(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE414

ASHGO_7.PE414        Location/Qualifiers
FT   CDS_pept        complement(1096869..1098629)
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751289"
FT                   /locus_tag="AGR039C"
FT                   /orf_name="AGOS_AGR039C"
FT                   /product="AGR039Cp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54528.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000253484"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B8"
FT                   /transl_table=1
FT                   /translation="MSGFVSDKPAVPKATSDSSSSAVSIEYAGNRNAWTRFTDSFKRAQ
FT                   VDTAVDLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPA
FT                   GLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWA
FT                   TVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLL
FT                   MAGFIIMAISLTAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSE
FT                   FIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSR
FT                   ASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYV
FT                   DRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRR
FT                   AMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQN
FT                   YLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRNST
FT                   LFKRLLDFWC"
     atgtcaggct ttgtatcaga taagcctgcg gtaccaaagg caaccagtga ctcctccagc        60
     agcgctgtct cgatagaata cgccgggaat cgcaatgcat ggacgaggtt cactgattcg       120
     ttcaagcgtg cccaagtcga cacggcggtg gacttggagg ggaaagatgc tgataatgga       180
     ctgaataaaa cccagcagac gttgaaacac aatatcaaga cccggcacct gactatgatt       240
     tcgctcggga cgggtattgg caccggtctt cttgtcgcct ctggtaaggc gttgcatttt       300
     ggcggacccg ctgggctggt gatcggctac gttactacat ccacaatgct ttactgtgtt       360
     gtccaggcat gttgtgagct tggcgtagca tacgctacac ttcccggaaa ctacaatgca       420
     taccccacgt ttttggtcga taagggtttt ggctttgctg tggcgctggt ttatgggttg       480
     cagtgggcca cggttcttcc tttagagctg gtgactgctt cgatgacggt gaaatactgg       540
     acatcgagcg tcaatcctga tgtcttcgtc gccatcttct acgtcttctt gctcttcatc       600
     cacttcttcg gctccagagg ttacgccgaa gctgagttca tcttcaattc gctaaaagtg       660
     ttgctgatgg ccgggtttat cattatggct atttctctaa ccgcgggtgc ctccgaacag       720
     ggctacatcg ggggacagta ctggcacgac ccgggtgcct ttggaggcga tcgtgccatc       780
     gacaggttca agggcatctg ctccgtgtgg gtgcaggccg cgttcgcgta tggcggttcc       840
     gagttcatcg ccctgaccgc agcagagcag gcaaacccca gggaatcggt tcccaaggcc       900
     accaagagat ggctatacag agtcgtcgtc gtgtttctgc tccccgtcat tctgatcggc       960
     ttcctggtcc cacacaactc agaccagctg ttgtccgccg agggtggctc cggcagccgc      1020
     gcgtcgccgt tcgtgatcgc agccgcgctg cacggcgtcc gagtcgtgcc gcacatcatc      1080
     aacttcatca ttctgacgtc cgtgatctct gtcggcaact ccgccatgta ctccgcgccc      1140
     cgcatcctgc tgtcgcttgc cgaacacggt atgtgcccca agatcttcac ctacgtcgac      1200
     agacagggcc ggccgcttgt gactctgatt ttcgtttcgc tattcggtct catcgccttc      1260
     gtcgccgcct ccaaccagga ggagaacgtc ttcacctggc tcagcgccat cgccggtcta      1320
     tcccagctct tcacctggac cgctatcgcc gtctcgcacg tgcgcttccg ccgcgccatg      1380
     cgcgtgcagg gcaggtcgct aggggagctc ggctaccgcg ccaacaccgg cgcactgggc      1440
     tcctactacg ccatcttctt taacgtcatc gtcctaattg cccagttctg gattgccatc      1500
     gcgcccatcc ccaagcacgg tgagctcgac gtcgagtttt tcttccagaa ctacttggcg      1560
     ttcccggtgc tggtcgtgtt ctacctgggc tacaagctgt ggaagaggga cttccgccta      1620
     gtcatcccct ccagcgaggt cgacctgctg tcgcacagac agatctttga cgaggaggta      1680
     ttgctgcagg aggaggccga acgcaaggag aggctgagaa actccaccct cttcaagcgt      1740
     ttattggatt tctggtgtta a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page