(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE415

ASHGO_7.PE415        Location/Qualifiers
FT   CDS_pept        complement(1099432..1101153)
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622781"
FT                   /locus_tag="AGR040C"
FT                   /orf_name="AGOS_AGR040C"
FT                   /product="AGR040Cp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54529.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000253485"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B7"
FT                   /transl_table=1
FT                   /translation="MQDMTSSISSSKKDESYVKVSPNTVGSGDERRTGIMRGFIDSFRR
FT                   GRDVDLMCKADAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLI
FT                   LGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVF
FT                   PLQLVTAAMIIQYWTDINPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGF
FT                   VILGVVINCGGAGTSGYIGDKYWHEPRPFMNGFKGLCFVFCYAAFAYGGIEVMVLSASE
FT                   QENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGSRASPLVIAVSFHG
FT                   VKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFV
FT                   AMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEV
FT                   GYKARTGYWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFG
FT                   YKIYHKDWRICIPASEVDLISHRQVFDEDELKQEDLEWKLKLKSSPIWVRIYHFWC"
     atgcaagata tgacctcctc gatatcttct tccaagaagg acgagagcta cgtgaaggtc        60
     agccccaata ccgtggggtc tggcgatgag cggcgcaccg gcataatgcg gggtttcata       120
     gactcgttcc gccgcgggcg cgatgttgac ttaatgtgca aggctgacgc ggaggatggc       180
     acgaccgcga aaatgaagaa gacgattaag accaggcatc tattgatgat tacacttgga       240
     acgggtatcg gaacgggttt gcttgtgggc aatggttctg ctctagcaaa ggctgggcct       300
     gcgggtttga ttctaggata cgtagtgtcc tctgcgatgt tgtacttgat tgtcgaggcc       360
     gctggtgagc taggtatttg ctactctggg atgactggta actacactgc atactcgtcg       420
     cttctcgtgg accccgctat gggattctcc gtctcatggg tttactgtat tcagtggatg       480
     acagtcttcc cgctacagtt ggttaccgct gctatgatca ttcaatactg gacggacata       540
     aatcctgata tctttgttgc gattatctat gcagtcatcg tgttcatcaa tttgttcggt       600
     gcgaaaggat atgcggaagc agagttcttc ttcaacttgt gcaaagttct gatgattatt       660
     ggtttcgtga tcctaggtgt cgtcattaac tgtggcggtg ccggtacctc cggatacatc       720
     ggtgacaagt actggcacga acctcgtccg tttatgaacg gtttcaaggg tttatgcttt       780
     gtcttttgct acgctgcatt tgcatacggt ggtattgaag tgatggttct aagtgcatct       840
     gaacaagaga accctaggaa atccatctcc agtgcgtgca aaaaagtcat ctaccgtatt       900
     gtcctcatct acctattgac cactgtaatt gtgtgctttt tggtgcctgc agaccatcca       960
     agtttggcgt ctgagggcag tcgcgcttct ccattagtca ttgccgtctc cttccatggt      1020
     gtgaagattg ttccacatat tatcaatgct gtcatcttaa ttgctgtcgt ctctgttgga      1080
     aactcctctc tatactccgc accaagacta ttgctttctt tggcggagca gggctacgct      1140
     ccaaagatat tcacatacat cgacaggcaa ggtagaccat tgccagcctt ctttgttgcc      1200
     atggtattcg gtcttttggc cttcttggcc gcttcgccag ctcaggacga cgtcttcgga      1260
     tggttgttgg ctatctctgg tctttcgcag atgtttatct ggatgtcgat ctgtatctcg      1320
     cacattcgct tccgtgatgc catgaaggca caggggcgtt ccatgggtga ggttggttac      1380
     aaggccagaa ctggctactg gggctcgtgg atagctgtcg tcactgcttt cctcatccta      1440
     atcgcccagt tctgggtcgc catctctcct gtcgagacga aaggcgtcga cgctcgctcc      1500
     ttcttccaga gctacctagc gttccccatt ctactattgg cctacttcgg ttacaaaatc      1560
     taccataaag actggcgtat ctgcattcca gcttcggagg tcgacttaat ttcgcacaga      1620
     caagtcttcg atgaggacga gctaaagcaa gaagacctag agtggaaact aaaactaaag      1680
     agctcgccaa tttgggttag aatataccac ttctggtgtt ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page