(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE428

ASHGO_7.PE428        Location/Qualifiers
FT   CDS_pept        1131617..1132231
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751296"
FT                   /gene_name="DPB4"
FT                   /locus_tag="AGR053W"
FT                   /product="DNA polymerase epsilon subunit D "
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54542.1"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000253492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750A4"
FT                   /transl_table=1
FT                   /translation="MVCGESNAAAISAKYVDNDPLQRPAARATPANESHICDLMPPKGW
FT                   KKDAQGNYPTTSYIKEQEKLTVDDLLFPRSIITSLAKDAVHQAVQTAEQDPRVMLSKDA
FT                   SLALQRSSTVFVNHLLMHARQIAQSNDRKSCSGEDVLKALDQIGLAGFESVVRERVVEY
FT                   EKEVQRRRAEKTPAADEGQAEEGDAADEEEGSHKRAKLDEH"
     atggtctgcg gcgagagtaa cgcggcggcc atctccgcga aatatgttga caacgatccc        60
     cttcagcggc cagcagccag ggcaacgccg gcgaacgaga gtcatatctg cgatctaatg       120
     cctcccaagg gttggaagaa ggacgcacag gggaactacc ccacaacgtc atacataaaa       180
     gagcaggaga agctaacggt tgatgacttg ctcttcccga ggtccattat tacatcgctg       240
     gccaaggacg cggtacacca ggccgtgcag accgcggaac aggatccgcg cgtgatgctg       300
     tcgaaggacg cgtcgctggc gttgcagcgg tcgtcgacag tgtttgtgaa ccacctgctg       360
     atgcatgcac gtcagatcgc acagagtaac gaccgcaagt cctgcagcgg ggaggacgtg       420
     ctgaaggcgc tggaccaaat cggactggcg ggctttgaat ccgtggtgcg agagcgggtt       480
     gtggagtacg agaaggaggt gcagcgccgc cgcgcggaaa agacgccggc tgcggacgag       540
     gggcaggccg aggagggtga cgccgcggac gaggaggagg gcagtcacaa gcgcgcgaag       600
     cttgacgagc attaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page