(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE413

ASHGO_7.PE413        Location/Qualifiers
FT   CDS_pept        complement(1094678..1096420)
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775331"
FT                   /locus_tag="AGR038C"
FT                   /orf_name="AGOS_AGR038C"
FT                   /product="AGR038Cp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54527.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000253483"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B9"
FT                   /transl_table=1
FT                   /translation="MSADSVNKFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTS
FT                   RSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIG
FT                   YLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPL
FT                   ELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFV
FT                   IVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYAL
FT                   SVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYV
FT                   LAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGR
FT                   PLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQ
FT                   GRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPL
FT                   WLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNSPWYVKVL
FT                   NFWC"
     atgtcagcag attctgtgaa taagttcaac gagaaaaccg ttgtgcaaac agcatacagc        60
     ccgagctacg cgagccccga gtcgacgggg ccgttccggc ggttcgtgga ctcgttccgg       120
     cgggaagaca cgtcgcggag tggggacctg gaggacggcg agatcaactc gacggacaca       180
     accaagctgc agcagaggat gcgcacgcgg catgtggtga tgatgtcgct gggtactggt       240
     atcgggacgg gcctgctcgt tgcgaatgca gcgtctctac attacggtgg accagcaggc       300
     ttgttgatcg ggtatctgtt ggtctccatt gtctcctata tcatgatgca tgcggccggc       360
     gagatggccg tggcctaccc tacgttgccg ggcaacttca acgcttactc atcgattttc       420
     atctccaagc cgttcggatt tgccacggtg tggctgttct gtctgcagtg gctgacggtg       480
     ttcccattgg agctgatcac ggcgaccatc gtcatcaagt actggaaagt ttctgtgaac       540
     gcgaatgtgt tcgtggtaat cttctacctg ttcatcatct gtatccactt ctttggtgcg       600
     cgcggctacg gcgaaaccga gttcatcttc aacatgtgca aggttctgat gattgtggga       660
     tttgtgattg tgggcatctt gatcaacgtc ggcgcgattg gcgataccgg ctacatcggc       720
     gaccgctact ggcggaaccc cggctccttc gtctcgggga cgccgctcga taaactgaag       780
     ggcactgcat acgtgctcgt caccgcttac ttttcgttcg gtggtatgga gctgtacgcc       840
     ctgtcagtca atgagctacc caacccgaag acagccatcc caagcgcctg taagaagggt       900
     gtgtaccgga tcctgttggt ttatttgctc accatgatca tgattgggtt cctagttccc       960
     cacgatagcg atcggttaat ggggtcgggc agcaacgatg tccacccatc gccatacgtt      1020
     ctggctatcg agatgcacgg tgtgaaggtg cttccgcaca ttgtcaacgc cgttatcctc      1080
     atctcggtca tctcggttgg caactccgcg atgtactcgg cgcccagact gttgtgtgcg      1140
     ttggcacagc agggctacgc tcccaagcag ttagactaca ttgacagaga aggtcggccg      1200
     ttgatctccc tgatcctatg tgccatattc gggctaattg ccttttcagc tgcatccgat      1260
     aatcaggaaa agattttcat ctggcttgcg gccatcgccg gtctctctga gctgttcaca      1320
     tggacgtcga tctgcctctc gcatttcaga ttccggcaag ctatgaagct tcagggcaga      1380
     tcactggaaa ctcttgggta ccgtgccatc accgggcaat ggggctcgct atatgccgtc      1440
     tttttcaacc tccttgtctt tattgcccag ttctgggttg ccctagttcc aattgcaaag      1500
     aaaaaggtgg atgttctgtc tttcttccag aactacatgg ctttcccgct gtggttaatc      1560
     atgttccttg gctacatggt gtatagccgg aactggaccc tcctcaaccc actggacaag      1620
     atggacttgg acacccatcg cagggtctac gacgtggagg tcctgaaaca ggaggagtac      1680
     gagttcaagg aacggatgag aaacagtcct tggtacgtca aagtattgaa tttttggtgt      1740
     taa                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page