacaccat ttgaattgac aggtcagttt       840
     gcaatcttac actccaagta tgaaataccg cggaatagct tctcgtccaa actaatcaat       900
     ttggtgatca ttatgctggc tgagaatcct tatttgcgtc cgaatgtgta ccaagtgatg       960
     tatcatattt gctctatgat ggaatgcgaa gtcaaaatag acgacctcta tggccagggg      1020
     ccatacaatt ttgatatgta tgggcgatac caagaaaagc tacaacgcct gcaatatgat      1080
     atgttgatgt ctcaccagct ggcgcagagg gggattatca acactgacaa agtaaatgat      1140
     ctttttatta gcacctttga gtgcgctccg aagcaaccaa tggtaatggg ccagaatgcc      1200
     gtggcacagc aacagatttt cgttgcgcca ccatccacga atacctccat gccagtcgat      1260
     atgcagcagt ccttaccgaa gcctttggat cataatggac ctaacgcgca tgggggttta      1320
     gattcattgc agaaattacc aaaatcagcg gatgttggca attatcctgt tgcggaaacc      1380
     catatgcata tgtatgctga cgcccagaaa aattatatcc aggttccaag gaaggaggtt      1440
     atgatgcagc atacagatcg ctctgtattg tctgatcatt ccggcaatgg tacatctact      1500
     ccatcattac ctggctcctg ccccgttcaa catgaacaac ttgctaacac accaaagtcc      1560
     aaacagtata agaaaaacaa tcccttccct aaaatggcta aacaggactt cgtgcacgac      1620
     acctacgatg agagcgacga gcactcgccg ggcgatgatc ctgccccagc aagcaagcct      1680
     gttgacagta tgatcccctc tgtcccagct accgtaacgc ctatggtgtc cgtccagcgc      1740
     gaccgctctt tccagcatat ccagccaggt cagattccag aaaacgtgcg cgaatgcgag      1800
     ccagaaagtg aggttgagat ggatttgagc cataaaatcc aaaactgtaa cttggatcag      1860
     cagcagtctc tccaggctca ggacctcaag ctgcagcaga ttctcctcca tcagcaacaa      1920
     ctccagcatc gacaatacca acaacagaat gataatcgcc agcagcatgc acagcgtttg      1980
     catgaccaga tgccacatca acagcggcag caattgccgc tccaaatgca tttgcggccg      2040
     cagcacccgt gtagtaacaa tgtgccgttg cataagacgt tggcggaaca ggcttaccaa      2100
     ctttccgatt ccacacagcc gcagccgcag ccgcaatatc aagcctacta tgttgatagg      2160
     aagacggctg tgcccttcca aacttacagc aacgcctaca cccaaaatca gcacgtgttc      2220
     cctcagcagt cttcaagagg cacttacggt acctctgaca gaatacagaa tggcagcaac      2280
     caactcatag aattttcgtc gcctgataag tctgcgaacg atgcacaatt ggatctgact      2340
     tataaccaga ttaacctgtc gaaaccaaac tctgtcggcg gcggcgaccc cagcgaaaac      2400
     gccagtgtcg agttgaacgg ctccggtagc agcgttctaa cgaacgagag tatcgcaatg      2460
     gaattaccca atgccgaaga gagaccagtg cccccctcga cgtccggcgc cacgcagccc      2520
     gctgaaaaca ttcattctcg ccaagagagt gatagctacc atgaccgaga agacagtcgc      2580
     catgtgactg gccacgttcc caggcgctct cttgagctgg acttccagga aattgatctg      2640
     tcttcctctc caacgccggt ttctgcgtcc aagacatcct cgaaggcaca tctacagcca      2700
     aaccgctctg gcacggccaa ctgtggcaca agtaacagca gcagcgtcgt gagcggcgtg      2760
     cgcaagtcct tccacagagg gaggaaatca gtcgacttgg atgtctcgaa gaaagagtcg      2820
     aaagaagaac ccaccaactc aggttccggt aagaggcgtt cgatttttgg tgtcttcaag      2880
     agttaa                                                                 2886
//

If you have problems or comments...

PBIL Back to PBIL home page