(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE48

ASHGO_7.PE48         Location/Qualifiers
FT   CDS_pept        complement(105260..105916)
FT                   /codon_start=1
FT                   /gene_family="HOG000231400" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774752"
FT                   /locus_tag="AGL323C"
FT                   /orf_name="AGOS_AGL323C"
FT                   /product="AGL323Cp"
FT                   /function="ER retention sequence binding"
FT                   /biological_process="protein retention in ER lumen "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54168.1"
FT                   /db_xref="GO:0006621"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046923"
FT                   /db_xref="HOGENOM:HBG145091"
FT                   /db_xref="HOGENOM:HBG332839"
FT                   /db_xref="InterPro:IPR000133"
FT                   /db_xref="UniParc:UPI000025331F"
FT                   /db_xref="UniProtKB/TrEMBL:Q751M0"
FT                   /transl_table=1
FT                   /translation="MNPFRLLGDASHLASILVLISTIQRTQAIDGISLKTQVLYFVVFV
FT                   TRYLDLFTKWRSLYNTLMKVFFISSSLYVIVQLKQARHKQVVGYQNMVMRDTFKIRYLV
FT                   AASAALALITTRQYKVQQVLWVFSVWLESVAIMPQLFMLSKAGKADALTSHYIFALGFY
FT                   RAMYIPNWIWRYYVENRFDKVAVVAGVVQTLIYSDFFYIYYRKVIREGANFELPV"
     atgaacccat tcaggctact gggcgatgcg tcgcacttgg cgagcatttt ggtgttgata        60
     agtaccatcc agcggactca ggcgattgat gggatatcgc tgaagacaca ggtactatat       120
     ttcgtcgtgt tcgtgacgcg gtacctggac ttgttcacca aatggcggtc gctctacaac       180
     acgttgatga aggtgttctt catcagctcg tcgctgtacg tgattgtgca gctgaagcag       240
     gcgcgccaca agcaagtggt gggataccag aacatggtga tgcgggacac ctttaaaatc       300
     aggtacctgg tggcggcaag tgccgcgctg gcgctgatca cgacacgcca atacaaggta       360
     caacaggtgc tatgggtatt ctcggtctgg ttggagagcg tggctattat gccacagttg       420
     tttatgctgt cgaaggcggg gaaggcagac gccttgacgt cacactacat ttttgccctg       480
     ggtttctacc gggccatgta tattccgaac tggatttggc gctactacgt ggagaaccgc       540
     tttgacaagg tggcagttgt tgcgggcgtg gtacagacac tgatctactc ggacttcttc       600
     tacatctact acaggaaggt gatacgtgag ggcgcgaact ttgagcttcc tgtataa          657
//

If you have problems or comments...

PBIL Back to PBIL home page